A white threadlike worm which causes elephantiasis, lymphangitis, and chyluria by interfering with the lymphatic circulation. The microfilaria are found in the circulating blood and are carried by mosquitoes.
A species of parasitic nematode causing Malayan filariasis and having a distribution centering roughly on the Malay peninsula. The life cycle of B. malayi is similar to that of WUCHERERIA BANCROFTI, except that in most areas the principal mosquito vectors belong to the genus Mansonia.
A genus of filarial nematodes.
Infections with nematodes of the superfamily FILARIOIDEA. The presence of living worms in the body is mainly asymptomatic but the death of adult worms leads to granulomatous inflammation and permanent fibrosis. Organisms of the genus Elaeophora infect wild elk and domestic sheep causing ischemic necrosis of the brain, blindness, and dermatosis of the face.
Parasitic infestation of the human lymphatic system by WUCHERERIA BANCROFTI or BRUGIA MALAYI. It is also called lymphatic filariasis.
An anthelmintic used primarily as the citrate in the treatment of filariasis, particularly infestations with Wucheria bancrofti or Loa loa.
The prelarval stage of Filarioidea in the blood and other tissues of mammals and birds. They are removed from these hosts by blood-sucking insects in which they metamorphose into mature larvae.
Pharmacological agents destructive to nematodes in the superfamily Filarioidea.
A filarial worm of Southeast Asia, producing filariasis and elephantiasis in various mammals including man. It was formerly included in the genus WUCHERERIA.
Any part or derivative of a helminth that elicits an immune reaction. The most commonly seen helminth antigens are those of the schistosomes.
A superfamily of nematodes of the suborder SPIRURINA. Its organisms possess a filiform body and a mouth surrounded by papillae.
A mixture of mostly avermectin H2B1a (RN 71827-03-7) with some avermectin H2B1b (RN 70209-81-3), which are macrolides from STREPTOMYCES avermitilis. It binds glutamate-gated chloride channel to cause increased permeability and hyperpolarization of nerve and muscle cells. It also interacts with other CHLORIDE CHANNELS. It is a broad spectrum antiparasitic that is active against microfilariae of ONCHOCERCA VOLVULUS but not the adult form.
A benzimidazole broad-spectrum anthelmintic structurally related to MEBENDAZOLE that is effective against many diseases. (From Martindale, The Extra Pharmacopoeia, 30th ed, p38)
Immunoglobulins produced in a response to HELMINTH ANTIGENS.
A genus of parasitic nematodes whose organisms are distributed in Central and South America. Characteristics include a smooth cuticle and an enlarged anterior end.
Deoxyribonucleic acid that makes up the genetic material of helminths.
A species of parasitic nematode found in man and other mammals. It has been reported from Malaya and East Pakistan and may produce symptoms of tropical eosinophilia.
A genus of mosquitoes (CULICIDAE) commonly found in tropical regions. Species of this genus are vectors for ST. LOUIS ENCEPHALITIS as well as many other diseases of man and domestic and wild animals.
The collective name for the islands of the central Pacific Ocean, including the Austral Islands, Cook Islands, Easter Island, HAWAII; NEW ZEALAND; Phoenix Islands, PITCAIRN ISLAND; SAMOA; TONGA; Tuamotu Archipelago, Wake Island, and Wallis and Futuna Islands. Polynesians are of the Caucasoid race, but many are of mixed origin. Polynesia is from the Greek poly, many + nesos, island, with reference to the many islands in the group. (From Webster's New Geographical Dictionary, 1988, p966 & Room, Brewer's Dictionary of Names, 1992, p426)
A filarial parasite primarily of dogs but occurring also in foxes, wolves, and humans. The parasite is transmitted by mosquitoes.
A genus of bacteria comprised of a heterogenous group of gram-negative small rods and coccoid forms associated with arthropods. (From Bergey's Manual of Systematic Bacteriology, vol 1, 1984)
Proteins found in any species of helminth.
A group of islands of SAMOA, in the southwest central Pacific. Its capital is Pago Pago. The islands were ruled by native chiefs until about 1869. An object of American interest beginning in 1839, Pago Pago and trading and extraterritorial rights were granted to the United States in 1878. The United States, Germany, and England administered the islands jointly 1889-99, but in 1899 they were granted to the United States by treaty. The Department of the Interior has administered American Samoa since 1951. (From Webster's New Geographical Dictionary, 1988, p44)
A country consisting of the eastern half of the island of New Guinea and adjacent islands, including New Britain, New Ireland, the Admiralty Islands, and New Hanover in the Bismarck Archipelago; Bougainville and Buka in the northern Solomon Islands; the D'Entrecasteaux and Trobriand Islands; Woodlark (Murua) Island; and the Louisiade Archipelago. It became independent on September 16, 1975. Formerly, the southern part was the Australian Territory of Papua, and the northern part was the UN Trust Territory of New Guinea, administered by Australia. They were administratively merged in 1949 and named Papua and New Guinea, and renamed Papua New Guinea in 1971.
A genus of parasitic nematodes found throughout the rain-forest areas of the Sudan and the basin of the Congo. L. loa inhabits the subcutaneous tissues, which it traverses freely.
A republic in the Greater Antilles in the West Indies. Its capital is Port-au-Prince. With the Dominican Republic it forms the island of Hispaniola - Haiti occupying the western third and the Dominican Republic, the eastern two thirds. Haiti belonged to France from 1697 until its rule was challenged by slave insurrections from 1791. It became a republic in 1820. It was virtually an American protectorate from 1915 to 1934. It adopted its present constitution in 1964 and amended it in 1971. The name may represent either of two Caribbean words, haiti, mountain land, or jhaiti, nest. (From Webster's New Geographical Dictionary, 1988, p481 & Room, Brewer's Dictionary of Names, 1992, p225)
Agents destructive to parasitic worms. They are used therapeutically in the treatment of HELMINTHIASIS in man and animal.
A family of the order DIPTERA that comprises the mosquitoes. The larval stages are aquatic, and the adults can be recognized by the characteristic WINGS, ANIMAL venation, the scales along the wing veins, and the long proboscis. Many species are of particular medical importance.
Insects that transmit infective organisms from one host to another or from an inanimate reservoir to an animate host.
A genus of parasitic nematodes found in the peritoneal cavity of wild or domestic cattle or equines.
A genus of parasitic nematodes whose organisms live and breed in skin and subcutaneous tissues. Onchocercal microfilariae may also be found in the urine, blood, or sputum.
Infection with nematodes of the genus MANSONELLA. Symptoms include pruritus, headache, and articular swelling.
An island group and constitutional monarchy in the southwest central Pacific Ocean. The capital is Apia. The islands were jointly administered by England, the United States, and Germany 1889-99, with the chief islands of Savai'i and Upolu recognized as German until 1919. Western Samoa gained independence in 1962 and assumed its present formal name in 1997.
The constant presence of diseases or infectious agents within a given geographic area or population group. It may also refer to the usual prevalence of a given disease with such area or group. It includes holoendemic and hyperendemic diseases. A holoendemic disease is one for which a high prevalent level of infection begins early in life and affects most of the child population, leading to a state of equilibrium such that the adult population shows evidence of the disease much less commonly than do children (malaria in many communities is a holoendemic disease). A hyperendemic disease is one that is constantly present at a high incidence and/or prevalence rate and affects all groups equally. (Last, A Dictionary of Epidemiology, 3d ed, p53, 78, 80)
Either of a pair of tubular structures formed by DUCTUS DEFERENS; ARTERIES; VEINS; LYMPHATIC VESSELS; and nerves. The spermatic cord extends from the deep inguinal ring through the INGUINAL CANAL to the TESTIS in the SCROTUM.
A republic of southeast Asia, northwest of Thailand, long familiar as Burma. Its capital is Yangon, formerly Rangoon. Inhabited by people of Mongolian stock and probably of Tibetan origin, by the 3d century A.D. it was settled by Hindus. The modern Burmese state was founded in the 18th century but was in conflict with the British during the 19th century. Made a crown colony of Great Britain in 1937, it was granted independence in 1947. In 1989 it became Myanmar. The name comes from myanma, meaning the strong, as applied to the Burmese people themselves. (From Webster's New Geographical Dictionary, 1988, p192 & Room, Brewer's Dictionary of Names, 1992, p367)
A subfamily of the Muridae consisting of several genera including Gerbillus, Rhombomys, Tatera, Meriones, and Psammomys.
A republic in western Africa, lying between GHANA on its west and BENIN on its east. Its capital is Lome.
A subfamily in the family MURIDAE, comprising the Old World MICE and RATS.
A filarial nematode parasite of mammalian blood with the vector being a tick or small fly.
A cutaneous pouch of skin containing the testicles and spermatic cords.
A country in western Africa, east of MAURITANIA and south of ALGERIA. Its capital is Bamako. From 1904-1920 it was known as Upper Senegal-Niger; prior to 1958, as French Sudan; 1958-1960 as the Sudanese Republic and 1959-1960 it joined Senegal in the Mali Federation. It became an independent republic in 1960.
Ribonucleic acid in helminths having regulatory and catalytic roles as well as involvement in protein synthesis.
The presence of parasites (especially malarial parasites) in the blood. (Dorland, 27th ed)
Drugs used to treat or prevent parasitic infections.
An enzyme that activates aspartic acid with its specific transfer RNA. EC 6.1.1.12.
A genus of mosquitoes (CULICIDAE) frequently found in tropical and subtropical regions. YELLOW FEVER and DENGUE are two of the diseases that can be transmitted by species of this genus.
The small RNAs which provide spliced leader sequences, SL1, SL2, SL3, SL4 and SL5 (short sequences which are joined to the 5' ends of pre-mRNAs by TRANS-SPLICING). They are found primarily in primitive eukaryotes (protozoans and nematodes).
A genus of mosquitoes (CULICIDAE) that are known vectors of MALARIA.
A republic in western Africa, south of BURKINA FASO and west of TOGO. Its capital is Accra.
An immunoassay utilizing an antibody labeled with an enzyme marker such as horseradish peroxidase. While either the enzyme or the antibody is bound to an immunosorbent substrate, they both retain their biologic activity; the change in enzyme activity as a result of the enzyme-antibody-antigen reaction is proportional to the concentration of the antigen and can be measured spectrophotometrically or with the naked eye. Many variations of the method have been developed.
The joining of RNA from two different genes. One type of trans-splicing is the "spliced leader" type (primarily found in protozoans such as trypanosomes and in lower invertebrates such as nematodes) which results in the addition of a capped, noncoding, spliced leader sequence to the 5' end of mRNAs. Another type of trans-splicing is the "discontinuous group II introns" type (found in plant/algal chloroplasts and plant mitochondria) which results in the joining of two independently transcribed coding sequences. Both are mechanistically similar to conventional nuclear pre-mRNA cis-splicing. Mammalian cells are also capable of trans-splicing.
Binary classification measures to assess test results. Sensitivity or recall rate is the proportion of true positives. Specificity is the probability of correctly determining the absence of a condition. (From Last, Dictionary of Epidemiology, 2d ed)
The genetic complement of a helminth (HELMINTHS) as represented in its DNA.
The major immunoglobulin isotype class in normal human serum. There are several isotype subclasses of IgG, for example, IgG1, IgG2A, and IgG2B.
For Wuchereria Spp. of the Malayi Group i.e., W. Malayi (Brug, 1927), W. Pahangi Buckley and Edeson, 1956, and W. Patei Buckley ... malayi?) from a Monkey (Macaca irus) and from Cats in Malaya, and on Wuchereria pahangi n.sp. from a Dog and a Cat". Journal of ... As such S. Sundar Rao and P.A. Maplestone assigned the name Wuchereria malayi in 1940. The scientific name was retained for two ... Edeson, J. F. B.; Wilson, T. (1964). "The Epidemiology of Filariasis Due to Wuchereria Bancroft and Brugia Malayi". Annual ...
Compared to infections with other filarial parasites such as Wuchereria bancrofti, Brugia malayi, and Loa loa, Mansonella ... Such lateral gene transfer has occurred in various geographic isolates of B. malayi, in which a fraction of the Wolbachia ... Another study evaluated the effectiveness of ivermectin and albendazole in M. perstans and Wuchereria bancrofti coinfection in ... September 2003). "Clinical characteristics of post-treatment reactions to ivermectin/albendazole for Wuchereria bancrofti in a ...
Adults and larva can be naturally infected with Wuchereria bancrofti and Batai virus in India, and Burgia malayi in Sri Lanka. ...
Three types of worms are known to cause the disease: Wuchereria bancrofti, Brugia malayi, and Brugia timori, with Wuchereria ... thread-like parasitic worms such as Wuchereria bancrofti (the most common), Brugia malayi, and Brugia timori, all of which are ... The immune response elicited by this vaccine has been demonstrated to be protective against both W. bancrofti and B. malayi ... On September 20, 2007, geneticists published the first draft of the complete genome (genetic content) of Brugia malayi, one of ...
The life cycle of Brugia timori is very similar to that of Wuchereria bancrofti and Brugia malayi, leading to nocturnal ... The microfilariae of Brugia timori are longer and morphologically distinct from those of Brugia malayi and Wuchereria bancrofti ... malayi. Also, the sheath of B. timori does not stain pink with Giemsa stain as is observed with B. malayi and W. bancrofti. The ... malayi but not W. bancrofti. B. timori microfilariae are slightly larger than B. malayi microfilariae. Aside from vectoring ...
... including lymphatic filariasis caused by infection with Wuchereria bancrofti, Brugia malayi, or Brugia timori; tropical ...
Lymphatic filariasis is caused by the worms Wuchereria bancrofti, Brugia malayi, and Brugia timori. These worms occupy the ... However, different species of filarial worms tend to affect different parts of the body; Wuchereria bancrofti can affect the ... "Doxycycline as a novel strategy against bancroftian filariasis-depletion of Wolbachia endosymbionts from Wuchereria bancrofti ... "Macrofilaricidal activity after doxycycline treatment of Wuchereria bancrofti: a double-blind, randomised placebo-controlled ...
In cases of lymphatic filariasis (elephantiasis) caused by Wuchereria bancrofti or Brugia malayi, albendazole is sometimes ... Since Brugia malayi relies on symbiotic Wolbachia, this would mean that albendazole is targeting both the worm and its ...
... chronic infection of Wuchereria bancrofti or Brugia malayi, two mosquito-borne parasites of Africa and Southeast Asia, ...
Brugia malayi Brugia timori Wuchereria bancrofti Three other medically important parasitic species are: Loa loa causes Loa loa ...
In the parasitic filarial nematode species responsible for elephantiasis, such as Brugia malayi and Wuchereria bancrofti, ... The second Wolbachia genome to be determined was one that infects Brugia malayi nematodes. Genome sequencing projects for ... 2005). "The Wolbachia Genome of Brugia malayi: Endosymbiont Evolution within a Human Pathogenic Nematode". PLOS Biology. 3 (4 ... 2005). "The Wolbachia Genome of Brugia malayi: Endosymbiont Evolution within a Human Pathogenic Nematode". PLOS Biology. 3 (4 ...
Wuchereria bancrofti, Brugia malayi infection) Onchocerciasis (Onchocerca volvulus infection) Soil-transmitted helminthiasis - ... Finally, Wuchereria, Onchocerca, and Dracunculus are transmitted by mosquitoes and flies. In the developing world, the use of ...
... effective against Wuchereria bancrofti, Brugia malayi, Brugia timori, and Loa loa. Pyrantel pamoate - effective against most ...
It is one of the three parasitic worms, together with Brugia malayi and B. timori, that infect the lymphatic system to cause ... In 1921, Léon Seurat erected the genus Wuchereria and placed this worm in it as Wuchereria bancrofti. W. bancrofti is ... Wuchereria bancrofti is a filarial (arthropod-borne) nematode (roundworm) that is the major cause of lymphatic filariasis. ... "Wuchereria bancrofti: The causative agent of Bancroftian Filariasis". ww.nematodes.org. Archived from the original on 3 January ...
... ". Edeson, J. F. B. & Wilson, T. (1964), "The epidemiology of filariasis due to Wuchereria Bancrofti and Brugia ... Based on the similarities with W. bancrofti, Rao and Mapelstone proposed to call the parasite Wuchereria malayi. After the ... B. malayi microfilariae also have a characteristic cephalic space ratio of 2:1. B. malayi is transmitted by a mosquito vector. ... Buckley proposed to divide the old genus Wuchereria, into two genera, Wuchereria and introduced a new Brugia after the original ...
Rajagopalan.P.K., Kazmi.S.J. and Mani.T.R. Some aspects of transmission of Wuchereria bancrofti and ecology of the vector Culex ... RAJAGOPALAN, P.K., PANICKER, K.N., & PANI, S.P. Impact of 50 years of vector control on the prevalence of Brugia malayi in ... Frequency Distribution of Wuchereria Bancrofti Microfilariae in Human Populations and Its Relationships with Age and Sex. ... "Frequency Distribution of Wuchereria Bancroft! Microfilariae in Human Populations and Its Relationships with Age and Sex". ...
... wuchereria MeSH B01.500.500.294.700.750.700.300.708.150 - wuchereria bancrofti MeSH B01.500.500.294.700.750.700.680 - ... brugia malayi MeSH B01.500.500.294.700.750.700.300.088.550 - brugia pahangi MeSH B01.500.500.294.700.750.700.300.208 - ...
The syndrome is caused by a distinct hypersensitive immunological reaction to microfilariae of W. bancrofti and Brugia malayi. ... and is caused by Wuchereria bancrofti, a filarial infection. It occurs most frequently in India and Southeast Asia. Tropical ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ... Brugia malayi, Brugia timori lymph nodes blood samples tropical regions of Asia arthropods ... Wuchereria bancrofti lymphatic system thick blood smears stained with hematoxylin. tropical and subtropical mosquito, bites at ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ...
Wuchereria bancrofti and Brugia malayi Lymphocytic choriomeningitis Lymphocytic choriomeningitis virus (LCMV) Malaria ...
Wuchereria bancrofti/Brugia malayi/Brugia timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum/Gnathostoma ...
Wuchereria bancrofti/Brugia malayi/Brugia timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum/Gnathostoma ...
Wuchereria bancrofti/Brugia malayi/Brugia timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum/Gnathostoma ...
September 2007). "Draft genome of the filarial nematode parasite Brugia malayi". Science. 317 (5845): 1756-60. Bibcode:2007Sci ... Wuchereria bancrofti, human-infecting filarial parasite Capitella teleta, polychaete (2007, 2013) Helobdella robusta, leech ( ... Brugia malayi (Strain:TRS), human-infecting filarial parasite (2007) Bursaphelenchus xylophilus, infects pine trees (2011) ...
B74.0) Filariasis due to Wuchereria bancrofti *Elephantiasis, filarial (ILDS B74.01). *(B74.1) Filariasis due to Brugia malayi ...
Combination therapy with ivermectin plus albendazole is effective for treatment of Lymphatic filariasis due to Wuchereria ... bancrofti,[23] Brugia malayi, or Brugia timori.[24] Arthropod[edit]. Evidence supports its use against parasitic arthropods and ... worm-productivity loss after diethylcarbamazine-albendazole or ivermectin-albendazole combination therapy against Wuchereria ...
O segundo xenoma de Wolbachia secuenciado foi o da especie que infecta ao nematodo Brugia malayi.[25] Están en marcha proxectos ... 2003). "Doxycycline as a novel strategy against bancroftian filariasis-depletion of Wolbachia endosymbionts from Wuchereria ... No nematodo parasito filarial Brugia malayi, Wolbachia converteuse nun endosimbionte obrigado e proporciona ao seu hóspede ... "Macrofilaricidal activity after doxycycline treatment of Wuchereria bancrofti: a double-blind, randomised placebo-controlled ...
Sababaraha spésiés Anopheles ogé bisa jadi véktor Dirofilaria immitis, Filariidae Wuchereria bancrofti, jeung Brugia malayi, ...
... chronic infection of Wuchereria bancrofti or Brugia malayi, two mosquito-borne parasites of Africa and Southeast Asia, ...
Wuchereria bancrofti / Brugia malayi / ,B. timori *Lymphatic filariasis. Thelazioidea. *Gnathostoma spinigerum / G. hispidum * ...
B74.0) Filarioza, ki jo povzroča Wuchereria bancrofti *Bankroftska elefantiaza, bankroftska filarioza ... B74.1) Filarioza, ki jo povzroča Brugia malayi. *(B74.2) Filarioza, ki jo povzroča Brugia timori ...
Wuchereria *Wuchereria bancrofti (parasite of humans, cause of "bancroftian filariasis"). *Wuchereria kalimantani (parasite of ... Brugia malayi (one cause of filariasis in humans). *Brugia pahangi (parasite of domestic cats and wild animals) ...
Wuchereria bancrofti and Brugia malayi. Lymphocytic choriomeningitis. Lymphocytic choriomeningitis virus (LCMV). Malaria. ...
A 2019 report identified dogs in Kerala who have another worm which can cause filariasis, Brugia malayi. This worm is not known ... 99% of infections in India happen when the mosquito Culex quinquefasciatus spreads the worm Wuchereria bancrofti through a ... Sadarama, PV; Chirayath, D; Pillai, UN; Unny, NM; Lakshmanan, B; Sunanda, C (December 2019). "Canine Brugia malayi ...
... and Wuchereria bancrofti at a controlled rate of 1 degree C/min by use of a freezing tank. Microfilariae of each of these ... This method was used to cryopreserve microfilariae of Dirofilaria immitis, Brugia malayi, ... f Short report: A practical technique for the cryopreservation of Dirofilaria immitis, Brugia malayi, and Wuchereria bancrofti ... This method was used to cryopreserve microfilariae of Dirofilaria immitis, Brugia malayi, and Wuchereria bancrofti at a ...
These results provide direct evidence that individual microfilariae of W. bancrofti as well as B. malayi release prostaglandins ... was examined in individual microfilariae of Wuchereria bancrofti and Brugia malayi. Following incubation of living ... Release of Prostaglandin E2 by Microfilariae of Wuchereria bancrofti and Brugia malayi * Authors: Leo X. Liu, Janet E. Buhlmann ... was examined in individual microfilariae of Wuchereria bancrofti and Brugia malayi. Following incubation of living ...
Développement de Wuchereria bancrofti (Cobbold) et de Wuchereria malayi (Brug). (IIe partie) Ann. Parasitol. Hum. Comp., 1956, ... Evolution de Wuchereria bancrofti et W. malayi chez Aëdes (Stegomyia) ægypti et A. (S.) albopictus H. Galliard ... La filariose à Wuchereria bancrofti var Pacifica à Tahiti et dans larchipel de la société Ann. Parasitol. Hum. Comp., 1949, 24 ...
Wuchereria bancrofti and Brugia malayi EIA. Serum or plasma separated from cells. ...
Wuchereria Bancrofti. Brugia Malayi. Diethylcarbamazine (DEC). Ivermectin. To Top. *For Patients and Families ...
Wuchereria Bancrofti. Loa Loa. Brugia Malayi. Brugia Timori. Onchocerca Volvulus. Mansonella Perstans. Mansonella Ozzardi. ... Persons between 3 and 100 years of age diagnosed with or suspected of infection with Wuchereria bancrofti, Bugia malayi, ...
Wuchereria bancrofti, Brugia malayi, and B. timori are considered human parasites as animal reservoirs are of minor ... Microfilariae of Wuchereria bancrofti.. The microfilariae of Wuchereria bancrofti are sheathed and measure 240-300 µm in ... Microfilariae of Brugia malayi. Microfilariae of Brugia malayi are sheathed and in stained blood smears measure 175-230 µm. In ... Brugia malayi adults in tissue. Brugia spp. have typical features of filarial nematodes in cross-section. Females reach a ...
Og4C3 circulating antigen test was confirmed to be a good marker of active Wuchereria bancrofti infection. ... Og4C3 circulating antigen, anti-Brugia malayi IgG and IgG4 titers in Wuchereria bancrofti infected patients, according to their ... article{Chanteau1994Og4C3CA, title={Og4C3 circulating antigen, anti-Brugia malayi IgG and IgG4 titers in Wuchereria bancrofti ... Og4C3 circulating antigen test was confirmed to be a good marker of active Wuchereria bancrofti infection. ...
Full text: Available Index: IMSEAR (South-East Asia) Main subject: Testis / Wuchereria / Wuchereria bancrofti / Elephantiasis, ... Full text: Available Index: IMSEAR (South-East Asia) Main subject: Testis / Wuchereria / Wuchereria bancrofti / Elephantiasis, ... Development of Brugia malayi in Mongolian gerbils previously exposed to Wuchereria bancrof ... Development of Brugia malayi in Mongolian gerbils previously exposed to Wuchereria bancrofti. ...
Epidemiology of Brugia malayi infection and its co-existence with Wuchereria bancrofti in and around Sillaberia PHC, District ... Epidemiology of Brugia malayi infection and its co-existence with Wuchereria bancrofti in and around Sillaberia PHC, District ... Of 2186 persons investigated in thirteen villages of Sillaberia PHC, 19 were found to be infected with Brugia malayi and only ... one person harboured microfilaria (mf) of Wuchereria bancrofti. Similarly 41 persons exhibited signs and symptoms of chronic ...
Full text: Available Index: IMSEAR (South-East Asia) Main subject: Wuchereria / Wuchereria bancrofti / Brugia / Female / Humans ... Full text: Available Index: IMSEAR (South-East Asia) Main subject: Wuchereria / Wuchereria bancrofti / Brugia / Female / Humans ... Scanning electron microscopic study of third-stage larva of Wuchereria bancrofti and Brugia malayi in Thailand. ... Scanning electron microscopic study of third-stage larva of Wuchereria bancrofti and Brugi ...
3.3.4.13 Wuchereria bancrofti and Brugia malayi 326. 3.3.4.14 Onchocerca volvulus 330 ...
Wuchereria bancrofti, Brugia malayi and Brugia timori (120). Acute adeno-lymphangitis and acute filarial lymphangitis, ...
Study Midterm III (Leiel) Different order flashcards from Leiel Lalo
Wuchereria bancrofti. - Brugia malayi. - Brugia timori. - Loa loa. 17 TISSUE NEMATODES. - Parastrongylus/Angiostrongylus. - ...
Here, the lymphatic system is infected by the following types of worm: Wuchereria bancrofti, Brugia malayi and Brugia timori. ...
Wolbachia endosymbiont of Wuchereria bancrofti. 330. UniRef90_Q5GSR3. UPI0003001ED0. Wolbachia endosymbiont of Brugia malayi ... Brugia malayi (strain TRS)Imported. Automatic assertion inferred from database entriesi ... Brugia malayi (strain TRS) OX=292805 GN=Wbm0373 PE=3 SV=1 MMFNFPNTRLRRRRSSKWVRNLTSESALSVNDLIFPLFVHDREETTELVSSLPGMKCYSI ...
Filariasis: WUCHERERIA BANCROFTI; BRUGIA MALAYI. Leprosy: MYCOBACTERIUM LEPRAE. Measles: PARAMYXO VIRUS. German measles: TOGA ...
Wuchereria bancrofti. Brucella abortus. Influenza. Brugia malayi. Listeria monocytogenes. Dengue. Loa loa. ...
For Wuchereria Spp. of the Malayi Group i.e., W. Malayi (Brug, 1927), W. Pahangi Buckley and Edeson, 1956, and W. Patei Buckley ... malayi?) from a Monkey (Macaca irus) and from Cats in Malaya, and on Wuchereria pahangi n.sp. from a Dog and a Cat". Journal of ... As such S. Sundar Rao and P.A. Maplestone assigned the name Wuchereria malayi in 1940. The scientific name was retained for two ... Edeson, J. F. B.; Wilson, T. (1964). "The Epidemiology of Filariasis Due to Wuchereria Bancroft and Brugia Malayi". Annual ...
... of patients with Wuchereria Bancrofti Infection - Dr. Magapu Solomon Sudhakar - Doctoral Thesis / Dissertation - Medicine - ... Wuchereria bancrofti and Brugia malayi cause lymphatic filariasis, and Onchocerca volvulus causes onchocerciasis (river ... Species-specific DNA probes developed for Brugia malayi, Wuchereria bancrofti, Onchocerca volvulus and Loa loa (Nutman et al ... Lymphatic filariasis caused by Wuchereria bancrofti and Brugia malayi is a major debilitating disease in the developing ...
wuchereria bancrofti & brugia malayi. Causative agent, vector and the symptoms of Rocky Mountain spotted fever. wood tick, rash ...
Filarial nematodes Wuchereria bancrofti, Brugia malayi, and B. timori.. TRANSMISSION. Through the bite of infected Aedes, Culex ...
Wuchereria bancrofti: J9BIN2 ; Haemonchus placei: A0A0N4W9S7 ; Onchocerca volvulus: A0A044TMQ9 ; Brugia pahangi: A0A0N4TLS2 ; ... Brugia malayi: A0A4E9FFK1 ; A0A0K0JD75 ; Acanthocheilonema viteae: A0A498SFA0 ; Toxocara canis: A0A0B2W330 ; Ascaris suum: ...
The L1 larvae of W.bancrofti and B.malayi develop to L3 larvae in the... ...
Wuchereria bancrofti. 1.3.4.2. Brugia malayi. 1.4. Virus. 1.4.1. Pneumonia. 1.4.1.1. SARS ...
Wuchereria bancrofti and Brugia malayi; both are threadlike worms that lie coiled up in the lymph vessels for decades. ...
Lymphatic group - Includes Wuchereria bancrofti, Brugia malayi, and Brugia timori * Body-cavity group - Includes M perstans and ... B malayi is found in similar locations but not in sub-Saharan Africa. B timori occurs on Timor Island, in Indonesia. (See ... Infection with B timori appears to result in more abscesses than infection with B malayi or W bancrofti. (See the image below.) ... B malayi elephantiasis is more likely to affect the upper and lower limbs, with genital pathology and chyluria being rare. ...
... we describe intraperitoneal development of the FR3 strain of Brugia malayi in Mongolian jirds (Meriones unguiculatus). The ... for Wuchereria spp. of the malayi group, i.e., W. malayi (Brug, 1927), W. pahangi Buckley and Edeson, 1956, and W. patei ... malayi?) from a monkey (Macaca irus) and from cats in Malaya, and on Wuchereria pahangi n.sp. from a dog and a cat. J ... Wuchereria bancrofti (Cobbold, 1877), Brugia malayi (Brug, 1927), and Brugia timori (Partono, Purnomo, Dennis, Atmosoedjono, ...
  • Humans (for B. malayi and B. timori), and animals (for B. pahangi and B. patei) acts as the definitive hosts in which the adult worms cause filariasis. (wikipedia.org)
  • The two other filarial causes of lymphatic filariasis are Wuchereria bancrofti and Brugia timori, which both differ from B. malayi morphologically, symptomatically, and in geographical extent. (wikipedia.org)
  • The disease is spread by mosquitoes that carry the filarial worms Wuchereria bancrofti, Brugia malayi, and Brugia timori. (webwire.com)
  • It is a disease caused by a group of nematode worms belonging to the order "Filariidae" and transmitted to man by the infective bites of blood-sucking arthropods in man, and caused by three parasites namely: Wuchereria bancrofti (Wb), Brugia malayi (Bm) and Brugia timori (Bt). (thefreedictionary.com)
  • One of the two types, known as filariasis, is caused by thread-like parasitic worms such as Wuchereria bancrofti, Brugia malayi and Brugia timori , all of which parasites being transmitted by mosquitoes. (thefreedictionary.com)
  • About 120 million people live in 83 countries in Africa, Asia and the Pacific are infected with LF, primarily by Wuchereria bancrofii and to a lesser extent, by Brugia malayi and Brugia timori (3-5). (thefreedictionary.com)
  • Lymphatic filariasis, a disease caused by filarial parasites, Wuchereria bancrofti, Brugia malayi and Brugia timori , is a major health problem with nearly 1. (thefreedictionary.com)
  • It is a mosquito-borne disease caused by tissue-dwelling nematodes of Brugia malayi, Brugia timori , and Wuchereria bancrofti species [ 1 , 3 ] and is estimated to affect about 120 million people worldwide [ 4 - 6 ]. (hindawi.com)
  • Lymphatic filariasis - Wuchereria bancrofti , Brugia malayi , and Brugia timori . (healthhype.com)
  • The parasites that cause LF (Wuchereria bancrofti, Brugia malayi, Brugia timori) are transmitted by mosquitoes and live in the lymphatic system of sufferers. (cartercenter.org)
  • Wuchereria subjects, they ingest MF along with their bancrofti , Brugia malayi and B. timori . (who.int)
  • The three main worms include Wuchereria bancrofti , Brugia malayi , and B. timori. (lymphedemapeople.com)
  • These parasites include Wuchereria brancofti , Brugia malayi as well as Brugia timori . (insecthobbyist.com)
  • In lymphatic filariasis, the filarial worms Wuchereria bancrofti , Brugia malayi , and Brugia timori are the species associated with it. (biology-online.org)
  • The disease is caused by three species of thread-like nematode worms, known as filariae - Wuchereria bancrofti , Brugia malayi and Brugia timori . (who.int)
  • Worldwide approximately 68 million people are infected with lymphatic filariasis (Lf), provoked by Wuchereria bancrofti, Brugia malayi and Brugia timori. (usda.gov)
  • A filariasis that is characterized by the thickening of the skin and underlying tissues, especially in the legs, male genitals and female breasts, caused by thread-like parasitic worms Wuchereria bancrofti, Brugia malayi or Brugia timori, which inhabit the lymphatics. (jax.org)
  • Lymphatic filariasis (LF) is a chronic, debilitating vector-borne disease caused by the filarial parasites Wuchereria bancrofti, Brugia malayi and B. timori . (biomedcentral.com)
  • Lymphatic Filariasis, also known as Elephantiasis, is a parasitic infection caused by the Wuchereria bancrofti , B rugia malayi , and Brugia timori nematode worms transmitted to humans through the bite of infected Aedes, Culex, Anopheles, and Mansonia mosquitoes. (iamat.org)
  • Unilateral left lower leg elephantiasis secondary to Wuchereria bancrofti infection in a boy. (medscape.com)
  • Elephantiasis resulting from B. malayi infection typically affects the distal portions of the extremities. (wikipedia.org)
  • Wuchereria bancrofti , one parasite targeted by effort to eliminate elephantiasis. (sciencemag.org)
  • Of particular consequence was its ability to clear infections in humans involving the microfilariae of Onchocerca volvulus , the cause of river blindness , and Wuchereria bancrofti and Brugia malayi , the major causes of lymphatic filariasis ( elephantiasis ). (britannica.com)
  • Some patients develop lymphatic dysfunction causing lymphedema and elephantiasis (frequently in the lower extremities) and, with Wuchereria bancrofti, hydrocele and scrotal elephantiasis. (parasitetesting.com)
  • The film portrayed children and adults suffering from a chronic elephantiasis , one of the end products of the filariasis that spreads through the operation of the life cycle of worms that are also called nematodes (specifically, often Wuchereria bancrofti and Brugia malayi) . (hubpages.com)
  • Persons infected with lymph dwelling filarial nematodes such as Wuchereria bancrofti and Brugia malayi may be completely asymptomatic or can present a wide spectrum of clinical manifestations, including chronic elephantiasis, hydrocoeles, and chyluria (1). (annals.org)
  • Evaluation of Wuchereria bancrofti GST as a vaccine candidate for lymphatic filariasis. (nih.gov)
  • Immunological characterization of recombinant Wuchereria bancrofti cuticular collagen (COL-4) as putative vaccine candidate for human lymphatic filariasis. (nih.gov)
  • The Wuchereria bancrofti orthologue of Brugia malayi SXP1 and the diagnosis of bancroftian filariasis. (nih.gov)
  • Brugia malayi is a filarial (arthropod-borne) nematode (roundworm), one of the three causative agents of lymphatic filariasis in humans. (wikipedia.org)
  • B. malayi is one of the causative agents of lymphatic filariasis, a condition marked by infection and swelling of the lymphatic system. (wikipedia.org)
  • It is an early manifestation of filariasis, usually occurs in the inguinal area during B. malayi infection and can occur before the worms mature. (wikipedia.org)
  • Abscess formation and ulceration of the affected lymph node occasionally occurs during B. malayi infection, more often than in Bancroftian filariasis. (wikipedia.org)
  • There are eight different kinds of this worm, out of which three should take care of causing the disorder:Wucheria bancrofti and Brugia malayi cause lymphatic filariasis, and Onchocera volvulus causes onchocerciasis( river blindness). (selfgrowth.com)
  • Many cases of filariasis are generated by the parasite called Wuchereria bancrofti. (selfgrowth.com)
  • Another parasite called Brugia malayi also causes the vector Mansonia, and Anopheles mosquitoes transmit filariasis. (selfgrowth.com)
  • The thread-like, parasitic filarial worms Wuchereria bancrofti and Brugia malayi that cause lymphatic filariasis live almost exclusively in humans. (lymphedemapeople.com)
  • Lymphatic filariasis is a parasitic disease caused by microscopic, thread-like worms (Wuchereria bancrofti and Brugia malayi). (nd.edu)
  • The nematodes that cause chronic human lymphatic filariasis, Brugia malayi and Wuchereria bancrofti , are among the parasites that induce immune suppression. (asm.org)
  • Brugia malayi is a filarial nematode, which causes lymphatic filariasis in humans. (mdpi.com)
  • Brugia malayi , one of the causative agents of lymphatic filariasis, falls under the category of nematodes that infects human and animals. (mdpi.com)
  • Three of these are responsible for most of the morbidity due to filariasis: Wuchereria bancrofti and Brugia malayi cause lymphatic filariasis, and Onchocerca volvulus causes onchocerciasis (river blindness). (parasitetesting.com)
  • The typical vector for Brugia malayi filariasis are mosquito species from the genera Mansonia and Aedes. (parasitetesting.com)
  • Loaisis or loa loa filariasis is caused by the parasitic worm Loa Loa versus either the Wuchereria bancrofti,or the Brugia malayi. (lymphedemapeople.com)
  • The control of lymphatic filariasis (LF) caused by Wuchereria bancrofti in the Central African Region has been hampered by the presence of Loa loa due to severe adverse events that arise in the treatment with ivermectin. (biomedcentral.com)
  • Expression of defensin, cecropin, and transferrin in Aedes aegypti (Diptera: Culicidae) infected with Wuchereria bancrofti (Spirurida: Onchocercidae), and the abnormal development of nematodes in the mosquito. (semanticscholar.org)
  • A number of other mammalian-parasitic nematodes, including the giant roundworm Ascaris suum and the tissue-dwelling filarial nematode Brugia malayi , are also now amenable to transgenesis and/or RNAi in some contexts. (biologists.org)
  • By comparing these genomes to that of another filarial parasite, Brugia malayi, and to those of several other nematodes, we demonstrate synteny among filariae but not with nonparasitic nematodes. (broadinstitute.org)
  • Persons between 3 and 100 years of age diagnosed with or suspected of infection with Wuchereria bancrofti, Bugia malayi, Onchocerca volvulus, Loa loa, or other parasitic worms may be eligible for this study. (clinicaltrials.gov)
  • Of these, the most significant are Wuchereria bancrofti , Brugia malayi , and Onchocerca volvulus . (isradiology.org)
  • Humans from Wuchereria bancrofti endemic area elicit substantial immune response to proteins of the filarial parasite Brugia malayi and its endosymbiont Wolbachia. (nih.gov)
  • Infections with the helminth parasite Brugia malayi share many key features with Th2-mediated allergic diseases, including recruitment of eosinophils. (jimmunol.org)
  • In a murine model of filarial infection, the human nematode parasite Brugia malayi is surgically implanted into the peritoneal cavity of mice ( 15 , 16 , 19 , 20 ) where the recruitment of both AAMφ and eosinophils occurs. (jimmunol.org)
  • It is caused by a nematode parasite, wuchereria bancrofti, and W.Malayi. (expertsmind.com)
  • We describe the 91.4-Mb genome of L. loa and that of the related filarial parasite Wuchereria bancrofti and predict 14,907 L. loa genes on the basis of microfilarial RNA sequencing. (broadinstitute.org)
  • This study suggests that gerbils are able to develop partial resistance to Brugia malayi following a previous infection with Wuchereria bancrofti . (bvsalud.org)
  • Humans are the exclusive hosts of infection with Wuchereria bancrofti. (coursera.org)
  • Short report: A practical technique for the cryopreservation of Dirofilaria immitis, Brugia malayi, and Wuchereria bancrofti microfilariae. (ajtmh.org)
  • This method was used to cryopreserve microfilariae of Dirofilaria immitis, Brugia malayi, and Wuchereria bancrofti at a controlled rate of 1 degree C/min by use of a freezing tank. (ajtmh.org)
  • These results provide direct evidence that individual microfilariae of W. bancrofti as well as B. malayi release prostaglandins into their microenvironment. (ajtmh.org)
  • Adults produce microfilariae, measuring 177 to 230 μm in length and 5 to 7 μm in width, which are sheathed and have nocturnal periodicity (in some regions B. malayi may be sub-periodic, and note that microfilariae are usually not produced in B. pahangi infections). (cdc.gov)
  • Wuchereria bancrofti and Brugia microfilariae have a diurnal periodicity. (proprofs.com)
  • Cytochemical localization of carbohydrate residues in microfilariae of Wuchereria bancrofti and Brugia malayi. (degruyter.com)
  • Development of B. malayi in humans is most frequently modeled in the domestic shorthair cat ( Felis catus ) or in the Mongolian jird ( Meriones unguiculatus ), commonly referred to as the Mongolian gerbil, with the jird model being most popular because they are easier to handle and more economical to maintain than cats. (springer.com)
  • B. malayi is transmitted by Mansonia mosquitoes and is restricted to South and Southeast Asia. (wikipedia.org)
  • and Mansonia mosquitoes are the carriers of B. malayi . (thefreedictionary.com)
  • Développement de Wuchereria bancrofti (Cobbold) et de Wuchereria malayi (Brug). (parasite-journal.org)
  • It was for this reason that Brug gave the original name Microfilaria (Filaria) malayi. (wikipedia.org)
  • Wuchereria bancrofti is responsible for infective larvae within 10-15 days. (who.int)
  • Twelve Mongolian gerbils , Meriones unguiculatus, were infected with 100 third-stage larvae of Wuchereria bancrofti . (bvsalud.org)
  • One month later these animals , along with 4 control animals , were given 100 third-stage larvae of Brugia malayi . (bvsalud.org)
  • The L1 larvae of W.bancrofti and B.malayi develop to L3 larvae in the. (proprofs.com)
  • Patent infections are produced by injecting infective third-stage larvae (L3) of B. malayi subcutaneously (SQ) into jirds. (springer.com)
  • In this study, we infected BALB/c mice with infective larvae stage-3 of Brugia malayi (Bm-L3) and studied their effect on the polarization of splenic MΦs. (frontiersin.org)
  • The adult worms outwardly resemble those of Wuchereria bancrofti but are smaller. (cdc.gov)
  • The disease is caused by the parasitic filarial worms Wuchereria bancrofti and Brugia malayi. (bmj.com)
  • As the post genomic approach, Kaliraj's team has identified more than 20 targets of diagnostic and prophylactic importance from the cDNA libraries of Brugia Malayi and Wuchereria bancrofti, the filaria causing parasital worms. (hindustantimes.com)
  • The adult worms resemble those of Wuchereria bancrofti but are smaller. (parasitetesting.com)
  • Development and replication of B. malayi occurs in two discrete phases: in the mosquito vector and in the human. (wikipedia.org)
  • Mosquito: The mosquito serves as a biological vector and intermediate host - it is required for the developmental cycle and transmission of B. malayi. (wikipedia.org)
  • Og4C3 circulating antigen, anti-Brugia malayi IgG and IgG4 titers in Wuchereria bancrofti infected patients, according to their parasitological status. (semanticscholar.org)
  • Og4C3 circulating antigen test was confirmed to be a good marker of active Wuchereria bancrofti infection. (semanticscholar.org)
  • [ 9 ] Wuchereria bancrofti can be detected via by circulating filarial antigen (CFA) assays. (medscape.com)
  • Wuchereria bancrofti is transmitted by Culex species. (coursera.org)
  • It was originally believed to be similar or closely related to another filarial roundworm then named Microfilaria bancrofti (now Wuchereria bancrofti), described by an English naturalist Thomas Spencer Cobbold in 1877. (wikipedia.org)
  • The first species discovered was B. malayi. (wikipedia.org)
  • They are so similar that even after a decade of research, there were still arguments of B. malayi as a separate and valid species. (wikipedia.org)
  • When a new species (now called Brugia pahangi) was discovered in 1956 from dog and cat, J. J. C. Buckley and J. F. B. Edeson named it Wuchereria pahangi after the village Pahang in Malay, where it was discovered. (wikipedia.org)
  • Another species Wuchereria patei was described by Buckley, with G. S. Nelson and R. B. Heisch, in 1958. (wikipedia.org)
  • Buckley reexamined all the Wuchereria species in 1960, and concluded that the genus should contain only W. bancrofti. (wikipedia.org)
  • 1973 ), and IP-derived B. pahangi and B. malayi have been widely used for decades, however the developmental timing for neither species has been reported for the IP model. (springer.com)
  • This is surprising because the majority of B. malayi and its sister species B. pahangi that are used for molecular, immunologic, and -omics studies are generated using the IP jird model. (springer.com)
  • Certain rare species like Brugia malayi can also affect some animal species. (coursera.org)
  • However, the origin and evolution of the species in the Wuchereria-Brugia clade remain unclear. (bireme.br)
  • CONCLUSIONS: The newly described species appears most closely related to Wuchereria spp. (bireme.br)
  • Adult male jirds were IP infected with 150 freshly isolated FR3 strain B. malayi L3s at UW Oshkosh using standard methods (Michalski et al. (springer.com)
  • Adult Wuchereria are often lodged transmission of infection, and these combi- in the lymphatics of the spermatic cord, nations impressively reduce MF by 99% causing scrotal damage and swelling. (who.int)
  • Of 2186 persons investigated in thirteen villages of Sillaberia PHC, 19 were found to be infected with Brugia malayi and only one person harboured microfilaria (mf) of Wuchereria bancrofti. (who.int)
  • The primary organism currently used for laboratory study of LF is B. malayi because the entire life cycle can be propagated experimentally. (springer.com)
  • The temporal expression of defensin, cecropin and transferrin was assessed in Aedes aegypti naturally refractory to Wuchereria bancrofti upon infection with this worm, in parallel to analysis of filarial development in the insect. (semanticscholar.org)
  • In the present study, we describe intraperitoneal development of the FR3 strain of Brugia malayi in Mongolian jirds ( Meriones unguiculatus ). (springer.com)
  • He created a new genus Brugia in honour of the original discoverer, thus renaming B. malayi, B. pahangi, and B. patei. (wikipedia.org)
  • Immunogenicity and Protective Efficacy of Brugia malayi Heavy Chain Myosin as Homologous DNA, Protein and Heterologous DNA/Protein Prime Boost Vaccine in Rodent Model. (nih.gov)
  • Brugia malayi: comparison of protective immune responses induced by Bm-alt-2 DNA, recombinant Bm-ALT-2 protein and prime-boost vaccine regimens in a jird model. (nih.gov)
  • IMSEAR at SEARO: Epidemiology of Brugia malayi infection and its co-existence with Wuchereria bancrofti in and around Sillaberia PHC, District Midnapur, West Bengal. (who.int)
  • Brugia malayi there is restricted to Southeast Asia. (coursera.org)
  • 90% of worldwide infections, with 9% quitoes transmit the infection from person caused by B. malayi in southeast and east- to person. (who.int)