Brugia malayi: A species of parasitic nematode causing Malayan filariasis and having a distribution centering roughly on the Malay peninsula. The life cycle of B. malayi is similar to that of WUCHERERIA BANCROFTI, except that in most areas the principal mosquito vectors belong to the genus Mansonia.Brugia: A filarial worm of Southeast Asia, producing filariasis and elephantiasis in various mammals including man. It was formerly included in the genus WUCHERERIA.Filariasis: Infections with nematodes of the superfamily FILARIOIDEA. The presence of living worms in the body is mainly asymptomatic but the death of adult worms leads to granulomatous inflammation and permanent fibrosis. Organisms of the genus Elaeophora infect wild elk and domestic sheep causing ischemic necrosis of the brain, blindness, and dermatosis of the face.Microfilaria: The prelarval stage of Filarioidea in the blood and other tissues of mammals and birds. They are removed from these hosts by blood-sucking insects in which they metamorphose into mature larvae.Elephantiasis, Filarial: Parasitic infestation of the human lymphatic system by WUCHERERIA BANCROFTI or BRUGIA MALAYI. It is also called lymphatic filariasis.Filarioidea: A superfamily of nematodes of the suborder SPIRURINA. Its organisms possess a filiform body and a mouth surrounded by papillae.Brugia pahangi: A species of parasitic nematode found in man and other mammals. It has been reported from Malaya and East Pakistan and may produce symptoms of tropical eosinophilia.Wolbachia: A genus of bacteria comprised of a heterogenous group of gram-negative small rods and coccoid forms associated with arthropods. (From Bergey's Manual of Systematic Bacteriology, vol 1, 1984)Helminth Proteins: Proteins found in any species of helminth.Gerbillinae: A subfamily of the Muridae consisting of several genera including Gerbillus, Rhombomys, Tatera, Meriones, and Psammomys.Antigens, Helminth: Any part or derivative of a helminth that elicits an immune reaction. The most commonly seen helminth antigens are those of the schistosomes.Wuchereria bancrofti: A white threadlike worm which causes elephantiasis, lymphangitis, and chyluria by interfering with the lymphatic circulation. The microfilaria are found in the circulating blood and are carried by mosquitoes.Antibodies, Helminth: Immunoglobulins produced in a response to HELMINTH ANTIGENS.Murinae: A subfamily in the family MURIDAE, comprising the Old World MICE and RATS.DNA, Helminth: Deoxyribonucleic acid that makes up the genetic material of helminths.Dipetalonema: A filarial nematode parasite of mammalian blood with the vector being a tick or small fly.Dirofilaria immitis: A filarial parasite primarily of dogs but occurring also in foxes, wolves, and humans. The parasite is transmitted by mosquitoes.RNA, Helminth: Ribonucleic acid in helminths having regulatory and catalytic roles as well as involvement in protein synthesis.Aspartate-tRNA Ligase: An enzyme that activates aspartic acid with its specific transfer RNA. EC 6.1.1.12.Filaricides: Pharmacological agents destructive to nematodes in the superfamily Filarioidea.Diethylcarbamazine: An anthelmintic used primarily as the citrate in the treatment of filariasis, particularly infestations with Wucheria bancrofti or Loa loa.RNA, Spliced Leader: The small RNAs which provide spliced leader sequences, SL1, SL2, SL3, SL4 and SL5 (short sequences which are joined to the 5' ends of pre-mRNAs by TRANS-SPLICING). They are found primarily in primitive eukaryotes (protozoans and nematodes).Culicidae: A family of the order DIPTERA that comprises the mosquitoes. The larval stages are aquatic, and the adults can be recognized by the characteristic WINGS, ANIMAL venation, the scales along the wing veins, and the long proboscis. Many species are of particular medical importance.Onchocerca: A genus of parasitic nematodes whose organisms live and breed in skin and subcutaneous tissues. Onchocercal microfilariae may also be found in the urine, blood, or sputum.Trans-Splicing: The joining of RNA from two different genes. One type of trans-splicing is the "spliced leader" type (primarily found in protozoans such as trypanosomes and in lower invertebrates such as nematodes) which results in the addition of a capped, noncoding, spliced leader sequence to the 5' end of mRNAs. Another type of trans-splicing is the "discontinuous group II introns" type (found in plant/algal chloroplasts and plant mitochondria) which results in the joining of two independently transcribed coding sequences. Both are mechanistically similar to conventional nuclear pre-mRNA cis-splicing. Mammalian cells are also capable of trans-splicing.Genome, Helminth: The genetic complement of a helminth (HELMINTHS) as represented in its DNA.Genes, Helminth: The functional hereditary units of HELMINTHS.Host-Parasite Interactions: The relationship between an invertebrate and another organism (the host), one of which lives at the expense of the other. Traditionally excluded from definition of parasites are pathogenic BACTERIA; FUNGI; VIRUSES; and PLANTS; though they may live parasitically.Symbiosis: The relationship between two different species of organisms that are interdependent; each gains benefits from the other or a relationship between different species where both of the organisms in question benefit from the presence of the other.Pleural Cavity: Paired but separate cavity within the THORACIC CAVITY. It consists of the space between the parietal and visceral PLEURA and normally contains a capillary layer of serous fluid that lubricates the pleural surfaces.Nematoda: A class of unsegmented helminths with fundamental bilateral symmetry and secondary triradiate symmetry of the oral and esophageal structures. Many species are parasites.Anopheles: A genus of mosquitoes (CULICIDAE) that are known vectors of MALARIA.Haemonchus: A genus of parasitic nematode worms which infest the duodenum and stomach of domestic and wild herbivores, which ingest it with the grasses (POACEAE) they eat. Infestation of man is accidental.Aedes: A genus of mosquitoes (CULICIDAE) frequently found in tropical and subtropical regions. YELLOW FEVER and DENGUE are two of the diseases that can be transmitted by species of this genus.Tropical Medicine: The branch of medicine concerned with diseases, mainly of parasitic origin, common in tropical and subtropical regions.Benzothiazoles: Compounds with a benzene ring fused to a thiazole ring.Strongyloides stercoralis: A species of parasitic nematode widely distributed in tropical and subtropical countries. The females and their larvae inhabit the mucosa of the intestinal tract, where they cause ulceration and diarrhea.Strongyloidiasis: Infection with nematodes of the genus STRONGYLOIDES. The presence of larvae may produce pneumonitis and the presence of adult worms in the intestine could lead to moderate to severe diarrhea.Thiabendazole: 2-Substituted benzimidazole first introduced in 1962. It is active against a variety of nematodes and is the drug of choice for STRONGYLOIDIASIS. It has CENTRAL NERVOUS SYSTEM side effects and hepatototoxic potential. (From Smith and Reynard, Textbook of Pharmacology, 1992, p919)IndiaStrongyloides: A genus of parasitic nematodes widely distributed as intestinal parasites of mammals.Loa: A genus of parasitic nematodes found throughout the rain-forest areas of the Sudan and the basin of the Congo. L. loa inhabits the subcutaneous tissues, which it traverses freely.Onchocerca volvulus: A species of parasitic nematodes widely distributed throughout central Africa and also found in northern South America, southern Mexico, and Guatemala. Its intermediate host and vector is the blackfly or buffalo gnat.Trichostrongyloidea: A superfamily of nematodes. Most are intestinal parasites of ruminants and accidentally in humans. This superfamily includes seven genera: DICTYOCAULUS; HAEMONCHUS; Cooperia, OSTERTAGIA; Nematodirus, TRICHOSTRONGYLUS; and Hyostrongylus.Trichostrongyloidiasis: Infection by roundworms of the superfamily TRICHOSTRONGYLOIDEA, including the genera TRICHOSTRONGYLUS; OSTERTAGIA; Cooperia, HAEMONCHUS; Nematodirus, Hyostrongylus, and DICTYOCAULUS.Ostertagia: A genus of parasitic nematodes occurring in the stomach of ruminants.Ostertagiasis: A disease of herbivorous mammals, particularly cattle and sheep, caused by stomach worms of the genus OSTERTAGIA.Abomasum: The fourth stomach of ruminating animals. It is also called the "true" stomach. It is an elongated pear-shaped sac lying on the floor of the abdomen, on the right-hand side, and roughly between the seventh and twelfth ribs. It leads to the beginning of the small intestine. (From Black's Veterinary Dictionary, 17th ed)Nematode Infections: Infections by nematodes, general or unspecified.Sheep Diseases: Diseases of domestic and mountain sheep of the genus Ovis.Quinestrol: The 3-cyclopentyl ether of ETHINYL ESTRADIOL. After gastrointestinal absorption, it is stored in ADIPOSE TISSUE, slowly released, and metabolized principally to the parent compound. It has been used in ESTROGEN REPLACEMENT THERAPY. (From AMA Drug Evaluations Annual, 1992, p1011)Karyometry: Microscopic study of the spacial distribution pattern of CHROMATIN in CELL NUCLEI and CELL NUCLEOLI.
of the Malayi Group i.e., W. Malayi (Brug, 1927), W. Pahangi Buckley and Edeson, 1956, and W. Patei Buckley, Nelson and Heisch ... malayi?) from a Monkey (Macaca irus) and from Cats in Malaya, and on Wuchereria pahangi n.sp. from a Dog and a Cat". Journal of ... Humans (for B. malayi and B. timori), and animals (for B. pahangi and B. patei) acts as the definitive hosts in which the adult ... They are so similar that even after a decade of research, there were still arguments of B. malayi as a separate and valid ...
The immune response elicited by this vaccine has been demonstrated to be protective against both W. bancrofti and B. malayi ... Three types of worms are known to cause the disease: Wuchereria bancrofti, Brugia malayi, and Brugia timori, with Wuchereria ... On September 20, 2007, geneticists published the first draft of the complete genome (genetic content) of Brugia malayi, one of ... Brugia malayi, and Brugia timori (also known as B. timori), all of which are transmitted by bites from infected mosquitoes. It ...
September 21, 2007). "Draft Genome of the Filarial Nematode Parasite Brugia malayi". Science. 317 (5845): 1756-1760. Bibcode: ... Brugia malayi (Strain:TRS), human-infecting filarial parasite (2007) Bursaphelenchus xylophilus, infects pine trees (2011) ...
It is a vector of nocturnally subperiodic Brugia malayi. Females are known to be strongly anthropophilic (human biters). Larvae ... to nocturnally subperiodic Brugia malayi (Spirurida: Filariodea)". J Med Entomol. 39: 215-7. PMID 11931259. "Bionomics". ENVIS ...
Brugia malayi (one cause of filariasis in humans). *Brugia pahangi (parasite of domestic cats and wild animals) ...
... malayi. Also, the sheath of B. timori does not stain pink with Giemsa stain as is observed with B. malayi and W. bancrofti. ... B. timori microfilariae have nuclei that extend to the tip of the tail, which is also characteristic of B. malayi but not W. ... The life cycle of Brugia timori is very similar to that of Wuchereria bancrofti and Brugia malayi, leading to nocturnal ... The microfilariae of Brugia timori are longer and morphologically distinct from those of Brugia malayi and Wuchereria bancrofti ...
"Mining predicted essential genes of Brugia malayi for nematode drug targets". PLoS One. 2 (11): e1189. doi:10.1371/journal.pone ...
2005). "The Wolbachia genome of Brugia malayi: endosymbiont evolution within a human pathogenic nematode". PLoS Biol. 3 (4): ...
The second Wolbachia genome to be determined was one that infects Brugia malayi nematodes. Genome sequencing projects for ... In the parasitic filarial nematode species responsible for elephantiasis, such as Brugia malayi and Wuchereria bancrofti, ... 2005). "The Wolbachia Genome of Brugia malayi: Endosymbiont Evolution within a Human Pathogenic Nematode". PLOS Biology. 3 (4 ... 2005). "The Wolbachia Genome of Brugia malayi: Endosymbiont Evolution within a Human Pathogenic Nematode". PLOS Biology. 3 (4 ...
These diseases include: lymphatic filariasis caused by infection with Wuchereria bancrofti, Brugia malayi, or Brugia timori; ...
Geography of Malaysia "A Record of the Buddhist Religion as Practiced in India and the Malay ... - I-Tsing - Google Books". ...
"Field and laboratory observations on Coquillettidia crassipes in relation to transmission of Brugia malayi in Peninsular ...
His current research focuses on enteric fever and on a rapid antigen detection test for brugia malayi. Honorary Member of ...
The syndrome is caused by a distinct hypersensitive immunological reaction to microfilariae of W. bancrofti and Brugia malayi. ...
Malayikkuthu (Malayikuthu, Malayikkuth) is a dance ritual performed by the people of Malayi sect in Kerala, South India. ...
... other species are secondary or suspected vectors of Brugia malayi the cause of lymphatic filariasis, and Rift Valley fever. ...
There is evidence it is a vector for Japanese encephalitis, as well as the roundworm Brugia malayi in Thailand. Norbert Becker ...
It shows high affinity for human biting and is a potent vector of Brugia malayi to cause Malayan filariasis. In 1980, Japanese ... Natural Mortality of Mansonia annulifera with Special Reference to Mortality due to Brugia malayi Infection and Distribution of ...
Similarly, unlike the common murine research model, M. coucha can support the complete lifecycle of B. malayi, a parasite that ... "Immunization of Mastomys coucha with Brugia malayi Recombinant Trehalose-6-Phosphate Phosphatase Results in Significant ...
The nerve ring (excretory pore) and the nucleus of the excretory cell are said to be similar to B. malayi. Behind the nerve ...
Adults and larva can be naturally infected with Wuchereria bancrofti and Batai virus in India, and Burgia malayi in Sri Lanka. ...
O segundo xenoma de Wolbachia secuenciado foi o da especie que infecta ao nematodo Brugia malayi.[25] Están en marcha proxectos ... No nematodo parasito filarial Brugia malayi, Wolbachia converteuse nun endosimbionte obrigado e proporciona ao seu hóspede ... "The Wolbachia Genome of Brugia malayi: Endosymbiont Evolution within a Human Pathogenic Nematode". PLos Biology 3 (4): e121. ... "The Wolbachia Genome of Brugia malayi: Endosymbiont Evolution within a Human Pathogenic Nematode". PLOS Biology 3 (4): e121. ...
It is one of the three parasitic worms, together with Brugia malayi and B. timori, that infect the lymphatic system to cause ...
Brugia malayi, and other worms and parasites. Another important disadvantage of the existence of tolerance may be ...
Brugia pahangi and Brugia malayi, and, as in other nematodes, code for components of the cuticle". Molecular and Biochemical ...
... malayi; Molecular & Biochemical Parasitology 166, 15-21. Daryl A. Scott, Merel Klaassens, Ashley M. Holder, Kevin P. Lally, ...
Brugia-malayi: gd, CD4-Positive-T-Lymphocytes: ph, Filariasis: ps, Histocompatibility-Antigens-Class-II: ph, Human, Mice, Mice- ... Rajan, T V.; Greiner, D L.; Yates, J A.; and Shultz, L D., " Growth of the human filarial parasite Brugia malayi in mice ... Growth of the human filarial parasite Brugia malayi in mice lacking major histocompatibility complex class II antigen ...
The Wolbachia genome of Brugia malayi: endosymbiont evolution within a human pathogenic nematode. PLoS Biol. 3:e121. ... The annotated genome of Wolbachia from the filarial nematode Brugia malayi: what it means for progress in antifilarial medicine ... malayi (supergroup D) and C. lectularius (supergroup F) (Table 2). In the 37 strains analyzed, there were 25 ftsZ alleles, 26 ... malayi (supergroup D) and the bed bug Cimex lectularius (supergroup F). For other divergent strains the primers worked well for ...
Homologs between H. contortus and A. suum, B. malayi, C. elegans, and T. spiralis were inferred by comparison of all proteins ... malayi, and T. spiralis (around 1,000 to 2,000 and around 100 to 400 bp). Most of the predicted H. contortus genes (Figure 1) ... malayi [15]. C. elegans [116], and T. spiralis [16]. In the final annotation, proteins inferred from genes were classified ... malayi [57], and in the plant-parasitic nematodes Xiphinema index, Heterodera glycines, Meloidogyne incognita, and Radopholus ...
Brugia malayi asparaginyl-transfer RNA synthetase induces chemotaxis of human leukocytes and activates G-protein-coupled ... Eotaxin-1-regulated eosinophils have a critical role in innate immunity against experimental Brugia malayi infection. Eur J ... eotaxin-1/CCL11 knockout mice exhibit decreased eosinophil tissue influx and an inability to clear infection with Brugia malayi ...
The typical vector for Brugia malayi filariasis are mosquito species from the genera Mansonia and Aedes. During a blood meal, ... specifically the life cycle of Brugia malayi. ...
"Species Details : Culex malayi (Leicester, 1908)". Catalogue of Life. Retrieved 4 February 2017. "malayi (Leicester)". ... Culex (Eumelanomyia) malayi is a species of mosquito belonging to the genus Culex. It is found in Bangladesh, Cambodia, China, ...
Hodgesia malayi is a species of zoophilic mosquito belonging to the genus Hodgesia. It is found in Sri Lanka, India, Malaya, ... "Species Details : Hodgesia malayi Leicester, 1908". Catalogue of Life. Retrieved 2 February 2017. "bailyi Barraud". Systematic ...
Brugia malayi chitinase (BmCHT1) is expressed in the microfilarial stage, the first larval stage, of the organism and is ... Brugia malayi chitinase (BmCHT1) is expressed in the microfilarial stage, the first larval stage, of the organism and is ... The microfiliaria of Brugia malayi have been shown to have chitin in their sheaths (3). Antisera to the chitinase temporarily ... insect cells infected with an AcNPV chiA minus recombinant baculovirus carrying the BmCHT1 gene cloned from Brugia malayi ( ...
... malayi. In order to determine more precisely the component of the immune system that mediates murine resistance to B. malayi, ... B lymphocytes are not required for murine resistance to the human filarial parasite, Brugia malayi.. Rajan TV1, Shultz LD, ... We demonstrate that such "B-less" mice are completely resistant to B. malayi. These data, taken in combination with the ... malayi as intact mice. In the current study, we have used mice in which the membrane exon of the immunoglobulin (Ig) mu (heavy ...
J. Foster, M. Ganatra, I. Kamal et al., "The Wolbachia genome of Brugia malayi: endosymbiont evolution within a human ... M. J. Taylor, H. F. Cross, and K. Bilo, "Inflammatory responses induced by the filarial nematode Brugia malayi are mediated by ... Proinflammatory Cytokine Gene Expression by Murine Macrophages in Response to Brugia malayi Wolbachia Surface Protein. Chantima ... "Innate immune responses to endosymbiotic Wolbachia bacteria in Brugia malayi and Onchocerca volvulus are dependent on TLR2, ...
Brugia malayi is a filarial nematode, which causes lymphatic filariasis in humans. In 1995, the disease has been identified by ... Khor, B.Y.; Tye, G.J.; Lim, T.S.; Noordin, R.; Choong, Y.S. The Structure and Dynamics of BmR1 Protein from Brugia malayi: In S ... "The Structure and Dynamics of BmR1 Protein from Brugia malayi: In Silico Approaches." Int. J. Mol. Sci. 15, no. 6: 11082-11099 ... The Structure and Dynamics of BmR1 Protein from Brugia malayi: In Silico Approaches. Bee Yin Khor. ...
Brugia malayi (Filarial nematode worm)Imported. Automatic assertion inferred from database entriesi ... tr,A8PXH7,A8PXH7_BRUMA Ephrin EFN-4, putative OS=Brugia malayi OX=6279 GN=Bm1_37240 PE=3 SV=1 ...
Brugia malayi (strain TRS)Imported. Automatic assertion inferred from database entriesi ... Brugia malayi (strain TRS) OX=292805 GN=Wbm0373 PE=3 SV=1 MMFNFPNTRLRRRRSSKWVRNLTSESALSVNDLIFPLFVHDREETTELVSSLPGMKCYSI ...
Brugia malayi is a filarial nematode, which causes lymphatic filariasis in humans. In 1995, the disease has been identified by ... Brugia malayi (Bm-FAR-1), Brugia pahangi (Bp-FAR-1), Wuchereria bancrofti (Wb-FAR-1) and Loa loa (Ll-FAR-1) were chosen for MSA ... Bm17DIII gene product of B. malayi in this study is the BmR1 protein with 206 amino acids. The structure prediction for BmR1 is ... Brugia malayi is a filarial nematode, which causes lymphatic filariasis in humans. In 1995, the disease has been identified by ...
... study examines the production and persistence of peripheral lymphedema in ferrets experimentally infected with Brugia malayi. ... Peripheral Lymphedema in Ferrets Infected with Brugia malayi * Richard B. Crandall, Catherine A. Crandall, Stephen A. Hines, ... study examines the production and persistence of peripheral lymphedema in ferrets experimentally infected with Brugia malayi. ...
Abstract Sexually mature male and female Brugia malayi were developed from third stage larvae after 60 days in the in vitro ... Cultivation of Sexually Mature Brugia malayi In Vitro * Authors: W. A. Riberu, Soeroto Atmosoedjono, Purnomo, S. Tirtokusumo, M ... Sexually mature male and female Brugia malayi were developed from third stage larvae after 60 days in the in vitro culture ...
Recruitment of macrophages and eosinophils by B. malayi. Implantation of B. malayi filarial parasites into the peritoneal ... Six- to 8-wk-old CBA/Ca or C57BL/6 males were used for B. malayi implantation. Both male and female BALB/c mice were used for ... Because B. malayi is known to secrete homologs (Bm macrophage migration inhibitory factor (MIF)-1 and -2) of the human cytokine ... B. malayi has been recently shown to secrete homologs of the human cytokine MIF (24) that actively stimulate human monocytes ...
Antifilarial activity of intravenous suramin and oral diethylcarbamazine citrate on subperiodic Brugia malayi in the leaf- ... Studies on the chemoprophylaxis of subperiodic Brugia malayi infection in the leaf monkey (Presbytis melalophos) with ... Experimental infection of the leaf-monkeys, Presbytis cristata and Presbytis melalophos with subperiodic Brugia malayi. Acta ... Antifilarial activity of CGP 20376 against subperiodic Brugia malayi in the leaf-monkey Presbytis cristata. Tropical Medicine ...
In the present study, we identified a ~2.0 Kb cDNA clone by immunoscreening of cDNA library of adult female Brugia malayi. The ... Myosin of human lymphatic filarial parasite Brugia malayi. by patoco » Mon Dec 17, 2007 7:28 am ... Molecular cloning, purification and characterisation of myosin of human lymphatic filarial parasite Brugia malayi. Parasitol ... Myosin of human lymphatic filarial parasite Brugia malayi. Wuchereria bancrofti vespid, Immune response, Serum immune complexes ...
B) BALB/c wt (n = 5), IL-4−/− (n = 5), or Stat6−/− (n = 5) mice were injected i.p. with 50 B. malayi L3 infective-stage larvae ... A total of 50 B. malayi L3 infective-stage larvae were injected i.p. into groups of BALB/c wt (n = 9) or TCRβ−/− mice (n = 12 ... BALB/c TCRβ−/− (n = 12) or BALB/c wt mice (n = 9) were injected i.p. with 50 B. malayi L3 infective-stage larvae. At 6 weeks ... T Cells Are Required for Host Protection against Brugia malayi but Need Not Produce or Respond to Interleukin-4. L. Spencer, L ...
We evaluated the antifilarial activity of 6 flavonoids against the human lymphatic filarial parasite Brugia malayi using an in ... Immunomodulatory Activity of Sulfonamide Chalcone Compounds in Mice Infected with Filarial Parasite, Brugia malayi. *Priyanka ... We evaluated the antifilarial activity of 6 flavonoids against the human lymphatic filarial parasite Brugia malayi using an in ... Antifilarial activity in vitro and in vivo of some flavonoids tested against Brugia malayi.. @article{Lakshmi2010AntifilarialAI ...
Brugia malayi L3 were kept in 48 well plate ~200 L3/ml/well in culture medium fortified with 8 U RNase OUT, 1 mM spermidine at ... Effect of in vitro gene silencing on the microfilariae released by female B. malayi adult worm. a, b depict the healthy and ... The effective concentration of siRNA has been optimized earlier in our lab targeted against other B. malayi genes [17, 18]. The ... After treatment of adult female B. malayi with siRNA1 (c), siRNA2 (d), siRNA1 + 2 (e) the eggs were degenerated (shrunken) in ...
togoi is highly susceptible to B. malayi, melanisation responses against B. malayi mf were first noted in the haemocoel of Ae. ... The migration of B. malayi mf from the midgut to thoracic muscles of the highly susceptible mosquitoes Ae. togoi and An. ... malayi mf occurred in the midgut of all mosquito species and was completed within 24 h post-blood meal. ... Brugia malayi microfilariae (mf) and studied the exsheathment, migration and innate immune responses among them. Mosquito- ...
Aiyar, S.,Zaman, V.,Ha, C.S. (1982). Effect of immune serum on Brugia malayi microfilaria: Ultra structural observations. ...
Consultation to Accelerate Elimination of Brugia malayi Transmission in Indonesia and Malaysia, Kota Kinabalu, Malaysia, 13-15 ...
  • They reported the occurrence of a species of human filariae in North Sumatra that was both physiologically and morphologically distinct from the W. bancrofti microfilariae commonly found in Jakarta and named the pathogen Filaria malayi . (meddic.jp)
  • Adults produce microfilariae, measuring 177 to 230 μm in length and 5 to 7 μm in width, which are sheathed and have nocturnal periodicity (in some regions B. malayi may be sub-periodic, and note that microfilariae are usually not produced in B. pahangi infections). (cdc.gov)
  • Behavior of the B. malayi microfilariae in the peripheral blood of human carrier in the intergradation area of Mahakam Delta East Kalimantan. (ugm.ac.id)
  • Patent infections are produced by injecting infective third-stage larvae (L3) of B. malayi subcutaneously (SQ) into jirds. (springer.com)
  • The L1 larvae of W.bancrofti and B.malayi develop to L3 larvae in the. (proprofs.com)
  • By contrast, chemically mediated gene transfer, involving incubation of developing larvae with DNA/calcium co-precipitates, yields fully viable transgenic larvae of B. malayi that can be maintained in laboratory hosts. (wormbook.org)
  • The researchers found that B. malayi has about 2,000 fewer protein-coding genes in its genome than the non-parasitic nematode Caenorhabditis elegans . (nih.gov)
  • The in vitro gene silencing of adult B. malayi parasites was undertaken to observe the effects on parasites. (biomedcentral.com)
  • [ 2 ] However, despite epidemiological studies identifying Filaria malayi in India, Sri Lanka, China, North Vietnam, and Malaysia in the 1930s, Lichentenstein and Brug's hypothesis was not accepted until the 1940s, when Rao and Mapelstone identified two adult worms in India. (meddic.jp)
  • The patent period of infection which reflects the fecundic life span of the adult female worm was estimated for periodic B. malayi in south India by using immigration death model. (who.int)
  • Adult male jirds were IP infected with 150 freshly isolated FR3 strain B. malayi L3s at UW Oshkosh using standard methods (Michalski et al. (springer.com)
  • Bm-TPP gene was found to be expressed in all the major life-stages (Mf, L3 and adult) of B. malayi. (cdri.res.in)
  • MTT reduction assay for adult worm viability also corroborated with the motility findings demonstrating profound adverse effect of target gene silencing on B. malayi viability and survival. (cdri.res.in)
  • Methods: Periodicity examinations were carried out on the microfilarial carriers discovered in the B. malayi endemic area of Mahakam delta. (ugm.ac.id)
  • This represents a major advancement for B. malayi and promises to be a method that is widely applicable to the majority of parasitic nematodes that lack a free-living generation. (wormbook.org)
  • In 1957, two subspecies of human infecting B. malayi were discovered by Turner and Edeson in Malaysia based on the observation of different patterns of microfilaria periodicity. (meddic.jp)
  • Results: Six microfilaria carriers of B. malayi were examined for periodicity study. (ugm.ac.id)
  • Culex (Eumelanomyia) malayi is a species of mosquito belonging to the genus Culex. (wikipedia.org)
  • Hodgesia malayi is a species of zoophilic mosquito belonging to the genus Hodgesia. (wikipedia.org)
  • 1973 ), and IP-derived B. pahangi and B. malayi have been widely used for decades, however the developmental timing for neither species has been reported for the IP model. (springer.com)
  • This is surprising because the majority of B. malayi and its sister species B. pahangi that are used for molecular, immunologic, and -omics studies are generated using the IP jird model. (springer.com)
  • The B. malayi filarial worm was still showing a nonperiodic wave pattern as different subspecies apart from the subperiodic and periodic form of filarial worm. (ugm.ac.id)
  • The primary organism currently used for laboratory study of LF is B. malayi because the entire life cycle can be propagated experimentally. (springer.com)
  • By virtue of the selection procedure, the potential B. malayi drug targets highlight components of key processes in nematode biology such as central metabolism, molting and regulation of gene expression. (elsevier.com)
  • In view of the its vital role in filarial biology and absence of tpp gene in mammals, this enzyme was also exploited as antifilarial drug target by RNA interference studies that validated B. malayi TPP as a promising antifilarial drug target too. (cdri.res.in)
  • Development of B. malayi in humans is most frequently modeled in the domestic shorthair cat ( Felis catus ) or in the Mongolian jird ( Meriones unguiculatus ), commonly referred to as the Mongolian gerbil, with the jird model being most popular because they are easier to handle and more economical to maintain than cats. (springer.com)
  • [ 4 ] Cats, dogs, monkeys, slow lorises, civet cats, and hamsters have all been successfully experimentally infected with B. malayi from man and may serve as important reservoirs. (meddic.jp)
  • The work embodied in the present thesis primarily involves molecular and immunological characterisation of recombinant trehalose-6-phosphate phosphatase of human filariid B. malayi as a possible vaccine candidate. (cdri.res.in)
  • An international team of scientists reported on their completion of the B. malayi draft genome sequence in the September 21, 2007, issue of Science . (nih.gov)
  • Here, we report a morphological temporal study of IP B. malayi development in the jird host and demonstrate that the third molt occurs slightly sooner than reported for SQ B. malay i infection and that the asynchronous fourth molt is earlier and longer in duration than that reported in SQ infected jirds. (springer.com)
  • In order to determine more precisely the component of the immune system that mediates murine resistance to B. malayi, we have used mouse strains in which individual genes involved in the maturation of specific components of the immune system have been disrupted by homologous recombination. (nih.gov)
  • Lichentenstein and Brug first recognized B. malayi as a distinct pathogen in 1927. (meddic.jp)
  • This observation suggests that components of the adaptive (antigen-specific) immune system are obligate requirements for murine resistance to B. malayi. (nih.gov)
  • Several independent studies in murine models have also highlighted the rapid induction of Th2-like responses after infection with B. malayi or B. pahangi . (asm.org)
  • Our laboratory has shown that, in the absence of IL-4 production or when signaling through the IL-4 receptor (IL-4R) or subsequent Stat6 activation is blocked, mice become significantly more susceptible to infection with either B. malayi or B. pahangi ( 2 , 40 ). (asm.org)
  • B. malayi is transmitted by mosquitoes and is restricted to South and South East Asia. (meddic.jp)
  • Sequence comparisons between the two genomes allow us to map C. elegans orthologs to B. Malayi genes. (elsevier.com)
  • Using these orthology mappings and by incorporating the extensive genomic and functional genomic data, including genome-wide RNAi screens, that already exist for C. elegans, we identify potentially essential genes in B. malayi. (elsevier.com)
  • To circumvent this problem, we have utilized the free-living model nematode Caenorhabditis elegans as a surrogate for B. malayi. (elsevier.com)