OrganismsChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsInformation Science
HistidineHistidine DecarboxylaseDiethyl PyrocarbonateHistidine Ammonia-LyaseAmino Acid SequenceMolecular Sequence DataHydrogen-Ion ConcentrationBinding SitesMutagenesis, Site-DirectedATP PhosphoribosyltransferaseHistidinolUrocanate HydrataseProtein KinasesAmino AcidsBacterial ProteinsModels, MolecularKineticsEscherichia coliProtein ConformationAcid Anhydride HydrolasesMutationZincPeptide PHIFormiminoglutamic AcidSequence Homology, Amino AcidBase SequenceHistamineCatalysisHemeCarnosineMethylhistidinesMagnetic Resonance SpectroscopyProtein BindingProtein Structure, TertiaryRecombinant ProteinsFormatesStructure-Activity RelationshipRNA, Transfer, HisCrystallography, X-RayHydroxylamineWhalesAmino Acid SubstitutionOperonProtonsCopperMyoglobinCysteineHemeproteinsSalmonella typhimuriumGene Expression Regulation, BacterialCloning, MolecularSequence AlignmentAspartic AcidRose BengalHistidine-tRNA LigaseCarboxy-LyasesCatalytic DomainOxidation-ReductionProtein Structure, SecondarySubstrate SpecificityAmmonia-LyasesElectron Spin Resonance SpectroscopyHydroxylaminesSpectrum Analysis, RamanHistidinol-PhosphataseAlanineConserved SequenceHydrogen BondingSpectrophotometryLigandsArginineNickelEscherichia coli ProteinsCircular DichroismGenes, BacterialAmino Acid Transport Systems, BasicLysineTryptophanSpectrophotometry, UltravioletModels, ChemicalAmino Acids, EssentialNucleoside-Diphosphate KinaseFIGLU TestPhosphorylationCaulobacter crescentusPhosphoric Monoester HydrolasesSignal TransductionMutagenesisPeptide FragmentsPhotochemistryImidazolesPlasmidsAnserinePhosphotransferases
Histidine
An essential amino acid that is required for the production of HISTAMINE.
Histidine Decarboxylase
An enzyme that catalyzes the decarboxylation of histidine to histamine and carbon dioxide. It requires pyridoxal phosphate in animal tissues, but not in microorganisms. EC 4.1.1.22.
Diethyl Pyrocarbonate
Preservative for wines, soft drinks, and fruit juices and a gentle esterifying agent.
Histidine Ammonia-Lyase
An enzyme that catalyzes the first step of histidine catabolism, forming UROCANIC ACID and AMMONIA from HISTIDINE. Deficiency of this enzyme is associated with elevated levels of serum histidine and is called histidinemia (AMINO ACID METABOLISM, INBORN ERRORS).
Amino Acid Sequence
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Hydrogen-Ion Concentration
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
Binding Sites
The parts of a macromolecule that directly participate in its specific combination with another molecule.
Mutagenesis, Site-Directed
Genetically engineered MUTAGENESIS at a specific site in the DNA molecule that introduces a base substitution, or an insertion or deletion.
ATP Phosphoribosyltransferase
An enzyme that catalyzes the first step of the pathway for histidine biosynthesis in Salmonella typhimurium. ATP reacts reversibly with 5-phosphoribosyl-1-pyrophosphate to yield N-1-(5'-phosphoribosyl)-ATP and pyrophosphate. EC 2.4.2.17.
Histidinol
The penultimate step in the pathway of histidine biosynthesis. Oxidation of the alcohol group on the side chain gives the acid group forming histidine. Histidinol has also been used as an inhibitor of protein synthesis.
Urocanate Hydratase
An enzyme that catalyzes the conversion of 4,5-dihydro-4-oxo-5-imidazolepropanoate to urocanate and water. EC 4.2.1.49.
Protein Kinases
A family of enzymes that catalyze the conversion of ATP and a protein to ADP and a phosphoprotein.
Amino Acids
Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.
Bacterial Proteins
Proteins found in any species of bacterium.
Models, Molecular
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
Kinetics
The rate dynamics in chemical or physical systems.
Escherichia coli
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Protein Conformation
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
Acid Anhydride Hydrolases
A group of enzymes that catalyze the hydrolysis of diphosphate bonds in compounds such as nucleoside di- and tri-phosphates, and sulfonyl-containing anhydrides such as adenylylsulfate. (Enzyme Nomenclature, 1992) EC 3.6.
Mutation
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Zinc
A metallic element of atomic number 30 and atomic weight 65.38. It is a necessary trace element in the diet, forming an essential part of many enzymes, and playing an important role in protein synthesis and in cell division. Zinc deficiency is associated with ANEMIA, short stature, HYPOGONADISM, impaired WOUND HEALING, and geophagia. It is known by the symbol Zn.
Peptide PHI
A 27-amino acid peptide with histidine at the N-terminal and isoleucine amide at the C-terminal. The exact amino acid composition of the peptide is species dependent. The peptide is secreted in the intestine, but is found in the nervous system, many organs, and in the majority of peripheral tissues. It has a wide range of biological actions, affecting the cardiovascular, gastrointestinal, respiratory, and central nervous systems.
Formiminoglutamic Acid
Measurement of this acid in the urine after oral administration of histidine provides the basis for the diagnostic test of folic acid deficiency and of megaloblastic anemia of pregnancy.
Sequence Homology, Amino Acid
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Base Sequence
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Histamine
An amine derived by enzymatic decarboxylation of HISTIDINE. It is a powerful stimulant of gastric secretion, a constrictor of bronchial smooth muscle, a vasodilator, and also a centrally acting neurotransmitter.
Catalysis
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
Heme
The color-furnishing portion of hemoglobin. It is found free in tissues and as the prosthetic group in many hemeproteins.
Carnosine
A naturally occurring dipeptide neuropeptide found in muscles.
Methylhistidines
Histidine substituted in any position with one or more methyl groups.
Magnetic Resonance Spectroscopy
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
Protein Binding
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Protein Structure, Tertiary
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Recombinant Proteins
Proteins prepared by recombinant DNA technology.
Formates
Derivatives of formic acids. Included under this heading are a broad variety of acid forms, salts, esters, and amides that are formed with a single carbon carboxy group.
Structure-Activity Relationship
The relationship between the chemical structure of a compound and its biological or pharmacological activity. Compounds are often classed together because they have structural characteristics in common including shape, size, stereochemical arrangement, and distribution of functional groups.
RNA, Transfer, His
A transfer RNA which is specific for carrying histidine to sites on the ribosomes in preparation for protein synthesis.
Crystallography, X-Ray
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Hydroxylamine
A colorless inorganic compound (HONH2) used in organic synthesis and as a reducing agent, due to its ability to donate nitric oxide.
Whales
Large marine mammals of the order CETACEA. In the past, they were commercially valued for whale oil, for their flesh as human food and in ANIMAL FEED and FERTILIZERS, and for baleen. Today, there is a moratorium on most commercial whaling, as all species are either listed as endangered or threatened.
Amino Acid Substitution
The naturally occurring or experimentally induced replacement of one or more AMINO ACIDS in a protein with another. If a functionally equivalent amino acid is substituted, the protein may retain wild-type activity. Substitution may also diminish, enhance, or eliminate protein function. Experimentally induced substitution is often used to study enzyme activities and binding site properties.
Operon
In bacteria, a group of metabolically related genes, with a common promoter, whose transcription into a single polycistronic MESSENGER RNA is under the control of an OPERATOR REGION.
Protons
Stable elementary particles having the smallest known positive charge, found in the nuclei of all elements. The proton mass is less than that of a neutron. A proton is the nucleus of the light hydrogen atom, i.e., the hydrogen ion.
Copper
A heavy metal trace element with the atomic symbol Cu, atomic number 29, and atomic weight 63.55.
Myoglobin
A conjugated protein which is the oxygen-transporting pigment of muscle. It is made up of one globin polypeptide chain and one heme group.
Cysteine
A thiol-containing non-essential amino acid that is oxidized to form CYSTINE.
Hemeproteins
Proteins that contain an iron-porphyrin, or heme, prosthetic group resembling that of hemoglobin. (From Lehninger, Principles of Biochemistry, 1982, p480)
Salmonella typhimurium
A serotype of Salmonella enterica that is a frequent agent of Salmonella gastroenteritis in humans. It also causes PARATYPHOID FEVER.
Gene Expression Regulation, Bacterial
Any of the processes by which cytoplasmic or intercellular factors influence the differential control of gene action in bacteria.
Cloning, Molecular
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Sequence Alignment
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
Aspartic Acid
One of the non-essential amino acids commonly occurring in the L-form. It is found in animals and plants, especially in sugar cane and sugar beets. It may be a neurotransmitter.
Rose Bengal
A bright bluish pink compound that has been used as a dye, biological stain, and diagnostic aid.
Histidine-tRNA Ligase
An enzyme that activates histidine with its specific transfer RNA. EC 6.1.1.21.
Carboxy-Lyases
Enzymes that catalyze the addition of a carboxyl group to a compound (carboxylases) or the removal of a carboxyl group from a compound (decarboxylases). EC 4.1.1.
Catalytic Domain
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
Oxidation-Reduction
A chemical reaction in which an electron is transferred from one molecule to another. The electron-donating molecule is the reducing agent or reductant; the electron-accepting molecule is the oxidizing agent or oxidant. Reducing and oxidizing agents function as conjugate reductant-oxidant pairs or redox pairs (Lehninger, Principles of Biochemistry, 1982, p471).
Protein Structure, Secondary
The level of protein structure in which regular hydrogen-bond interactions within contiguous stretches of polypeptide chain give rise to alpha helices, beta strands (which align to form beta sheets) or other types of coils. This is the first folding level of protein conformation.
Substrate Specificity
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Ammonia-Lyases
Enzymes that catalyze the formation of a carbon-carbon double bond by the elimination of AMMONIA. EC 4.3.1.
Electron Spin Resonance Spectroscopy
A technique applicable to the wide variety of substances which exhibit paramagnetism because of the magnetic moments of unpaired electrons. The spectra are useful for detection and identification, for determination of electron structure, for study of interactions between molecules, and for measurement of nuclear spins and moments. (From McGraw-Hill Encyclopedia of Science and Technology, 7th edition) Electron nuclear double resonance (ENDOR) spectroscopy is a variant of the technique which can give enhanced resolution. Electron spin resonance analysis can now be used in vivo, including imaging applications such as MAGNETIC RESONANCE IMAGING.
Hydroxylamines
Organic compounds that contain the (-NH2OH) radical.
Spectrum Analysis, Raman
Analysis of the intensity of Raman scattering of monochromatic light as a function of frequency of the scattered light.
Histidinol-Phosphatase
An enzyme that catalyzes the hydrolysis of histidinol-phosphate to histidinol. One of the regulatory enzymes in histidine biosynthesis. EC 3.1.3.15.
Alanine
A non-essential amino acid that occurs in high levels in its free state in plasma. It is produced from pyruvate by transamination. It is involved in sugar and acid metabolism, increases IMMUNITY, and provides energy for muscle tissue, BRAIN, and the CENTRAL NERVOUS SYSTEM.
Conserved Sequence
A sequence of amino acids in a polypeptide or of nucleotides in DNA or RNA that is similar across multiple species. A known set of conserved sequences is represented by a CONSENSUS SEQUENCE. AMINO ACID MOTIFS are often composed of conserved sequences.
Hydrogen Bonding
A low-energy attractive force between hydrogen and another element. It plays a major role in determining the properties of water, proteins, and other compounds.
Spectrophotometry
The art or process of comparing photometrically the relative intensities of the light in different parts of the spectrum.
Ligands
A molecule that binds to another molecule, used especially to refer to a small molecule that binds specifically to a larger molecule, e.g., an antigen binding to an antibody, a hormone or neurotransmitter binding to a receptor, or a substrate or allosteric effector binding to an enzyme. Ligands are also molecules that donate or accept a pair of electrons to form a coordinate covalent bond with the central metal atom of a coordination complex. (From Dorland, 27th ed)
Arginine
An essential amino acid that is physiologically active in the L-form.
Nickel
A trace element with the atomic symbol Ni, atomic number 28, and atomic weight 58.69. It is a cofactor of the enzyme UREASE.
Escherichia coli Proteins
Proteins obtained from ESCHERICHIA COLI.
Circular Dichroism
A change from planar to elliptic polarization when an initially plane-polarized light wave traverses an optically active medium. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Genes, Bacterial
The functional hereditary units of BACTERIA.
Amino Acid Transport Systems, Basic
Amino acid transporter systems capable of transporting basic amino acids (AMINO ACIDS, BASIC).
Lysine
An essential amino acid. It is often added to animal feed.
Tryptophan
An essential amino acid that is necessary for normal growth in infants and for NITROGEN balance in adults. It is a precursor of INDOLE ALKALOIDS in plants. It is a precursor of SEROTONIN (hence its use as an antidepressant and sleep aid). It can be a precursor to NIACIN, albeit inefficiently, in mammals.
Spectrophotometry, Ultraviolet
Determination of the spectra of ultraviolet absorption by specific molecules in gases or liquids, for example Cl2, SO2, NO2, CS2, ozone, mercury vapor, and various unsaturated compounds. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Models, Chemical
Theoretical representations that simulate the behavior or activity of chemical processes or phenomena; includes the use of mathematical equations, computers, and other electronic equipment.
Amino Acids, Essential
Amino acids that are not synthesized by the human body in amounts sufficient to carry out physiological functions. They are obtained from dietary foodstuffs.
Nucleoside-Diphosphate Kinase
An enzyme that is found in mitochondria and in the soluble cytoplasm of cells. It catalyzes reversible reactions of a nucleoside triphosphate, e.g., ATP, with a nucleoside diphosphate, e.g., UDP, to form ADP and UTP. Many nucleoside diphosphates can act as acceptor, while many ribo- and deoxyribonucleoside triphosphates can act as donor. EC 2.7.4.6.
FIGLU Test
A urine test for formiminoglutamic acid, an intermediate metabolite in L-histidine catabolism in the conversion of L-histidine to L-glutamic acid. It may be an indicator of vitamin B12 or folic acid deficiency or liver disease.
Phosphorylation
The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.
Caulobacter crescentus
A species of gram-negative, aerobic bacteria that consist of slender vibroid cells.
Phosphoric Monoester Hydrolases
A group of hydrolases which catalyze the hydrolysis of monophosphoric esters with the production of one mole of orthophosphate. EC 3.1.3.
Signal Transduction
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Mutagenesis
Process of generating a genetic MUTATION. It may occur spontaneously or be induced by MUTAGENS.
Peptide Fragments
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
Photochemistry
Imidazoles
Compounds containing 1,3-diazole, a five membered aromatic ring containing two nitrogen atoms separated by one of the carbons. Chemically reduced ones include IMIDAZOLINES and IMIDAZOLIDINES. Distinguish from 1,2-diazole (PYRAZOLES).
Plasmids
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
Anserine
Phosphotransferases
A rather large group of enzymes comprising not only those transferring phosphate but also diphosphate, nucleotidyl residues, and others. These have also been subdivided according to the acceptor group. (From Enzyme Nomenclature, 1992) EC 2.7.

Possible role for ligand binding of histidine 81 in the second transmembrane domain of the rat prostaglandin F2alpha receptor. (1/5209)

For the five principal prostanoids PGD2, PGE2, PGF2alpha, prostacyclin and thromboxane A2 eight receptors have been identified that belong to the family of G-protein-coupled receptors. They display an overall homology of merely 30%. However, single amino acids in the transmembrane domains such as an Arg in the seventh transmembrane domain are highly conserved. This Arg has been identified as part of the ligand binding pocket. It interacts with the carboxyl group of the prostanoid. The aim of the current study was to analyze the potential role in ligand binding of His-81 in the second transmembrane domain of the rat PGF2alpha receptor, which is conserved among all PGF2alpha receptors from different species. Molecular modeling suggested that this residue is located in close proximity to the ligand binding pocket Arg 291 in the 7th transmembrane domain. The His81 (H) was exchanged by site-directed mutagenesis to Gln (Q), Asp (D), Arg (R), Ala (A) and Gly (G). The receptor molecules were N-terminally extended by a Flag epitope for immunological detection. All mutant proteins were expressed at levels between 50% and 80% of the wild type construct. The H81Q and H81D receptor bound PGF2alpha with 2-fold and 25-fold lower affinity, respectively, than the wild type receptor. Membranes of cells expressing the H81R, H81A or H81G mutants did not bind significant amounts of PGF2alpha. Wild type receptor and H81Q showed a shallow pH optimum for PGF2alpha binding around pH 5.5 with almost no reduction of binding at higher pH. In contrast the H81D mutant bound PGF2alpha with a sharp optimum at pH 4.5, a pH at which the Asp side chain is partially undissociated and may serve as a hydrogen bond donor as do His and Gln at higher pH values. The data indicate that the His-81 in the second transmembrane domain of the PGF2alpha receptor in concert with Arg-291 in the seventh transmembrane domain may be involved in ligand binding, most likely not by ionic interaction with the prostaglandin's carboxyl group but rather as a hydrogen bond donor.  (+info)

R73A and H144Q mutants of the yeast mitochondrial cyclophilin Cpr3 exhibit a low prolyl isomerase activity in both peptide and protein-folding assays. (2/5209)

Previously we reported that the R73A and H144Q variants of the yeast cyclophilin Cpr3 were virtually inactive in a protease-coupled peptide assay, but retained activity as catalysts of a proline-limited protein folding reaction [Scholz, C. et al. (1997) FEBS Lett. 414, 69-73]. A reinvestigation revealed that in fact these two mutations strongly decrease the prolyl isomerase activity of Cpr3 in both the peptide and the protein-folding assay. The high folding activities found previously originated from a contamination of the recombinant Cpr3 proteins with the Escherichia coli protein SlyD, a prolyl isomerase that co-purifies with His-tagged proteins. SlyD is inactive in the peptide assay, but highly active in the protein-folding assay.  (+info)

A possible involvement of aberrant expression of the FHIT gene in the carcinogenesis of squamous cell carcinoma of the uterine cervix. (3/5209)

To investigate involvement of an aberrant expression of the FHIT (fragile histidine triad) gene in the process of carcinogenesis and progression in cervical carcinoma, we examined its expression by the reverse transcriptase polymerase chain reaction (RT-PCR) and cDNA sequence method in 32 cervical invasive carcinomas (25 squamous cell carcinomas and seven adeno- or adenosquamous carcinomas) and 18 of its precursor lesions [four low-grade and 14 high-grade cervical intraepithelial neoplasias (CINs)]. We also examined a link between the occurrence of the aberrant expression and human papillomavirus (HPV). We detected the aberrant FHIT transcripts in 11 of 25 (44%) cervical invasive squamous cell carcinomas and in 5 of 14 (36%) high-grade CINs (CIN 2 or 3), whereas they were not found in seven non-squamous type and four low-grade CINs (CIN 1). The alteration patterns of the FHIT gene expression in high-grade CINs were virtually similar to those found in invasive carcinomas, such that the exons 5-7 were consistently deleted associated or unassociated with loss of the exon 4 and/or 8. The incidence of the aberrant expression was not related to the presence of HPV and its type. These data indicate that the aberrant expression of the FHIT gene is observed in precursor lesions of cervical carcinoma as well as invasive carcinomas, with its incidence not increasing with advance of clinical stage. Given the squamous cell type dominant expression, the aberrant expression may play a critical role in the generation of squamous cell carcinoma of the uterine cervix, but not the consequence of the progression of the cancer.  (+info)

Breaking the low barrier hydrogen bond in a serine protease. (4/5209)

The serine protease subtilisin BPN' is a useful catalyst for peptide synthesis when dissolved in high concentrations of a water-miscible organic co-solvent such as N,N-dimethylformamide (DMF). However, in 50% DMF, the k(cat) for amide hydrolysis is two orders of magnitude lower than in aqueous solution. Surprisingly, the k(cat) for ester hydrolysis is unchanged in 50% DMF. To explain this alteration in activity, the structure of subtilisin 8397+1 was determined in 20, 35, and 50% (v/v) DMF to 1.8 A resolution. In 50% DMF, the imidazole ring of His64, the central residue of the catalytic triad, has rotated approximately 180 degrees around the Cbeta-Cgamma bond. Two new water molecules in the active site stabilize the rotated conformation. This rotation places His64 in an unfavorable geometry to interact with the other members of the catalytic triad, Ser221 and Asp32. NMR experiments confirm that the characteristic resonance due to the low barrier hydrogen bond between the His64 and Asp32 is absent in 50% DMF. These experiments provide a clear structural basis for the change in activity of serine proteases in organic co-solvents.  (+info)

His ... Asp catalytic dyad of ribonuclease A: histidine pKa values in the wild-type, D121N, and D121A enzymes. (5/5209)

Bovine pancreatic ribonuclease A (RNase A) has a conserved His ... Asp catalytic dyad in its active site. Structural analyses had indicated that Asp121 forms a hydrogen bond with His119, which serves as an acid during catalysis of RNA cleavage. The enzyme contains three other histidine residues including His12, which is also in the active site. Here, 1H-NMR spectra of wild-type RNase A and the D121N and D121A variants were analyzed thoroughly as a function of pH. The effect of replacing Asp121 on the microscopic pKa values of the histidine residues is modest: none change by more than 0.2 units. There is no evidence for the formation of a low-barrier hydrogen bond between His119 and either an aspartate or an asparagine residue at position 121. In the presence of the reaction product, uridine 3'-phosphate (3'-UMP), protonation of one active-site histidine residue favors protonation of the other. This finding is consistent with the phosphoryl group of 3'-UMP interacting more strongly with the two active-site histidine residues when both are protonated. Comparison of the titration curves of the unliganded enzyme with that obtained in the presence of different concentrations of 3'-UMP shows that a second molecule of 3'-UMP can bind to the enzyme. Together, the data indicate that the aspartate residue in the His ... Asp catalytic dyad of RNase A has a measurable but modest effect on the ionization of the adjacent histidine residue.  (+info)

Mutational analysis of Bacillus subtilis glutamine phosphoribosylpyrophosphate amidotransferase propeptide processing. (6/5209)

Glutamine phosphoribosylpyrophosphate amidotransferase from Bacillus subtilis is a member of an N-terminal nucleophile hydrolase enzyme superfamily, several of which undergo autocatalytic propeptide processing to generate the mature active enzyme. A series of mutations was analyzed to determine whether amino acid residues required for catalysis are also used for propeptide processing. Propeptide cleavage was strongly inhibited by replacement of the cysteine nucleophile and two residues of an oxyanion hole that are required for glutaminase function. However, significant propeptide processing was retained in a deletion mutant with multiple defects in catalysis that was devoid of enzyme activity. Intermolecular processing of noncleaved mutant enzyme subunits by active wild-type enzyme subunits was not detected in hetero-oligomers obtained from a coexpression experiment. While direct in vitro evidence for autocatalytic propeptide cleavage was not obtained, the results indicate that some but not all of the amino acid residues that have a role in catalysis are also needed for propeptide processing.  (+info)

Metal-catalyzed oxidation of phenylalanine-sensitive 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from Escherichia coli: inactivation and destabilization by oxidation of active-site cysteines. (7/5209)

The in vitro instability of the phenylalanine-sensitive 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase [DAHPS(Phe)] from Escherichia coli has been found to be due to a metal-catalyzed oxidation mechanism. DAHPS(Phe) is one of three differentially feedback-regulated isoforms of the enzyme which catalyzes the first step of aromatic biosynthesis, the formation of DAHP from phosphoenolpyruvate and D-erythrose-4-phosphate. The activity of the apoenzyme decayed exponentially, with a half-life of about 1 day at room temperature, and the heterotetramer slowly dissociated to the monomeric state. The enzyme was stabilized by the presence of phosphoenolpyruvate or EDTA, indicating that in the absence of substrate, a trace metal(s) was the inactivating agent. Cu2+ and Fe2+, but none of the other divalent metals that activate the enzyme, greatly accelerated the rate of inactivation and subunit dissociation. Both anaerobiosis and the addition of catalase significantly reduced Cu2+-catalyzed inactivation. In the spontaneously inactivated enzyme, there was a net loss of two of the seven thiols per subunit; this value increased with increasing concentrations of added Cu2+. Dithiothreitol completely restored the enzymatic activity and the two lost thiols in the spontaneously inactivated enzyme but was only partially effective in reactivation of the Cu2+-inactivated enzyme. Mutant enzymes with conservative replacements at either of the two active-site cysteines, Cys61 or Cys328, were insensitive to the metal attack. Peptide mapping of the Cu2+-inactivated enzyme revealed a disulfide linkage between these two cysteine residues. All results indicate that DAHPS(Phe) is a metal-catalyzed oxidation system wherein bound substrate protects active-site residues from oxidative attack catalyzed by bound redox metal cofactor. A mechanism of inactivation of DAHPS is proposed that features a metal redox cycle that requires the sequential oxidation of its two active-site cysteines.  (+info)

Evidence for the head domain movement of the rieske iron-sulfur protein in electron transfer reaction of the cytochrome bc1 complex. (8/5209)

The three-dimensional structure of the mitochondrial cytochrome bc1 complex suggests that movement of the extramembrane domain (head) of the Rieske iron-sulfur protein (ISP) may play an important role in electron transfer. Such movement requires flexibility in the neck region of ISP, since the head and transmembrane domains of the protein are rather rigid. To test this hypothesis, Rhodobacter sphaeroides mutants expressing His-tagged cytochrome bc1 complexes with cysteine substitution at various positions in the ISP neck (residues 39-48) were generated and characterized. The mutants with a single cysteine substitution at Ala42 or Val44 and a double cysteine substitution at Val44 and Ala46 (VQA-CQC) or at Ala42 and Ala46 (ADVQA-CDVQC) have photosynthetic growth rates comparable with that of complement cells. Chromatophore membrane and intracytoplasmic membrane (ICM) prepared from these mutants have cytochrome bc1 complex activity similar to that in the complement membranes, indicating that flexibility of the neck region of ISP was not affected by these cysteine substitutions. Mutants with a double cysteine substitution at Ala42 and Val44 (ADV-CDC) or at Pro40 and Ala42 (PSA-CSC) have a retarded (50%) or no photosynthetic growth rate, respectively. The ADV-CDC or PSA-CSC mutant ICM contains 20 or 0% of the cytochrome bc1 complex activity found in the complement ICM. However, activity can be restored by the treatment with beta-mercaptoethanol (beta-ME). The restored activity is diminished upon removal of beta-ME but is retained if the beta-ME-treated membrane is treated with the sulfhydryl reagent N-ethylmaleimide or p-chloromercuribenzoic acid. These results indicate that the loss of bc1 complex activity in the ADV-CDC or PSA-CSC mutant membranes is due to disulfide bond formation, which increases the rigidity of ISP neck and, in turn, decreases the mobility of the head domain. Using the conditions developed for the isolation of His-tagged complement cytochrome bc1 complex, a two-subunit complex (cytochromes b and c1) is obtained from all of the double cysteine-substituted mutants. This suggests that introduction of two cysteines in the neck region of ISP weakens the interactions between cytochromes b, ISP, and subunit IV.  (+info)

Generation of a proton motive force by histidine decarboxylation and electrogenic histidine/histamine antiport in Lactobacillus...Generation of a proton motive force by histidine decarboxylation and electrogenic histidine/histamine antiport in Lactobacillus...
Lactobacillus buchneri ST2A vigorously decarboxylates histidine to the biogenic amine histamine, which is excreted into the medium. Cells grown in the presence of histidine generate both a transmembrane pH gradient, inside alkaline, and an electrical potential (delta psi), inside negative, upon addition of histidine. Studies of the mechanism of histidine uptake and histamine excretion in membrane vesicles and proteoliposomes devoid of cytosolic histidine decarboxylase activity demonstrate that histidine uptake, histamine efflux, and histidine/histamine exchange are electrogenic processes. Histidine/histamine exchange is much faster than the unidirectional fluxes of these substrates, is inhibited by an inside-negative delta psi and is stimulated by an inside positive delta psi. These data suggest that the generation of metabolic energy from histidine decarboxylation results from an electrogenic histidine/histamine exchange and indirect proton extrusion due to the combined action of the ...
https://jb.asm.org/content/175/10/2864?ijkey=7c390707fc757394c798d9bf9c09c93f627bfe29&keytype2=tf_ipsecsha
eCite - Evaluation of effects of copper histidine on copper transporter 1-mediated accumulation of platinum and oxaliplatin...eCite - Evaluation of effects of copper histidine on copper transporter 1-mediated accumulation of platinum and oxaliplatin...
Evaluation of effects of copper histidine on copper transporter 1-mediated accumulation of platinum and oxaliplatin-induced neurotoxicity in vitro and in vivo
http://ecite.utas.edu.au/86352
Site-directed mutagenesis of the alpha-toxin gene of Staphylococcus aureus: role of histidines in toxin activity in vitro and...Site-directed mutagenesis of the alpha-toxin gene of Staphylococcus aureus: role of histidines in toxin activity in vitro and...
Staphylococcus aureus alpha-toxin is a membrane-damaging exoprotein that oligomerizes to form transmembrane pores. Chemical modification of histidines with diethylpyrocarbonate has been shown to reduce the hemolytic activity of alpha-toxin, suggesting that one or more of the histidine residues is important for toxin function. To individually assess the functional importance of each of the four histidine residues (residues 35, 48, 144, and 259), we used oligonucleotide-directed mutagenesis of the cloned alpha-toxin gene to replace each histidine with leucine. The mutant toxins were expressed in S. aureus and evaluated for hemolytic activity in vitro and for lethality in an intraperitoneal murine model. Substitution of histidine 35 with leucine produced a mutant toxin (H35L) without hemolytic or lethal activity. Mutant toxins H48L, H144L, and H259L exhibited 7, 16, and 46%, respectively, of the hemolytic activity of wild-type toxin. Immunoblotting of purified H35L toxin incubated with liposomal ...
https://iai.asm.org/content/62/5/1843?ijkey=811535cb5eb9ad8d80efe66d26f82479c9639980&keytype2=tf_ipsecsha
An Arabidopsis Histidine-Containing Phosphotransfer (HPt) Factor Implicated in Phosphorelay Signal Transduction: Overexpression...
Histidine-containing phosphotransfer (HPt) factors from Arabidopsis thaliana, designated as AHPs, function most likely in concert with histidine (His)-kinases (HKs) and response regulators (RRs) in certain multistep histidine (His)→aspartate (Asp) phosphorelays that are involved in the signal transduction mechanisms, by which plant cells appear to respond to certain hormonal stimuli, including cytokinin. Although some previous in vitro results from studies on Arabidopsis AHPs (AHP1 to AHP5) supported this hypothesis, it has not yet been proven. To this end, here we constructed transgenic plants that contained the AHP2 protein in a considerably higher amount than in wild-type plants. Such AHP2-overexpressing young seedlings were examined in comparison with wild-type plants, with special reference to hormone responses; particularly, their inhibitory effects on root elongation of plants grown on agar-plates, and also hypocotyl elongation of etiolated seedlings grown in the dark. The results of ...
http://oxfordindex.oup.com/view/10.1093/pcp/pcf007
Genome-wide comparison of the His-to-Asp phosphorelay signaling components of three symbiotic genera of Rhizobia : DNA Research...
Histidine-to-aspartate (His-Asp) phosphorelay (or two-component) systems are very common signal transduction mechanisms that are implicated in a wide variety of cellular responses to environmental stimuli. The His-Asp phosphorelay components include sensor histidine kinase (HK), phosphotransfer intermediate (HPt), and response regulator (RR). With special reference to three bacterial species (Mesorhizobium loti, Bradyrhizobium japonicum, Sinorhizobium meliloti), each of which belongs to a different genera of Rhizobia, here we attempted to compile all of the His-Asp phosphorelay components in order to reveal a comparative genome-wide overview as to the His-Asp phosphorelay. It was revealed that M. loti has 47 HKs, 1 HPts, and 58 RRs; B. japonicum has 80 HKs, 3 HPts, and 91 RRs; whereas S. meliloti has 40 HKs, 1 HPt, and 58 RRs. These His-Asp phosphorelay components were extensively compiled and characterized. The resulting overview as to the His-Asp phosphorelay of Rhizobia will provide us ...
http://oxfordindex.oup.com/view/10.1093/dnares/11.1.57
Reversible Phosphorylation of Histidine Residues in Proteins from Vertebrates | Science SignalingReversible Phosphorylation of Histidine Residues in Proteins from Vertebrates | Science Signaling
Signaling by kinases and phosphatases that act on serine, threonine, and tyrosine residues of proteins is among the most extensively studied regulatory mechanisms in mammalian cells, and research focused in this area is ongoing. We are just beginning to appreciate that such signaling mechanisms are extended and enriched by the reversible phosphorylation of histidine residues. The most exciting developments in this field to date come from studies on the β subunit of heterotrimeric guanosine triphosphate-binding proteins (G proteins), the enzyme adenosine 5′-triphosphate-citrate lyase, and now the Ca2+-activated K+ channel KCa3.1, all of which are targeted by nucleoside diphosphate kinase (which phosphorylates histidines) and protein histidine phosphatase (which dephosphorylates phosphorylated histidines).. ...
http://stke.sciencemag.org/content/2/61/pe13
Administration and <sup>1</sup>H MRS, detection of histidine in human brain: Application to in vivo pH...
TY - JOUR. T1 - Administration and 1H MRS, detection of histidine in human brain. T2 - Application to in vivo pH measurement. AU - Vermathen, Peter. AU - Capizzano, Aristides A.. AU - Maudsley, Andrew A.. PY - 2000/5/17. Y1 - 2000/5/17. N2 - Measurement of histidine in vivo offers the potential for tissue pH measurement using routinely performed 1H MR spectroscopy. In the brain, however, histidine concentrations are generally too low for reliable measurement. By using oral loading of histidine, this study demonstrates that brain concentrations can be significantly increased, enabling detection of histidine by localized 1H MR measurements and making in vivo pH measurement possible. In studies carried out on healthy human subjects at 1.5 T, a consistent spectral quality downfield from water was achieved using a PRESS sequence at short echo times. Measurements at different TE values helped to characterize the downfield spectral region. Histidine loading of 400 mg/kg of body weight increased brain ...
https://miami.pure.elsevier.com/en/publications/administration-and-sup1suph-mrs-detection-of-histidine-in-human-b
histidine metal chelatinghistidine metal chelating
On 24 Mar 1997, Kathleen Blackwell wrote: , Given a complex nitrogen source with various peptides in solution, would , digesting to various levels of free amino acids lead to a solutions with better , metal chelating properties as the levels of free amino acids rises? My thinking , is that higher levels of free histidine would chelate metals better than , histidine bound in peptides, mostly for steric reasons. Any thought? TIA It might work for most of the cases, but the same steric reasons might enable multiple histidine peptides to bind better. In one of Frances Arnolds papers they are able to show that the His-X-X-X-His arrangement binds the strongest to metal. In short, I think that the answer to your question has to vary depending on the peptide fragment and one cannot always assume that free histidine binds better. My 2 cents worth Rajesh , , , , ************************************ Rajesh Krishnamurthy E-mail: krishnam at umbc7.umbc.edu Tel: (410) 247-8175 ...
http://www.bio.net/bionet/mm/bioforum/1997-March/023110.html
Gas-phase investigation of Pd(II)-alanine complexes with small native and derivatized peptides containing histidineGas-phase investigation of Pd(II)-alanine complexes with small native and derivatized peptides containing histidine
We report here the generation of gas-phase complexes containing Pd(II), a ligand (deprotonated alanine, A-), and/or N-terminus derivatized peptides containing histidine as one of the amino acids. The species were produced by electrospray ionization, and their gas-phase reactions were investigated using ion-trap tandem mass spectrometry. Pd(II) forms a stable diaqua complex in the gas phase of the formula, [Pd(A-) (H(2)O)(2)]+, (where A- = deprotonated alanine) along with ternary complexes containing A- and peptide. The collision-induced dissociation (CID) patterns of the binary and ternary complexes were investigated, and the dissociation patterns for the ternary complexes suggest that: (a) the imidazole ring of the histidine side group may be the intrinsic binding site of the metal ion, and (b) the peptides fragment primarily by cleavage of the amide bond to the C-terminal side of the histidine residues. These observations are in accord with previous solution-state studies in which Pd(II) was ...
https://soar.wichita.edu/handle/10057/4396
DPH2 - 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 - Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers...DPH2 - 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 - Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers...
Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.
https://www.uniprot.org/uniprot/P32461
Histidine transport ATP-binding protein elisa and antibodyHistidine transport ATP-binding protein elisa and antibody
Shop Histidine transport ATP-binding protein ELISA Kit, Recombinant Protein and Histidine transport ATP-binding protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=histidine-transport-atp-binding-protein
Plus it
A group of 28 uraemic patients on dialysis treatment were given daily supplements of histidine by mouth. Plasma amino-acid concentration, plasma iron, serum transferrin, packed cell volume, and reticulocyte count were all measured before and after two months of histidine supplementation. The treatment raised the plasma histidine concentration and at the same time there was a rise in transferrin and iron levels and packed cell volume. Reticulocyte counts fell after two months of histidine supplementation.. ...
http://www.bmj.com/content/4/5894/714
Characterization of Amino Acid Residues Integral to Neuronal Binding o by Nicole C. OlsonCharacterization of Amino Acid Residues Integral to Neuronal Binding o by Nicole C. Olson
Purpose: Alzheimers Disease is a neurodegenerative disease resulting from over-production and neuronal accumulation of amyloid-beta proteins (Aβ40/Aβ42). The glycine residue at position 33 and histidine residues at positions 13 and 14 are involved with binding and internalization of these proteins, actions potentially inhibited by substituting or sterically hindering these residues with an antibody specific to positions 2-11 (IgG-4.1). Rat pheochromocytoma (PC12) cells differentiated with nerve growth factor were used as a neuronal model to determine whether substitution and/or antibody block amyloid-betas neuronal interactions. Methods: PC12 cells were incubated with fluorescein-labeled-amyloid-beta-40 (F-Aβ40) or substituted F-Aβ40 derivatives (F-Aβ40-H13,14G, F-Aβ40-H13,14G;G33A), with or without IgG-4.1. Cells were analyzed by flow cytometry. Results: PC12 cells incubated with F-Aβ40 and IgG-4.1, as well as cells incubated with substituted peptides, exhibit decreased mean fluorescence
https://digitalcommons.calpoly.edu/chemsp/3/
Molecular insight in the purification of immunoglobulin by pseudobiospecific ligand l-histidine and histidyl moieties in...Molecular insight in the purification of immunoglobulin by pseudobiospecific ligand l-histidine and histidyl moieties in...
Pseudobiospecific ligand l-histidine is an inexpensive, highly stable, non-toxic ligand explored successfully over the last twenty years for the purification of immunoglobulins in immobilised histidine ligand affinity chromatography. It is of great interest to know the molecular recognition sites of IgG to immobilized l-histidine. Here, we have used an in silico approach to explore the molecular recognition of l-histidine by IgG. We have assessed the feasible binding modes of histidine and its moieties at different sites of IgG and considered only those binding conformations which are exhibited via the imidazole ring NH group or any other OH donating group apart from the ones which are terminally conjugated with the support matrix. We categorised binding site into two categories; category I: inner binding groove and category II: surface binding groove and observed that the hinge region of IgG has most favourable binding pocket for l-histidine and histidyl moieties. Ser and Tyr residues on the hinge
https://www.semanticscholar.org/paper/Molecular-insight-in-the-purification-of-immunoglo-Savane-Kumar/039a2bbc8e66fea59cba96de5f1e8b36280a07f3
Quantitative measurement of the solvent accessibility of histidine imidazole groups in proteins. | Sigma-AldrichQuantitative measurement of the solvent accessibility of histidine imidazole groups in proteins. | Sigma-Aldrich
Sigma-Aldrich offers abstracts and full-text articles by [Vennela Mullangi, Xiang Zhou, David W Ball, David J Anderson, Masaru Miyagi].
https://www.sigmaaldrich.com/catalog/papers/22901083
Osmotic stress-dependent serine phosphorylation of the histidine kinase homologue DokA | BMC Biochemistry | Full TextOsmotic stress-dependent serine phosphorylation of the histidine kinase homologue DokA | BMC Biochemistry | Full Text
Two-component systems consisting of histidine kinases and their corresponding receivers are widespread in bacterial signal transduction. In the past few years, genes coding for homologues of two-component systems were also discovered in eukaryotic organisms. DokA, a homologue of bacterial histidine kinases, is an element of the osmoregulatory pathway in the amoeba Dictyostelium. The work described here addresses the question whether DokA is phosphorylated in vivo in response to osmotic stress. We have endogenously overexpressed individual domains of DokA to investigate post-translational modification of the protein in response to osmotic shock in vivo. Dictyostelium cells were labeled with [32P]-orthophosphate, exposed to osmotic stress and DokA fragments were subsequently isolated by immunoprecipitation. Thus, a stress-dependent phosphorylation could be demonstrated, with the site of phosphorylation being located in the kinase domain. We demonstrate biochemically that the phosphorylated amino acid is
https://bmcbiochem.biomedcentral.com/articles/10.1186/1471-2091-2-2
Kosher Histidine
Kosher Histidine - Buy discounted Kosher Histidine and other Kosher Amino Acids at MaxVite.com. In our Kosher Amino Acids section you will find . Buy discount brand name Kosher Histidine vitamins, supplements, pills, capsules, softgels and tablets. Find natural, herbal, organic and healthy Kosher Histidine products.
http://www.maxvite.com/71/1237/S/Kosher-Histidine/items.html
PMID:22396523 - GONUTSPMID:22396523 - GONUTS
The voltage-sensitive phosphoinositide phosphatases provide a mechanism to couple changes in the transmembrane electrical potential to intracellular signal transduction pathways. These proteins share a domain architecture that is conserved in deuterostomes. However, gene duplication events in primates, including humans, give rise to the paralogs TPTE and TPTE2 that retain protein domain organization but, in the case of TPTE, have lost catalytic activity. Here, we present evidence that these human proteins contain a functional voltage sensor, similar to that in nonmammalian orthologs. However, domains of these human proteins can also generate a noninactivating outward current that is not observed in zebra fish or tunicate orthologs. This outward current has the anticipated characteristics of a voltage-sensitive proton current and is due to the appearance of a single histidine residue in the S4 transmembrane segment of the voltage sensor. Histidine is observed at this position only during the ...
https://gowiki.tamu.edu/wiki/index.php/PMID:22396523
DiVA - Search resultDiVA - Search result
A strategy for rational enzyme design is reported and illustrated by the engineering of a protein catalyst for thiol-ester hydrolysis. Five mutants of human glutathione (GSH; gamma-Glu-Cys-Gly) transferase A1-1 were designed in the search for a catalyst and to provide a set of proteins from which the reaction mechanism could be elucidated. The single mutant A216H catalyzed the hydrolysis of the S-benzoyl ester of GSH under turnover conditions with a k(cat)/K(M) of 156 M(-1) x min(-1), and a catalytic proficiency of ,10(7) M(-1) when compared with the first-order rate constant of the uncatalyzed reaction. The wild-type enzyme did not hydrolyze the substrate, and thus, the introduction of a single histidine residue transformed the wild-type enzyme into a turnover system for thiol-ester hydrolysis. By kinetic analysis of single, double, and triple mutants, as well as from studies of reaction products, it was established that the enzyme A216H catalyzes the hydrolysis of the thiol-ester substrate by ...
http://uu.diva-portal.org/smash/resultList.jsf?dswid=-4800&af=%5B%22categoryId%3A11548%22%5D&p=1&fs=true&language=en&searchType=SIMPLE&query=&aq=%5B%5B%7B%22organisationId%22%3A%221089%22%7D%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all
Bio 15 - 1 Histidine Glycine Histidine Leucine Tyrosine 2 Transcription starts at binding sites called promoters on the DNA...Bio 15 - 1 Histidine Glycine Histidine Leucine Tyrosine 2 Transcription starts at binding sites called promoters on the DNA...
View Notes - Bio 15 from BIOL 101 at UPenn. 1) Histidine, Glycine, Histidine, Leucine, Tyrosine 2) Transcription starts at binding sites called promoters on the DNA template strand, as opposed to the
https://www.coursehero.com/file/6435805/Bio-15/
Gentaur Molecular :Prospecbio \ Mouse Anti Polyhistidine Tag His tag \ ant-227Gentaur Molecular :Prospecbio \ Mouse Anti Polyhistidine Tag His tag \ ant-227
Gentaur molecular products has all kinds of products like :search , Prospecbio \ Mouse Anti Polyhistidine Tag His tag \ ant-227 for more molecular products just contact us
http://www.antibody-antibodies.com/product_det.php?id=2787486&supplier=search&name=Mouse%20Anti%20Polyhistidine%20Tag%20His%20tag
RCSB PDB - 2A0B: HISTIDINE-CONTAINING PHOSPHOTRANSFER DOMAIN OF ARCB FROM ESCHERICHIA COLIRCSB PDB - 2A0B: HISTIDINE-CONTAINING PHOSPHOTRANSFER DOMAIN OF ARCB FROM ESCHERICHIA COLI
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
https://www.rcsb.org/structure/2A0B
Histidine at position 462 determines the low quinine sensitivity of ether---go-go channel superfamil | British Pharmacological...Histidine at position 462 determines the low quinine sensitivity of ether---go-go channel superfamil | British Pharmacological...
Our journals promote pharmacology in all its forms by disseminating the latest high quality research in our peer reviewed scientific journals.
https://www.bps.ac.uk/publishing/our-journals/british-journal-of-pharmacology/volume-176/issue-15/10-1111-bph-14693
Hydrolysis catalyzed with a resin containing histidine groups<...Hydrolysis catalyzed with a resin containing histidine groups<...
TY - JOUR. T1 - Hydrolysis catalyzed with a resin containing histidine groups. AU - Hung, Wei Hsiu. AU - Hu, Cho Chun. AU - Liu, Chuen Ying. PY - 1996/1/1. Y1 - 1996/1/1. N2 - A histidine-containing polymer was synthesized in which the amino group of the histidine was attached chemically via an azide coupling method to the carboxylic acid of Amberlite IRC-50. The resultant polymer was applied as a catalyst for hydrolysis of p-nitrophenyl acetate (PNPA). PNPA in aqueous solution was hydrolyzed at 25°C with a phosphate buffer (pH 7.8). The observed kinetics obeyed Michaelis-Menten kinetics. The reaction rates at various temperature were measured. The activation parameters, preexponential factor (A) and activation energy (Ea), were 6.64 × 10-4 min-1 and 37.5 kJ mol-1 respectively. At a pH of the medium greater than 7.8, the reaction rate remained almost constant (kobs = 0.024 min-1) and seemed to be controlled by the rate of diffusion of PNPA from the bulk solution into the catalytically active ...
https://scholar.lib.ntnu.edu.tw/en/publications/hydrolysis-catalyzed-with-a-resin-containing-histidine-groups
Results for cd01292Results for cd01292
Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The family includes urease alpha, adenosine deaminase, phosphotriesterase dihydroorotases, allantoinases, hydantoinases, AMP-, adenine and cytosine deaminases, imidazolonepropionase, aryldialkylphosphatase, chlorohydrolases, formylmethanofuran dehydrogenases and others. ...
http://bioinf.umbc.edu/dmdm/generatelogo.php?domain=metallo-dependent_hy&accession=cd01292&prot=62422571
TCDB » SEARCHTCDB » SEARCH
5.B.1 The gp91phox Phagocyte NADPH Oxidase-associated Cytochrome b558 (Phox) Family The human phagocyte cytochrome b558 is a heterodimeric complex consisting of a heavy (β) chain (gp91phox) and a light (α) chain (p22phox) as well as several auxiliary subunits (Geisz and Leto, 2004). The β-chain is a glycoprotein of 570 amino acyl residues called gp91phox, the product of the X-linked chronic granulomatous disease gene. The protein bears (1) the heme-binding site in its N-terminal 280 residues, and (2) an FAD binding site (residues 338-344) as part of the C-terminal NADPH oxidase domain. The N-terminal domain has 6 putative transmembrane spanners (TMSs) and is the cytochrome binding site. It has been reported to catalyze efflux of protons through an H+ channel that acts as a charge compensation pathway for the electrogenic generation of the superoxide radical, O2&149;-. The proposal that (gp91phox) has H+ channel activity has been effectively disputed and is now in doubt (DeCoursey 2003; ...
http://tcdb.org/search/result.php?tc=5.B.1
DPH3P1 Gene - GeneCards | DPH3B Protein | DPH3B AntibodyDPH3P1 Gene - GeneCards | DPH3B Protein | DPH3B Antibody
Complete information for DPH3P1 gene (Protein Coding), Diphthamide Biosynthesis 3 Pseudogene 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=DPH3P1
Histidine kinase elisa and antibodyHistidine kinase elisa and antibody
Shop Histidine kinase ELISA Kit, Recombinant Protein and Histidine kinase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=histidine-kinase
Product information, instructions, health benefits, and usage for HistidineProduct information, instructions, health benefits, and usage for Histidine
Histidine list and information including what is Histidine, health benefits and usage indications. Find articles and product list for other top low-carb products, fat-burners, nutrition bars and shakes.
https://www.allstarhealth.com/lj_c_b/histidine/kirkman.htm
Product information, instructions, health benefits, and usage for HistidineProduct information, instructions, health benefits, and usage for Histidine
Histidine list and information including what is Histidine, health benefits and usage indications. Find articles and product list for other top low-carb products, fat-burners, nutrition bars and shakes.
https://www.allstarhealth.com/lj_c_b/histidine/all_american_efx.htm
Global Histidine Sales Market Report 2020 : ReportsnReports
[128 Pages Report] Check for Discount on Global Histidine Sales Market Report 2020 report by QYResearch Group. This report studies sales (consumption) of Histidine in Global market,...
http://www.reportsnreports.com/reports/706002-global-histidine-sales-market-report-2020.html
Arginine and Histidine
Posted by guillo from IP 68.100.129.210 on March 25, 2013 at 17:22:23:. Though Arginine and Histidine are syntethized inssufitiently in the organism, should we consider them ...
http://www.usmle.net/step-1/messages2012/238841.html
D-Histidine | PhionD-Histidine | Phion
Product Number , 33782677. CAS Number , 351-50-8. EC , 206-513-8. Molecular Formula , C6H9N3O2. Molecular Weight , 155.16. Storage Temp , Harmonized Tariff code , 29332990. Signal Word , ...
http://phionchemicals.com/product/d-histidine
L-histidine 71-00-1 MSDS, Safety Technical Specifications MSDSL-histidine 71-00-1 MSDS, Safety Technical Specifications MSDS
L-histidine 71-00-1 MSDS report, L-histidine MSDS safety technical specifications search, L-histidine safety information specifications ect.
http://www.molbase.com/en/msds_71-00-1-moldata-26978.html
EzCatDB S00283
Phosphoryl transfer between the PTS components is thought to proceed by nucleophilic attack of the active histidine residue on the phospho-histidine of the target protein ...
http://ezcatdb.cbrc.jp/EzCatDB/enzyme/S00283
overexpressed protein sometime gives two bandsoverexpressed protein sometime gives two bands
Jim ,ash_mountain at yahoo.com, wrote in message news:b83c549.0201240704.3268435c at posting.google.com... , post-translational modifications such as phosphorylation cannot be the , problem here as you are expressing in E. coli!! Proteolysis seems Yes they can. There are several examples of E.coli post-translational modifications :) Theyre not very common, but they DO happen. Examples include: histidine phosphorylation, biotinylation, and mysterious carbohydrate addition to the N-terminus (I have read a paper describing this recently, but I forgot which journal it was in, so one would have to look it up if ones interested). Artem ...
http://www.bio.net/bionet/mm/methods/2002-January/091999.html
EMBL: CP001630.PE64
CP001630.PE64 Location/Qualifiers FT CDS_pept 73786..75072 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Amir_0064 FT /product=signal transduction histidine kinase, LytS FT /note=PFAM: histidine kinase internal region; ATP-binding FT region ATPase domain protein; SMART: ATP-binding region FT ATPase domain protein; KEGG: signal transduction histidine FT kinase, LytS; K07704 two-component system, LytT family, FT sensor histidine kinase LytS FT /db_xref=EnsemblGenomes-Gn:Amir_0064 FT /db_xref=EnsemblGenomes-Tr:ACU34038 FT /db_xref=GOA:C6WDP3 FT /db_xref=InterPro:IPR003594 FT /db_xref=InterPro:IPR010559 FT /db_xref=InterPro:IPR036890 FT /db_xref=UniProtKB/TrEMBL:C6WDP3 FT /inference=protein motif:PFAM:PF06580 FT /protein_id=ACU34038.1 FT /translation=MPGARRPHSMDGVRDLLTERAVLGVIATLAVLGLFVMLCRARRVS FT TSVEDAVMDMLHRMSKASADLREGLTAEAADKATPHLREMLRCVAVGITDSTGSVLSWD FT GGAADHYELMRGHIEQAIREVHKEHVEHRKLDCDLSGPCPMHSAVIVPLIVESEVAGTL FT ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-id?query=CP001630.PE64&db=EMBL&ident=ACNUC7421
The multiple roles of histidine in protein interactions | SpringerLinkThe multiple roles of histidine in protein interactions | SpringerLink
Background Among the 20 natural amino acids histidine is the most active and versatile member that plays the multiple roles in protein interactions, often the key residue in enzyme catalytic...
https://link.springer.com/article/10.1186/1752-153X-7-44
Submissions for variant NM 025099.6(CTC1):c.917G|A (p.Arg306His) - ClinVar MinerSubmissions for variant NM 025099.6(CTC1):c.917G|A (p.Arg306His) - ClinVar Miner
This sequence change replaces arginine with histidine at codon 306 of the CTC1 protein (p.Arg306His). The arginine residue is weakly conserved and there is a small physicochemical difference between arginine and histidine. This variant is present in population databases (rs567779457, ExAC 0.01%). This variant has not been reported in the literature in individuals with CTC1-related disease. Algorithms developed to predict the effect of missense changes on protein structure and function output the following: SIFT: Tolerated; PolyPhen-2: Benign; Align-GVGD: Class C0. The histidine amino acid residue is found in multiple mammalian species, suggesting that this missense change does not adversely affect protein function. These predictions have not been confirmed by published functional studies and their clinical significance is uncertain. In summary, the available evidence is currently insufficient to determine the role of this variant in disease. Therefore, it has been classified as a Variant ...
https://clinvarminer.genetics.utah.edu/submissions-by-variant/NM_025099.6%28CTC1%29%3Ac.917G%3EA%20%28p.Arg306His%29
Submissions for variant NM 025099.6(CTC1):c.1379G|A (p.Arg460His) - ClinVar MinerSubmissions for variant NM 025099.6(CTC1):c.1379G|A (p.Arg460His) - ClinVar Miner
This sequence change replaces arginine with histidine at codon 460 of the CTC1 protein (p.Arg460His). The arginine residue is moderately conserved and there is a small physicochemical difference between arginine and histidine. This variant is present in population databases (rs200619397, ExAC 0.09%). This variant has not been reported in the literature in individuals with CTC1-related conditions. Algorithms developed to predict the effect of missense changes on protein structure and function output the following: SIFT: Tolerated; PolyPhen-2: Benign; Align-GVGD: Class C0. The histidine amino acid residue is found in multiple mammalian species, suggesting that this missense change does not adversely affect protein function. These predictions have not been confirmed by published functional studies and their clinical significance is uncertain. In summary, the available evidence is currently insufficient to determine the role of this variant in disease. Therefore, it has been classified as a ...
https://clinvarminer.genetics.utah.edu/submissions-by-variant/NM_025099.6%28CTC1%29%3Ac.1379G%3EA%20%28p.Arg460His%29
His - Pulldown | Sigma-AldrichHis - Pulldown | Sigma-Aldrich
HIS-Select products from Sigma Life Science have the ability to purify histidine-tagged proteins quickly and with high selectivity. This is due to HIS-Select′s patented, non-charged, hydrophilic nickel chelate linkage. This non-charged linkage greatly diminishes non-specific binding.
https://www.sigmaaldrich.com/life-science/molecular-biology/molecular-biology-products.html?TablePage=108655506
PQR | N-[2-({(1s)-1-carboxy-4-[(diaminomethylene)amino]butyl}amino)ethyl]-l-histidinePQR | N-[2-({(1s)-1-carboxy-4-[(diaminomethylene)amino]butyl}amino)ethyl]-l-histidine
You are viewing an interactive 3D depiction of the molecule n-[2-({(1s)-1-carboxy-4-[(diaminomethylene)amino]butyl}amino)ethyl]-l-histidine (C14H25N7O4) from the PQR.
http://pqr.pitt.edu/mol/LLPMPMKLOHAIMY-QWRGUYRKSA-N
Musashi L-Histidine Reviews and Information
L-Histidine Reviews and other Reviews of Nutritional Supplements and Merchants Plus Related Resources Including a 2017 Buying Guide. Healthy Learning for Healthy Living.
http://www.nutritionaltree.com/reviews/amino-acids/l-histadine/musashi_l-histidine.aspx
Recombinant Human ICAM1 protein, His-tagged ICAM1-2249H - Creative BioMart
Recombinant Human ICAM1 extracellular domain (Met 1-Glu 480) (NP_000192.2), fused with a polyhistidine tag at the C-terminus, was produced in Human Cell.
https://www.creativebiomart.net/description_7307_12.htm
Recombinant Human EFNB1 protein, His-tagged EFNB1-2237H - Creative BioMart
Recombinant Human EFNB1 extracellular domain (Met 1-Gly 232) (NP_004420.1), fused with a polyhistidine tag at the C-terminus, was produced in Human Cell.
https://www.creativebiomart.net/description_7296_12.htm
L-histidine: Benefits ? Sources ? Dosage ?L-histidine: Benefits ? Sources ? Dosage ?
I? This semi-essential amino acid BENEFITS skin, immune system, blood and cell regeneration. Read about functions and studies about Histidine here?
http://aminoacidstudies.org/l-histidine/
Histidine - AMINO ACIDS - ProductsHistidine - AMINO ACIDS - Products
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
https://www.iris-biotech.de/products/amino-acids/histidine.html
Histidine - AMINO ACIDS - ProductsHistidine - AMINO ACIDS - Products
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
https://www.iris-biotech.de/de/products/amino-acids/histidine.html
Histidine available at NutraBio.comHistidine available at NutraBio.com
Amino acids at deep discount. Save up to 75%. Pure, USA, l-carnitine, l-taurine, creatine, factory direct at below wholesale cost.
https://www.nutrabio.com/category/histidine/
Myoglobin - DocCheck FlexikonMyoglobin - DocCheck Flexikon
Myoglobin is a globular protein and consists of eight α-helixes in its secondary structure. Myoglobin is a protein composed of a single polypeptide chain build by 153 amino acids. The polypeptide chain is bound to a heme molecule which represents the prosthetic group of myoglobin. The heme is bound to a histidine residue at position 93 (His93 or His-F8) within the N-terminal end of the myoglobin polypeptide. If oxygen is bound to heme, the distal histidine at position 64 (called His64 or His-E7) contributes to the stabilization of the oxygen which binds to iron (Fe2+) within the heme structure. ...
https://flexikon.doccheck.com/en/Myoglobin
Serine protease acylation proceeds with a subtle re-orientation of the histidine ring at the tetrahedral intermediate<...
TY - JOUR. T1 - Serine protease acylation proceeds with a subtle re-orientation of the histidine ring at the tetrahedral intermediate. AU - Zhou, Yanzi. AU - Zhang, Yingkai. PY - 2011/2/7. Y1 - 2011/2/7. N2 - The acylation mechanism of a prototypical serine protease trypsin and its complete free energy reaction profile have been determined by Born-Oppenheimer ab initio QM/MM molecular dynamics simulations with umbrella sampling.. AB - The acylation mechanism of a prototypical serine protease trypsin and its complete free energy reaction profile have been determined by Born-Oppenheimer ab initio QM/MM molecular dynamics simulations with umbrella sampling.. UR - http://www.scopus.com/inward/record.url?scp=78751489563&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=78751489563&partnerID=8YFLogxK. U2 - 10.1039/c0cc04112b. DO - 10.1039/c0cc04112b. M3 - Article. C2 - 21116528. AN - SCOPUS:78751489563. VL - 47. SP - 1577. EP - 1579. JO - Chemical Communications. JF - Chemical ...
https://nyuscholars.nyu.edu/en/publications/serine-protease-acylation-proceeds-with-a-subtle-re-orientation-o
Identification of novel bacterial histidine biosynthesis inhibitors using docking, ensemble rescoring, and whole-cell assays -...Identification of novel bacterial histidine biosynthesis inhibitors using docking, ensemble rescoring, and whole-cell assays -...
TY - JOUR. T1 - Identification of novel bacterial histidine biosynthesis inhibitors using docking, ensemble rescoring, and whole-cell assays. AU - Henriksen,Signe Teuber. AU - Liu,J.. AU - Estiu,G.. AU - Oltvai,Z.N.. AU - Wiest,O.. PY - 2010. Y1 - 2010. N2 - The rapid spread on multidrug-resistant strains of Staphylococcus aureus requires not just novel treatment options, but the development of faster methods for the identification of new hits for drug development. The exponentially increasing speed of computational methods makes a more extensive use in the early stages of drug discovery attractive if sufficient accuracy can be achieved. Computational target identification using systems-level methods suggested the histidine biosynthesis pathway as an attractive target against S. aureus. Potential inhibitors for the pathway were identified through docking, followed by ensemble rescoring, that is sufficiently accurate to justify immediate testing of the identified compounds by whole-cell assays, ...
http://orbit.dtu.dk/en/publications/identification-of-novel-bacterial-histidine-biosynthesis-inhibitors-using-docking-ensemble-rescoring-and-wholecell-assays
Functional analysis of conserved histidines in ADP-glucose pyrophosphorylase from Escherichia coli. - Semantic ScholarFunctional analysis of conserved histidines in ADP-glucose pyrophosphorylase from Escherichia coli. - Semantic Scholar
Two absolutely conserved histidines and a third highly conserved histidine are noted in 11 bacterial and plant ADP-glucose pyrophosphorylases. These histidines were individually mutagenized in the E. coli enzyme to glutamine in order to determine their function. Glutamine mutations at residues 143 and 156 produced functional enzymes in cell extracts with slightly lower than wild-type specific catalytic activities and with same heat stability characteristics of the wild-type enzyme. Substitution of residue 83 with glutamine however produced an enzyme having decreased thermal stability. Additional mutageneses at residue 83 with asparagine, arginine, or aspartate gave rise to enzymes having a progressively decreasing trend in thermal stability. These mutants are more susceptible to proteolysis than wild-type enzyme. Kinetic analysis of H83Q and H83N indicates that histidine 83 is not involved in the catalytic mechanism or in substrate binding but possibly in maintenance of the active catalytic structure.
https://www.semanticscholar.org/paper/Functional-analysis-of-conserved-histidines-in-ADP-Hill-Preiss/14056a7c74bf62a66d9acb771c2bd24e1a8ed4b4
The post-translational modifications of the nuclear encoded subunits of complex I from bovine heart mitochondria. | MRC...
Bovine complex I is an assembly of 46 different proteins. Seven of them are encoded in mitochondrial DNA, and the rest are nuclear gene products that are imported into the organelle. Fourteen of the nuclear encoded subunits have modified N termini. Many of these post-translational modifications have been deduced previously from intact protein masses. These assignments have been verified by mass spectrometric analysis of peptides. Thirteen of them are N-alpha-acetylated, and a 14th, subunit B18, is N-alpha-myristoylated. Subunit B18 forms part of the membrane arm of the complex, and the myristoyl group may attach subunit B18 to the membrane. One subunit, B12, has a particularly complex pattern of post-translational modification that has not been analyzed before. It is a mixture of the N-alpha-acetylated form and the form with a free N terminus. In addition, it has one, two, or three methyl groups attached to histidine residues at positions 4, 6, and 8 in various combinations. The predominant form ...
http://www.mrc-mbu.cam.ac.uk/publications/674/post-translational-modifications-nuclear-encoded-subunits-complex-i-bovine-heart
NMR paper The Cu2+-nitrilotriacetic acid complex improves loading of ?-helical double histidine site for precise distance...
The Cu2+-nitrilotriacetic acid complex improves loading of ?-helical double histidine site for precise distance measurements by pulsed ESR Publication
http://www.bionmr.com/forum/journal-club-9/cu2-nitrilotriacetic-acid-complex-improves-loading-helical-double-histidine-site-precise-distance-measurements-pulsed-esr-25411/
Molecular characterization of His-Asp phosphorelay signaling factors in maize leaves: implications of the signal divergence by...Molecular characterization of His-Asp phosphorelay signaling factors in maize leaves: implications of the signal divergence by...
Genes for histidyl-aspartyl (His-Asp) phosphorelay components (His-containing phosphotransfer proteins, HP, and response regulators, RR) were isolated from Zea mays L. to characterize their function in cytokinin signaling. Six type-A RRs (ZmRR1, ZmRR2, ZmRR4-ZmRR7), 3 type-B RRs (ZmRR8-ZmRR10), and …
https://pubmed.ncbi.nlm.nih.gov/12856940/?dopt=Abstract
histidine facts, information, pictures | Encyclopedia.com articles about histidine
Get information, facts, and pictures about histidine at Encyclopedia.com. Make research projects and school reports about histidine easy with credible articles from our FREE, online encyclopedia and dictionary.
https://www.encyclopedia.com/science-and-technology/biochemistry/biochemistry/histidine
Histidine
Histidine is one of the 20 most common natural amino acids, coded for in DNA. Nutritionally, in humans, histidine is considered an essential amino acid, but only in children. The nitrogen side chains of histidine and the relatively neutral pK (ca 6.0) of the histine proton mean that this amino acid side chain finds its way into considerable use as a coordinating ligand in metalloproteins, and also as a catalytic site in certain enzymes.. The amino acid is a precursor for histamine biosynthesis.. ...
http://www.fact-index.com/h/hi/histidine.html
Global Histidine Market Revenue Status (2014-2019) and Forecast (2020-2025) - Daily Business Broker
The study report titled Global Histidine Market offers an in-depth analysis of this market across the globe. The study, aimed at providing current and prospect players in this market sharp insights to gain the advantage over their competitors. The report does so by providing an executive summary including all valuable market figures and exploring the favorable factors that are expected to drive the growth rate of the market, besides taking account of the restraining factors.. Questions that the report answers with regards to the competitive hierarchy of the Histidine market:. =,As per the Histidine report, which are the firms that fall under the competitive landscape of the industry in question.. =,Which among these contenders - Kyowa Hakko Bio, Ajinomoto, KingYork Group, Huaheng Biologgical, Shine Star Biological Engineering is most likely to evolve as the most profitable investment hub of this market.. =,How much market share does each of these companies accrue in the industry.. =,What are the ...
http://dailybusinessbroker.com/global-histidine-market-revenue-status-2014-2019-and-forecast-2020-2025/
Hydrolysis catalyzed with a resin containing histidine groups<...Hydrolysis catalyzed with a resin containing histidine groups<...
TY - JOUR. T1 - Hydrolysis catalyzed with a resin containing histidine groups. AU - Hung, Wei Hsiu. AU - Hu, Cho Chun. AU - Liu, Chuen Ying. N1 - Funding Information: We thank the National Science Council of the Republic of China for financial support. Copyright: Copyright 2017 Elsevier B.V., All rights reserved.. PY - 1996/10/10. Y1 - 1996/10/10. N2 - A histidine-containing polymer was synthesized in which the amino group of the histidine was attached chemically via an azide coupling method to the carboxylic acid of Amberlite IRC-50. The resultant polymer was applied as a catalyst for hydrolysis of p-nitrophenyl acetate (PNPA). PNPA in aqueous solution was hydrolyzed at 25°C with a phosphate buffer (pH 7.8). The observed kinetics obey those of Michaelis-Menten. The reaction rates at various temperatures were measured. The activation parameters, pre- exponential factor (A) and activation energy (E(a)), were 6.64 x 10-4 min- 1 and 37.5 kJ mol-1 respectively. At a pH of the medium greater than ...
https://scholar.lib.ntnu.edu.tw/en/publications/hydrolysis-catalyzed-with-a-resin-containing-histidine-groups-2
02 | June | 2017 | Evolution of NADPH Oxidase Inhibitors02 | June | 2017 | Evolution of NADPH Oxidase Inhibitors
Despite its importance in central metabolism and bacterial cell signaling, protein histidine phosphorylation has remained elusive with respect to its extent and functional roles in biological systems due to the lack of adequate research tools. to nitrogen availability and that -ketoglutarate (-KG) inhibits phosphotransfer from phosphorylated phosphoenolpyruvate synthase SRT3109 (PpsA) to pyruvate. We expect this antibody to open opportunities for investigating other pHis-proteins and their functions. INTRODUCTION Protein phosphorylation is a central player in the regulation of cellular processes.1 Although this class of posttranslational modification (PTM) is known to occur on several amino acids, the available biochemical, pharmacological and proteomic tools for studying the modification are best developed in the context of Ser, Thr and Tyr phosphorylation.2 By contrast, there is a dearth of such tools for studying other protein phosphorylation events, a situation which has greatly hindered our ...
http://biobeds.info/2017/06/02/
DPH7 Full-Length MS Protein Standard - Creative ProteomicsDPH7 Full-Length MS Protein Standard - Creative Proteomics
WDR85 Full-Length MS Protein Standard (NP_620133), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis (Carette et al., 2009 )
https://www.creative-proteomics.com/product/detail-cpfl305735_2605.htm
Histidine-rich glycoprotein - WikipediaHistidine-rich glycoprotein - Wikipedia
Histidine-rich glycoprotein (HRG)is a glycoprotein that in humans is encoded by the HRG gene. The HRG protein is produced in the liver, and it could also be synthesized by monocytes, macrophages, and megakaryocytes. It possesses a multi-domain structure, which makes it capable of binding to numerous ligands and modulating various biological processes including immunity, vascularization and coagulation. The HRG gene lies on location of 3q27 on the chromosome 3, spans approximately 11kb, and consist of 7 exons. Two common isoforms of the HRG gene have been found in humans. These isoforms exist due to a polymorphism occurring in exon 5. HRG is a glycoprotein of 70-75kDa present at a relatively high concentration in the plasma of vertebrates. The primary structure of human HRG is predicted to be a 507 amino acid multidomain polypeptide consisting of two cystatin-like regions at the N-terminus, a histidine-rich region (HRR) flanked by proline-rich regions (PRR), and a C-terminal domain. HRG has an ...
https://en.wikipedia.org/wiki/Histidine-rich_glycoprotein
Purification of Polyhistidine-Tagged Proteins by Immobilized Metal Affinity Chromatography
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
http://molecularcloning.com/index.php?prt=217
United States Histidine Market by Manufacturers, States, Type and Application, Forecast to 2022United States Histidine Market by Manufacturers, States, Type and Application, Forecast to 2022
United States Histidine Market by Manufacturers, States, Type and Application, Forecast to 2022 United States Histidine Market by Manufacturers, States, Type and Application, Forecast to - Market research report and industry analysis - 10946302
https://www.marketresearch.com/GlobalInfoResearch-v4117/United-States-Histidine-Manufacturers-Type-10946302/
Plus itPlus it
The pharmacokinetics of L-histidine in humans has been investigated to evaluate the in vivo histidine ammonia lyase system for the conversion of L-histidine to urocanic acid. Two healthy volunteers (subjects A and B) received a single 100-mg oral dose of L-[3,3-2H2,1,3-15N2]histidine. Blood and urine samples were obtained over 24 hr after the administration and analyzed by stable isotope dilution ms. Labeled L-histidine was rapidly absorbed, and a maximum plasma concentration of L-histidine was observed at 30 min (1057.6 ng/ml) in subject A and at 60 min (1635.6 ng/ml) in subject B after oral administration. Pharmacokinetic parameters were calculated based on a two-compartment model. Labeled L-histidine in subject A (t1/2 = 1.0 hr) was eliminated approximately twice faster than that in subject B (t1/2 = 1.9 hr). Total body clearances were 70.0 liters/hr in subject A and 30.0 liters/hr in subject B. The low ratios of the renal clearance to the total body clearance (1.04% for subject A and 0.43% ...
http://dmd.aspetjournals.org/content/24/1/49
Light-Regulated Alternative Splicing of Pseudo-Histidine Phosphotransfer Protein 3 in Oryza sativa | SpringerLinkLight-Regulated Alternative Splicing of Pseudo-Histidine Phosphotransfer Protein 3 in Oryza sativa | SpringerLink
The two-component system is involved in several developmental events and different responses to the environment. Histidine-containing phosphotransfer prote
https://link.springer.com/article/10.1007/s00344-019-09927-8?error=cookies_not_supported&code=a7850c26-c350-4dd3-a3ed-2efa12e547cf
Isolation and nucelotide sequence of a mouse histidine trna gene. by J H. Han and J D. HardingIsolation and nucelotide sequence of a mouse histidine trna gene. by J H. Han and J D. Harding
Han, J H. and Harding, J D., Isolation and nucelotide sequence of a mouse histidine trna gene. (1982). Subject Strain Bibliography 1982. 4165 ...
https://mouseion.jax.org/ssbb1982/4165/
RCSB PDB - 1OPD: HISTIDINE-CONTAINING PROTEIN (HPR), MUTANT WITH SER 46 REPLACED BY ASP (S46D) Structure Summary PageRCSB PDB - 1OPD: HISTIDINE-CONTAINING PROTEIN (HPR), MUTANT WITH SER 46 REPLACED BY ASP (S46D) Structure Summary Page
1OPD: Mutation of serine-46 to aspartate in the histidine-containing protein of Escherichia coli mimics the inactivation by phosphorylation of serine-46 in HPrs from gram-positive bacteria.
http://www.rcsb.org/pdb/explore/explore.do?structureId=1OPD
Use of a probabilistic motif search to identify histidine phosphotransfer domain-containing proteinsUse of a probabilistic motif search to identify histidine phosphotransfer domain-containing proteins
The wealth of newly obtained proteomic information affords researchers the possibility of searching for proteins of a given structure or function. Here we describe a general method for the detection of a protein domain of interest in any species for which a complete proteome exists. In particular, we apply this approach to identify histidine phosphotransfer (HPt) domain-containing proteins across a range of eukaryotic species. From the sequences of known HPt domains, we created an amino acid occurrence matrix which we then used to define a conserved, probabilistic motif. Examination of various organisms either known to contain (plant and fungal species) or believed to lack (mammals) HPt domains established criteria by which new HPt candidates were identified and ranked. Search results using a probabilistic motif matrix compare favorably with data to be found in several commonly used protein structure/function databases: our method identified all known HPt proteins in the Arabidopsis thaliana ...
https://acdc.amherst.edu/view/octagon:105
SMART: Pfam domain TrypsinSMART: Pfam domain Trypsin
This entry represents the active-site-containing domain found in the trypsin family members. The catalytic activity of the serine proteases from the trypsin family is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which itself is hydrogen-bonded to a serine. The sequences in the vicinity of the active site serine and histidine residues are well conserved in this family of proteases [ (PUBMED:3136396) ]. A partial list of proteases known to belong to the trypsin family is shown below. ...
http://smart.embl.de/smart/do_annotation.pl?DOMAIN=Pfam:Trypsin&START=170&END=321&E_VALUE=2.1e-10&TYPE=PFAM&BLAST=HPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLIPGLEPVG
SMART: Pfam domain TrypsinSMART: Pfam domain Trypsin
This entry represents the active-site-containing domain found in the trypsin family members. The catalytic activity of the serine proteases from the trypsin family is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which itself is hydrogen-bonded to a serine. The sequences in the vicinity of the active site serine and histidine residues are well conserved in this family of proteases [ (PUBMED:3136396) ]. A partial list of proteases known to belong to the trypsin family is shown below. ...
http://smart.embl.de/smart/do_annotation.pl?DOMAIN=Pfam:Trypsin&START=325&END=556&E_VALUE=1.2e-16&TYPE=PFAM&BLAST=ECGKAPRPGTWPWEAQVTVPGSTPCYGALVSDRWVLAPASCFLDFPTQQPRTSDSSPHDFETWRVLLPSRPEEERVARLVAHENASRDFASDLALLQLRTRVNLTAAPSAVCLPHHEHYFLPGSHCRLARWGRGELAPGSSAQLEAQLLNGWWCHCLYGRQGETVPRPGDPPHLLCPAYQEEEEAGLCWKDSSWSLLCREEGTWFLAGYRTLSDGCLRPRAFSPMQTHGPWI
BMRB Entry 6886BMRB Entry 6886
Authors: Julia, Georgescu; Burkhard, Bechinger. Citation: Georgescu, Julia; Bechinger, Burkhard. NMR structures of the histidine-rich peptide LAH4 in micellar environments: membrane insertion, pH-dependent mode of antimicrobial action and DNA transfection Biophysical J. ., .-... Assembly members: ...
http://bmrb.cerm.unifi.it/data_library/summary/?bmrbId=6886
Grandmas Histidine an Essential Amino Acid GuideGrandmas Histidine an Essential Amino Acid Guide
Histidine is an essential amino acid that is significant in the growth and repair of tissues. It is important for the maintenance of the myelin sheaths that protect nerve cells.....
http://www.grandmas-herbal-remedies.com/histidine.html
User:Brian P. Josey/Notebook/2009/10/13 - OpenWetWareUser:Brian P. Josey/Notebook/2009/10/13 - OpenWetWare
We have some questions concerning this process, namely it is how the histadine tags are interacting with the Ni-agarose and the casein that we use to passivate the flow cells. We know that histidine has an affinity to interact with cysteine, another amino acid, that is prevalent on the structure of the kappa-casein. We would like to know how they interact, and if that is the key for why kappa-casein is so effective as as a coating for the flow cells. Another thing that we are interested in is how the histidine tag interacts with the nickel in the Ni-agarose. We know that it interacts, it is a crucial step in the collection of kinesin, but exactly how it interacts is a currently a mystery. If we can understand that more clearly, we could use this knowledge to advance our understanding of the questions centered on the kappa-casein. One idea is that we can convert the histidine tag into a protected group that will not interact with anything and then proceed with the usual gliding motility assays to ...
https://openwetware.org/wiki/User:Brian_P._Josey/Notebook/2009/10/13
Sensitizer-mediated photooxidation of histidine residues
Exposure of proteins to visible light in the presence of a sensitizer results in the oxidation of Met, Trp, Tyr, Cys, and His side chains. These reactions are only partially understood, particularly with His. In this study, the oxidation of free His, His derivatives, and His-containing peptides has been examined using visible light and a range of sensitizers. It is shown that photooxidation gives rise to unstable peroxides, in a light-, illumination time-, and sensitizer-dependent manner. The yield of these materials is increased when reactions are carried out in solutions prepared with D2O, which prolongs the lifetime of 1O2, and decreased in the presence of the potent 1O2 scavenger azide, consistent with the involvement of this excited state. These peroxides have half-lives of hours, though the rate of decomposition is enhanced by elevated temperatures, reductants, and metal ions. Reducing metal ions catalyze the formation of radicals, which have been detected by EPR spin trapping. Structural ...
https://curis.ku.dk/portal/da/publications/sensitizermediated-photooxidation-of-histidine-residues
Histidine - Stock Image C017/6246 - Science Photo LibraryHistidine - Stock Image C017/6246 - Science Photo Library
A molecular model of histidine, an essential amino acid that is a precursor to histamine, a compound involved in the inflammatory response of the immune system. Atoms are coloured dark grey (carbon), light grey (hydrogen), red (oxygen) and blue (nitrogen). - Stock Image C017/6246
http://www.sciencephoto.com/media/538648/view
FPLC Purification of His-Tagged ProteinsFPLC Purification of His-Tagged Proteins
FPLC Purification of His-Tagged ProteinsFPLC Purification of His-Tagged Proteins
HealthVit L- Histidine 500mg Capsule - Uses, Dosage and Effects | mfineHealthVit L- Histidine 500mg Capsule - Uses, Dosage and Effects | mfine
Click to know about the uses, price, consumption and side effects of HealthVit L- Histidine 500mg Capsule. Consult with top doctors online on mfine to know more
https://www.mfine.co/medicines/healthvit-l-histidine-500mg-capsule/
Bahler Lab
Imidazoleglycerol-phosphate dehydratase, catalyzes the sixth step in histidine biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts; transcription is regulated by general amino acid control via ...
http://bahlerweb.cs.ucl.ac.uk/cgi-bin/YOGY/yogy.pl?gene=YOR202W&species=S._cerevisiae&wild=No&go_term=Yes&go_final=No
L-Histidine Base - 250g Pure Powder - PHF SupplementsL-Histidine Base - 250g Pure Powder - PHF Supplements
Histidine is an essential amino acid. L-Histidine, specifically, cannot be formed by other nutrients and must be present within ones diet.. ...
http://phfsupplements.com/product/l-histidine-base-250g-pure-powder/
SWISS-MODEL Template Library | 1hsl.1
SWISS-MODEL Template Library (SMTL) entry for 1hsl.1. REFINED 1.89 ANGSTROMS STRUCTURE OF THE HISTIDINE-BINDING PROTEIN COMPLEXED WITH HISTIDINE AND ITS RELATIONSHIP WITH MANY OTHER ACTIVE TRANSPORT(SLASH)CHEMOSENSORY RECEPTORS
https://swissmodel.expasy.org/templates/1hsl
10 months old, regularly constipated, skin tag on the bottom due to this. Advice ? - Doctors insight on HealthcareMagic10 months old, regularly constipated, skin tag on the bottom due to this. Advice ? - Doctors insight on HealthcareMagic
Question - 10 months old, regularly constipated, skin tag on the bottom due to this. Advice ?. Ask a Doctor about uses, dosages and side-effects of Lactulose, Ask a Gastroenterologist
http://www.healthcaremagic.com/questions/10-months-old-regularly-constipated-skin-tag-on-the-bottom-due-to-this-Advice/322057
MODx: img tag on steroids... :) - Cacher SnippetMODx: img tag on steroids... :) - Cacher Snippet
MODx: img tag on steroids... :) - @pepebe shared this Cacher snippet. Cacher is the code snippet organizer that empowers professional developers and their teams to get more coding done, faster.
https://snippets.cacher.io/snippet/052f4bac1a5276e2cd19
Ribose 5-phosphateRibose 5-phosphate
Like nucleotides, biosynthesis of histidine is initiated by the conversion of R5P to PRPP. The step of histidine biosynthesis ... Histidine biosynthesis is carefully regulated by feedback inhibition/ R5P can be converted to adenosine diphosphate ribose, ... Ingle RA (January 2011). "Histidine biosynthesis". The Arabidopsis Book. 9: e0141. doi:10.1199/tab.0141. PMC 3266711. PMID ... and histidine. Nucleotides serve as the building blocks for nucleic acids, DNA and RNA. They are composed of a nitrogenous base ...
https://en.wikipedia.org/wiki/Ribose_5-phosphate
Hydrolyzed proteinHydrolyzed protein
Examples include cystine from hydrolysis of hair, tryptophane from casein, histidine from red blood cells, and arginine from ... Foster, G. L.; Shemin, D. (1938). "L-Histidine Monohydrochloride". Organic Syntheses. 18: 43. doi:10.15227/orgsyn.018.0043. ...
https://en.wikipedia.org/wiki/Hydrolyzed_protein
3-Methylhistidine3-Methylhistidine
"3-Methyl-L-histidine". PubChem Compound. United States National Library of Medicine - National Center for Biotechnology ... 3-Methylhistidine is a metabolic product that is produced in the body via the enzymatic methylation of histidine during peptide ...
https://en.wikipedia.org/wiki/3-Methylhistidine
Imidazoleglycerol-phosphate dehydrataseImidazoleglycerol-phosphate dehydratase
This enzyme participates in histidine metabolism as it is involved in the 6th step of histidine biosynthesis as part of a nine ... AMES BN (1957). "The biosynthesis of histidine; D-erythro-imidazoleglycerol phosphate dehydrase". J. Biol. Chem. 228 (1): 131- ... "Structure and function of the Salmonella typhimurium and Escherichia coli K-12 histidine operons". J. Mol. Biol. 203 (3): 585- ...
https://en.wikipedia.org/wiki/Imidazoleglycerol-phosphate_dehydratase
Protein kinaseProtein kinase
There are also protein kinases that phosphorylate other amino acids, including histidine kinases that phosphorylate histidine ... Histidine kinases are structurally distinct from most other protein kinases and are found mostly in prokaryotes as part of two- ... Histidine kinases are found widely in prokaryotes, as well as in plants, fungi and eukaryotes. The pyruvate dehydrogenase ... A phosphate group from ATP is first added to a histidine residue within the kinase, and later transferred to an aspartate ...
https://en.wikipedia.org/wiki/Protein_kinase
Histidinol-phosphataseHistidinol-phosphatase
Ames BN (June 1957). "The biosynthesis of histidine; L-histidinol phosphate phosphatase". The Journal of Biological Chemistry. ... phosphate This enzyme participates in histidine metabolism. This enzyme belongs to the family of hydrolases, to be specific, ...
https://en.wikipedia.org/wiki/Histidinol-phosphatase
Phosphoribosyl pyrophosphatePhosphoribosyl pyrophosphate
Carbon atoms from ribose in PRPP form the linear chain and part of the imidazole ring in histidine. The same is true for the ... The histidine biosynthesis pathway involves the reaction between PRPP and ATP, which activates the latter to ring cleavage. ... Stepansky, A.; Leustek, T. (2006). "Histidine biosynthesis in plants". Amino Acids. 30 (2): 127-142. doi:10.1007/s00726-005- ... R. Caspi (2008-10-10). "Pathway: L-histidine biosynthesis". MetaCyc Metabolic Pathway Database. Retrieved 2022-02-17. ...
https://en.wikipedia.org/wiki/Phosphoribosyl_pyrophosphate
Urocanic aciduriaUrocanic aciduria
It is a secondary disorder of histidine metabolism. Urocanic aciduria is thought to be relatively benign. Although aggressive ... The amino acid histidine, when catalyzed by the enzyme histidase, forms urocanic acid. Disruptions in this pathway, caused by a ... With normal to only slightly elevated levels of histidine present in the liver during urocanic aciduria, the only true ... Disorders of histidine metabolism. http://www.ommbid.com/OMMBID/the_online_metabolic_and_molecular_bases_of_inherited_disease/b ...
https://en.wikipedia.org/wiki/Urocanic_aciduria
Sven Gustaf HedinSven Gustaf Hedin
THE PREPARATION OF HISTIDINE" (PDF). Journal of Biological Chemistry. 78 (3): 627-635. doi:10.1016/S0021-9258(18)83967-9. ISSN ... Vickery, Hubert Bradford; Leavenworth, Charles S. (1928-08-01). "ON THE SEPARATION OF HISTIDINE AND ARGININE IV. ... was a Swedish chemist and physiologist credited with the discovery of histidine. He was born in Alseda parish, Jönköping County ...
https://en.wikipedia.org/wiki/Sven_Gustaf_Hedin
Protein phosphorylationProtein phosphorylation
Phosphorylation usually occurs on serine, threonine, tyrosine and histidine residues in eukaryotic proteins. Histidine ... Histidine and aspartate phosphorylation occurs in prokaryotes as part of two-component signaling and in some cases in ... Once histidine is phosphorylated the regulatory domain of the response regulator catalyzes the transfer of the phosphate to ... and In prokaryotes, archea, and some lower eukaryotes histidine's nitrogen act as a nucleophile and binds to a phosphate group ...
https://en.wikipedia.org/wiki/Protein_phosphorylation
Beverly GuirardBeverly Guirard
Lysine, Histidine, Arginine, and Valine". Proceedings of the Society for Experimental Biology and Medicine. 61 (2): 158-161. ... Rosenthaler, J.; Guirard, B. M.; Chang, G. W.; Snell, E. E. (1965-07-01). "Purification and properties of histidine ... Guirard, B M; Tanase, S; Snell, E E (1984-01-01). "Pyridoxal-P dependent bacterial histidine decarboxylase". Progress in ... Rosenthaler, J.; Guirard, B. M.; Chang, G. W.; Snell, E. E. (1965-07-01). "Purification and properties of histidine ...
https://en.wikipedia.org/wiki/Beverly_Guirard
Essential amino acidEssential amino acid
Rose's later work showed that eight amino acids are essential for adult human beings, with histidine also being essential for ... Kopple JD, Swendseid ME (May 1975). "Evidence that histidine is an essential amino acid in normal and chronically uremic man". ... Of the twenty amino acids common to all life forms (not counting selenocysteine), humans cannot synthesize nine: histidine, ... The role of threonine and histidine". The Journal of Biological Chemistry. 188 (1): 49-58. doi:10.1016/S0021-9258(18)56144-5. ...
https://en.wikipedia.org/wiki/Essential_amino_acid
MeNZBMeNZB
histidine (to stabilise the pH). The histidine pH buffer is to ensure the vaccine stays as close as possible to the pH of human ... Outer membrane vesicles are purified out of the culture medium by ultracentrifugation, stabilised by histidine and then ...
https://en.wikipedia.org/wiki/MeNZB
Glutamine amidotransferaseGlutamine amidotransferase
... and the histidine amidotransferase hisH. Weng ML, Zalkin H (July 1987). "Structural role for a conserved region in the CTP ... histidine and glutamate. Class-I GATase domains have been found in the following enzymes: the second component of anthranilate ...
https://en.wikipedia.org/wiki/Glutamine_amidotransferase
Phosphoribosyl-ATP diphosphatasePhosphoribosyl-ATP diphosphatase
This enzyme participates in histidine metabolism. It employs one cofactor, H+. This enzyme belongs to the family of hydrolases ... Smith DW, Ames BN (July 1965). "Phosphoribosyladenosine monophosphate, an intermediate in histidine biosynthesis". The Journal ...
https://en.wikipedia.org/wiki/Phosphoribosyl-ATP_diphosphatase
Histidinol dehydrogenaseHistidinol dehydrogenase
... catalyzes the terminal step in the biosynthesis of histidine in bacteria, fungi, and plants, the four- ... Adams E (1955). "L-Histidinal, a biosynthetic precursor of histidine". J. Biol. Chem. 217 (1): 325-344. doi:10.1016/S0021-9258( ... Adams E (1954). "Enzymatic synthesis of histidine from histidinol". J. Biol. Chem. 209 (2): 829-846. doi:10.1016/S0021-9258(18) ... L-histidine + 2 NADH + 2 H+ Thus, the two substrates of this enzyme are L-histidinol and NAD+, whereas its 3 products are L- ...
https://en.wikipedia.org/wiki/Histidinol_dehydrogenase
KIAA1841KIAA1841
There is a higher percent composition of alanine, histidine and leucine and a lower composition of lysine. The protein sequence ... Humans and closely related orthologs are composed of 2.2% to 3.8% histidine compared to 5% in Batrachochytrium dendrobatidis. ...
https://en.wikipedia.org/wiki/KIAA1841
TRNA(His) guanylyltransferaseTRNA(His) guanylyltransferase
... (EC 2.7.7.79, histidine tRNA guanylyltransferase, Thg1p, Thg1) is an enzyme with systematic name ... Pande S, Jahn D, Söll D (December 1991). "Histidine tRNA guanylyltransferase from Saccharomyces cerevisiae. I. Purification and ... Jahn D, Pande S (December 1991). "Histidine tRNA guanylyltransferase from Saccharomyces cerevisiae. II. Catalytic mechanism". ...
https://en.wikipedia.org/wiki/TRNA(His)_guanylyltransferase
Hermann PaulyHermann Pauly
A histidine ring did the same. These discoveries proved invaluable to the work of Karl Landsteiner on immunity and allergy. H. ... He is known for the Pauly reaction, a chemical test used for detecting the presence of tyrosine or histidine in proteins. ... a method of detecting the presence of the amino acids tyrosine or histidine in proteins. In 1915 Pauly used diazo-benzene ...
https://en.wikipedia.org/wiki/Hermann_Pauly
CystatinCystatin
... s show similarity to fetuins, kininogens, histidine-rich glycoproteins and cystatin-related proteins. Cystatins mainly ... kininogen and histidine-rich glycoprotein". Frontiers in Bioscience. 14 (14): 2911-22. doi:10.2741/3422. PMID 19273244. ...
https://en.wikipedia.org/wiki/Cystatin
ImidazolonepropionaseImidazolonepropionase
This enzyme participates in histidine metabolism. As of late 2007, 6 structures have been solved for this class of enzymes, ... Snyder SH, Silva OL, Kies MW (1961). "The mammalian metabolism of L-histidine. IV. Purification and properties of imidazolone ...
https://en.wikipedia.org/wiki/Imidazolonepropionase
Active siteActive site
Candidate include aspartate, glutamate, histidine, cysteine. These acids and bases can stabilise the nucleophile or ...
https://en.wikipedia.org/wiki/Active_site
Phosphoribosyl-AMP cyclohydrolasePhosphoribosyl-AMP cyclohydrolase
This enzyme participates in histidine metabolism. As of late 2007, only one structure has been solved for this class of enzymes ... Minson AC, Creaser EH (1969). "Purification of a trifunctional enzyme, catalysing three steps of the histidine pathway, from ...
https://en.wikipedia.org/wiki/Phosphoribosyl-AMP_cyclohydrolase
Carnosine N-methyltransferaseCarnosine N-methyltransferase
This enzyme participates in histidine metabolism. The genes encoding carnosine N-methyltransferase activity have been ...
https://en.wikipedia.org/wiki/Carnosine_N-methyltransferase
Imidazoleacetate-phosphoribosyldiphosphate ligaseImidazoleacetate-phosphoribosyldiphosphate ligase
This enzyme participates in histidine metabolism. Crowley GM (August 1964). "The enzymatic synthesis of 5'- ...
https://en.wikipedia.org/wiki/Imidazoleacetate—phosphoribosyldiphosphate_ligase
FormimidoylglutamaseFormimidoylglutamase
This enzyme participates in histidine metabolism. As of late 2007, two structures have been solved for this class of enzymes, ... two enzymes of the histidine degradation pathway". J. Biol. Chem. 245 (14): 3536-44. PMID 4990470. Lund P, Magasanik B (1965 ...
https://en.wikipedia.org/wiki/Formimidoylglutamase
Formimidoylaspartate deiminaseFormimidoylaspartate deiminase
This enzyme participates in histidine metabolism. HAYAISHI O, TABOR H, HAYAISHI T (1957). "N-formimino-L-aspartic acid as an ...
https://en.wikipedia.org/wiki/Formimidoylaspartate_deiminase
Formimidoylglutamate deiminaseFormimidoylglutamate deiminase
This enzyme participates in histidine metabolism. Wickner RB, Tabor H (1971). "N-Formimino-L-glutamate iminohydrolase ( ...
https://en.wikipedia.org/wiki/Formimidoylglutamate_deiminase
MeciadanolMeciadanol
It inhibits histidine decarboxylase in rats. Konturek, Stanislaw J; Ellen Kitler, Mary; Brzozowski, Tomasz; Radecki, Tadeusz ( ... Histidine decarboxylase inhibitors, All stub articles, Aromatic compound stubs). ...
https://en.wikipedia.org/wiki/Meciadanol
Imidazoleacetate 4-monooxygenaseImidazoleacetate 4-monooxygenase
This enzyme participates in histidine metabolism. It employs one cofactor, FAD. Maki Y, Yamamoto S, Nozaki M, Hayaishi O (1969 ...
https://en.wikipedia.org/wiki/Imidazoleacetate_4-monooxygenase
histidine | Infopleasehistidine | Infoplease
Histidine is the direct precursor of histamine; it is also an important source of carbon atoms ... histidine hĭs´tĭdēn [key], organic compound, one of the 22 α-amino acids commonly found in animal proteins. Only the l. - ... Histidine is the direct precursor of histamine; it is also an important source of carbon atoms in the synthesis of purines. The ... Histidine is considered to be an essential amino acid for infants (it must be supplied in the diet); experiments with adults ...
https://www.infoplease.com/encyclopedia/science/biochemistry/concepts/histidine
Browsing by Subject HistidineBrowsing by Subject "Histidine"
False-negative RDT results and implications of new reports of P. falciparum histidine-rich protein 2/3 gene deletions  ... False-negative RDT results and implications of new reports of P. falciparum histidine-rich protein 2/3 gene deletions: ...
https://extranet.who.int/iris/restricted/browse?authority=Histidine&type=mesh
MP Biomedicals Inc L-Histidine Monohydrochloride Monohydrate, MP Biomedical | Fisher ScientificMP Biomedicals Inc L-Histidine Monohydrochloride Monohydrate, MP Biomedical | Fisher Scientific
Shop MP Biomedicals Inc L-Histidine Monohydrochloride Monohydrate, MP Biomedical at Fishersci.ca ... l-histidine hydrochloride hydrate, l-histidine hydrochloride monohydrate, s-2-amino-3-1h-imidazol-4-yl propanoic acid ... l-histidine hydrochloride hydrate, l-histidine hydrochloride monohydrate, s-2-amino-3-1h-imidazol-4-yl propanoic acid ... l-histidine, monohydrochloride, monohydrate, l-histidin hydrate hydrochloride, histidine, monohydrochloride, monohydrate, l, h- ...
https://www.fishersci.ca/shop/products/l-histidine-monohydrochloride-monohydrate-mp-biomedical-4/icn10195790
RCSB PDB - 5O7J: Structural insights into the periplasmic sensor domain of the GacS histidine kinase controlling biofilm...RCSB PDB - 5O7J: Structural insights into the periplasmic sensor domain of the GacS histidine kinase controlling biofilm...
Structural insights into the periplasmic sensor domain of the GacS histidine kinase controlling biofilm formation in ... Histidine kinase. A. 150. Pseudomonas aeruginosa. Mutation(s): 0 Gene Names: gacS, PAMH19_4268. EC: 2.7.13.3. ... Here, we investigate the functional role of the periplasmic detector domain (GacS PD ) from the membrane-bound GacS histidine ... Here, we investigate the functional role of the periplasmic detector domain (GacS PD ) from the membrane-bound GacS histidine ...
https://www.rcsb.org/structure/5o7j
Histidine provides long-term neuroprotection after cerebral ischemia through promoting astrocyte migration | Scientific ReportsHistidine provides long-term neuroprotection after cerebral ischemia through promoting astrocyte migration | Scientific Reports
With various administration regimens constructed for histidine, a precursor of histamine, we found that histidine treatment at ... Our data indicated that a dose/stage-dependent histidine treatment, mediated by H2 receptor, promoted astrocyte migration ... H2 receptor antagonists reversed the promotion of astrocyte migration and the neuroprotection provided by histidine. Moreover, ... abrogated the neuroprotection of histidine and its promotion of astrocyte migration. ...
https://www.nature.com/articles/srep15356?error=cookies_not_supported&code=f52f3149-c0aa-45ea-97b2-6b3a0aeb2a09
Figure 1 - Major Threat to Malaria Control Programs by Plasmodium falciparum Lacking Histidine-Rich Protein 2, Eritrea - Volume...Figure 1 - Major Threat to Malaria Control Programs by Plasmodium falciparum Lacking Histidine-Rich Protein 2, Eritrea - Volume...
Major Threat to Malaria Control Programs by Plasmodium falciparum Lacking Histidine-Rich Protein 2, Eritrea Araia Berhane, ... Major Threat to Malaria Control Programs by Plasmodium falciparum Lacking Histidine-Rich Protein 2, Eritrea. ... for analysis of a major threat to malaria control programs by Plasmodium falciparum lacking histidine-rich protein 2. Inset ...
https://wwwnc.cdc.gov/eid/article/24/3/17-1723-f1
L-HistidineL-Histidine
N.E.E.D.S., Chemical Sensitivity, Environmental Illness, Fibromyalgia, Candida, Vitamins & Supplements, Personal Care, Books, Pet Care, Gluten-Free, Domestic, Environmental
https://www.needs.com/prod_detail_list/htc_L_Histidine
Aminosyn 8.5% with Electrolytes (Arginine; Glycine; Histidine...) AbbottAminosyn 8.5% with Electrolytes (Arginine; Glycine; Histidine...) Abbott
Histidine*Isoleucine*L-Alanine*Leucine*Lysine*Magnesium Chloride*Methionine*Phenylalanine*Potassium Phosphate Dibasic*Proline* ...
https://drugs-about.com/drugs-a/aminosyn-8-5-electrolytes.html
SCOP 1.55: Protein: Histidine kinase FixL heme domainSCOP 1.55: Protein: Histidine kinase FixL heme domain
Timeline for Protein Histidine kinase FixL heme domain from d.110.3.2: Histidine kinase FixL heme domain: *Protein Histidine ... Protein Histidine kinase FixL heme domain from d.110.3.2: Histidine kinase FixL heme domain appears in the current release, ... More info for Protein Histidine kinase FixL heme domain from d.110.3.2: Histidine kinase FixL heme domain. ... Lineage for Protein: Histidine kinase FixL heme domain. *Root: SCOP 1.55 *. Class d: Alpha and beta proteins (a+b) [53931] (184 ...
http://scop.berkeley.edu/sunid=55790&ver=1.55
Hint1 MGI Mouse Gene Detail - MGI:1321133 - histidine triad nucleotide binding protein 1Hint1 MGI Mouse Gene Detail - MGI:1321133 - histidine triad nucleotide binding protein 1
View mouse Hint1 Chr11:54757209-54761327 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
http://www.informatics.jax.org/marker/MGI:1321133
RCSB PDB - 3T4Q: Arabidopsis histidine kinase 4 sensor domain in complex with trans-zeatin riboside (hydrolysed)RCSB PDB - 3T4Q: Arabidopsis histidine kinase 4 sensor domain in complex with trans-zeatin riboside (hydrolysed)
Arabidopsis histidine kinase 4 sensor domain in complex with trans-zeatin riboside (hydrolysed) ... Histidine kinase 4. A, B. 270. Arabidopsis thaliana. Mutation(s): 0 Gene Names: AHK4, At2g01830, CRE1, RAW1, T23K3.2, WOL. EC: ... Arabidopsis histidine kinase 4 sensor domain in complex with trans-zeatin riboside (hydrolysed). *PDB DOI: 10.2210/pdb3T4Q/pdb ... Structural basis for cytokinin recognition by Arabidopsis thaliana histidine kinase 4.. Hothorn, M., Dabi, T., Chory, J.. (2011 ...
https://www.rcsb.org/structure/3T4Q
L-Histidine Base Powder - Pure Bulk Health Supplements - PureBulk, Inc.L-Histidine Base Powder - Pure Bulk Health Supplements - PureBulk, Inc.
Supplementation of L-histidine is necessary for protein synthesis and to provide support for healthy metabolic and immune ... L-Histidine Base vs. L-Histidine HCl. The primary difference between l-histidine base powder and l-histidine HCl is that the ... What is L-Histidine?. L-Histidine is an essential amino acid, meaning the body needs it but cannot innately produce it. Its a ... Potential Histidine Benefits. Histidine and Immune Health. Histamine acts as an antioxidant and immunomodulator in the immune ...
https://purebulk.com/collections/amino-acids/products/l-histidine-base
The role of polyproline motifs in the histidine kinase EnvZThe role of polyproline motifs in the histidine kinase EnvZ
Motz, Magdalena; Jung, Kirsten (2018): The role of polyproline motifs in the histidine kinase EnvZ. In: PLOS One 13(6), ... Here we have investigated the roles of two polyP motifs in the osmosensor and histidine kinase EnvZ. We show that the I PPPL ... For example, polyP motifs are found in more than half of all histidine kinases in Escherichia coli K-12, which raises the ...
https://epub.ub.uni-muenchen.de/68184/
Histidine [Natural Amino Acid Derivatives] | TCI Deutschland GmbHHistidine [Natural Amino Acid Derivatives] | TCI Deutschland GmbH
Nα-[(9H-Fluoren-9-ylmethoxy)carbonyl]-τ-(triphenylmethyl)-L-histidine ... Nα-[(9H-Fluoren-9-ylmethoxy)carbonyl]-τ-(triphenylmethyl)-D-histidine ... Nα-[(9H-Fluoren-9-ylmethoxy)carbonyl]-τ-(triphenylmethyl)-L-histidine ... Nα-[(9H-Fluoren-9-ylmethoxy)carbonyl]-τ-(triphenylmethyl)-D-histidine ...
https://www.tcichemicals.com/DE/en/c/12331
Histidine in broiler chickensHistidine in broiler chickens
Histidine is the essential amino acid to be considered in the short and medium term in broiler chickens diets. ... Histidine requirements in Broiler chickens. If we go through the different scientific publications referring to the histidine ... make imperative to review the histidine requirements in the animals. In addition, improving knowledge about the histidine ... Now, Histidine obtained by fermentation is available on the market as a feed additive, being a key tool to move towards more ...
https://www.quimidroga.com/en/2022/01/18/histidine-the-next-limiting-essential-amino-acid-in-broiler-chickens-diets/
MedlinePlus - Search Results for: ALANINE OR ARGININE OR ASPARTIC ACID OR GLUTAMIC ACID OR GLYCINE OR HISTIDINE OR ISOLEUCINE...
Two-dimensional protein crystallization via metal-ion coordination by naturally occurring surface histidines - CaltechAUTHORSTwo-dimensional protein crystallization via metal-ion coordination by naturally occurring surface histidines - CaltechAUTHORS
Two-dimensional protein crystallization via metal-ion coordination by naturally occurring surface histidines ... Two-dimensional protein crystallization via metal-ion coordination by naturally occurring surface histidines. Proceedings of ... general approach to the targeting and crystallization of proteins on lipid interfaces through coordination of surface histidine ...
https://authors.library.caltech.edu/643/
Specific Histidine Residues Confer Histatin Peptides with Copper-Dependent Activity against Candida albicans | Scholars@DukeSpecific Histidine Residues Confer Histatin Peptides with Copper-Dependent Activity against Candida albicans | [email protected]
Specific Histidine Residues Confer Histatin Peptides with Copper-Dependent Activity against Candida albicans ... The histidine-rich salivary peptides of the histatin family are known to bind copper (Cu) and other metal ions in vitro; ... Specific Histidine Residues Confer Histatin Peptides with Copper-Dependent Activity against Candida albicans Journal Article ( ... Together, these results establish new structure-function relationships linking specific histidine residues with Cu binding ...
https://scholars.duke.edu/display/pub1267631
Genetic variation of Plasmodium falciparum histidine-rich protein 2 and 3 in Assosa zone, Ethiopia: its impact on the...Genetic variation of Plasmodium falciparum histidine-rich protein 2 and 3 in Assosa zone, Ethiopia: its impact on the...
However, false negative results of RDT caused by genetic variation of P. falciparum histidine-rich protein 2 and 3 genes ( ... From: Genetic variation of Plasmodium falciparum histidine-rich protein 2 and 3 in Assosa zone, Ethiopia: its impact on the ...
https://malariajournal.biomedcentral.com/articles/10.1186/s12936-021-03928-3/tables/1
Histidine-rich protein 2 (pfhrp2) and pfhrp3 gene deletions in Plasmodium falciparum isolates from select sites in Brazil and...Histidine-rich protein 2 (pfhrp2) and pfhrp3 gene deletions in Plasmodium falciparum isolates from select sites in Brazil and...
Plasmodium falciparum Histidine-Rich Protein 2 and 3 Gene Deletions in Strains from Nigeria, Sudan, and South Sudan Cite ... Histidine-rich protein 2 (pfhrp2) and pfhrp3 gene deletions in Plasmodium falciparum isolates from select sites in Brazil and ... Histidine-rich protein 2 (pfhrp2) and pfhrp3 gene deletions in Plasmodium falciparum isolates from select sites in Brazil and ... Deletion of histidine-rich protein genes pfhrp2/3 in Plasmodium falciparum causes infections to go undetected by HRP2-based ...
https://stacks.cdc.gov/view/cdc/46198
Copper binding and reactivity at the histidine brace motif - ResultCopper binding and reactivity at the histidine brace motif - Result
Copper binding and reactivity at the histidine brace motif: insights from mutational analysis of the Pseudomonas fluorescens ...
https://research.ku.dk/search/result/?pure=en%2Fpublications%2Fcopper-binding-and-reactivity-at-the-histidine-brace-motif
sup|14|/sup|C]histidine | Ligand page | IUPHAR/BPS Guide to PHARMACOLOGYsup|14|/sup|C]histidine | Ligand page | IUPHAR/BPS Guide to PHARMACOLOGY
The IUPHAR/BPS Guide to Pharmacology. [14C]histidine ligand page.
https://www.guidetopharmacology.org/GRAC/LigandDisplayForward?ligandId=4623
Effects of dietary potato by-product and rumen-protected histidine on growth, carcass characteristics and quality attributes of...Effects of dietary potato by-product and rumen-protected histidine on growth, carcass characteristics and quality attributes of...
Dive into the research topics of Effects of dietary potato by-product and rumen-protected histidine on growth, carcass ... Effects of dietary potato by-product and rumen-protected histidine on growth, carcass characteristics and quality attributes of ... Effects of dietary potato by-product and rumen-protected histidine on growth, carcass characteristics and quality attributes of ... Effects of dietary potato by-product and rumen-protected histidine on growth, carcass characteristics and quality attributes of ...
https://experts.umn.edu/en/publications/effects-of-dietary-potato-by-product-and-rumen-protected-histidin
ENEN
L-Histidine Base EP, fermented - L-Histidine mono hydrochloride EP/FCC, ferm. ...
https://www.pfannenschmidt.de/Histidine
Genetic and molecular identification of a Drosophila histidine decarboxylase gene required in photoreceptor transmitter...
Burg, M. G., Sarthy, P. V., Koliantz, G., & Pak, W. L. (1993). Genetic and molecular identification of a Drosophila histidine ... Burg, MG, Sarthy, PV, Koliantz, G & Pak, WL 1993, Genetic and molecular identification of a Drosophila histidine decarboxylase ... keywords = "Drosophila, Histidine decarboxylase gene, Mutant, Photoreceptor, Synaptic transmission",. author = "Burg, {M. G.} ... The results thus show that the Drosophila homolog corresponds to the histidine decarboxylase gene, identified by the hdc ...
https://www.scholars.northwestern.edu/en/publications/genetic-and-molecular-identification-of-a-drosophila-histidine-de
Finding step braF for L-histidine catabolism in Herbaspirillum seropedicae SmR1
4 candidates for braF: ABC transporter for glutamate, histidine, arginine, and other amino acids, ATPase component 1 (BraF). ... Finding step braF for L-histidine catabolism in Herbaspirillum seropedicae SmR1. ...
https://papers.genomics.lbl.gov/cgi-bin/gapView.cgi?orgs=orgsFit&set=carbon&orgId=FitnessBrowser__HerbieS&path=histidine&step=braF
Multiple genetic origins of histidine-rich protein 2 gene deletion in Plasmodium falciparum parasites from PeruMultiple genetic origins of histidine-rich protein 2 gene deletion in Plasmodium falciparum parasites from Peru
Histidine-rich protein 2 (pfhrp2) and pfhrp3 gene deletions in Plasmodium falciparum isolates from select sites in Brazil and ... Title : Histidine-rich protein 2 (pfhrp2) and pfhrp3 gene deletions in Plasmodium falciparum isolates from select sites in ... More than 80% of available malaria rapid diagnostic tests (RDTs) are based on the detection of histidine-rich protein-2 (PfHRP2 ... Multiple genetic origins of histidine-rich protein 2 gene deletion in Plasmodium falciparum parasites from Peru. ...
https://stacks.cdc.gov/view/cdc/21169
Almond - WikipediaAlmond - Wikipedia
Histidine. 0.557 g. Alanine. 1.027 g. Aspartic acid. 2.911 g. Glutamic acid. 6.810 g. ...
https://en.wikipedia.org/wiki/Almond
IMSEAR at SEARO: Histidine-15 and lytic activity of lysozyme.
The literature data on the activity of histidine-15 modified hen egg white lysozyme are conflicting: the modified enzyme is ... Our analysis suggests that even though histidine-15 is far removed from the active site of lysozyme, its chemical modification ... Ugrankar Madhuri M, Krishnamoorthy G, Prabhananda Bala S. Histidine-15 and lytic activity of lysozyme. Journal of Biosciences. ...
https://imsear.searo.who.int/handle/123456789/160742
HistidineHistidine
... Standard codons for H : CAC CAT Substitution preferences:. All protein types:. Favoured. Tyr ( 2). Asn ( 1). ... In this context, it is quite rare to see Histidine exchange for any amino acid at all.. Back to main page Please cite: M.J. ... Substitutions: Histidine is a generally considered to be a polar amino acid, however it is quite unique with regard to ... Role in structure: Histidine has a pKa near to that of physiological pH, meaning that it is relatively easy to move protons on ...
http://www.russelllab.org/aas/His.html
IsoleucineArginineProteinKinaseHistamineResiduesDecarboxylaseAmino acidProteinsLysineMonohydrochloride monohydrateGlycoproteinKinasesCysteineFetalCarnosineSupplementationGapMindEnzymeNutrientGene deliveryHeavy metalsConcentrationsPharmaceuticalDietsMolecularDetectionBeneficialStomachExclusivelyPowderStructuralSupplementsAcidScientific
Isoleucine1
  • New crystalline amino acids , such as isoleucine, arginine and histidine, have recently arrived on the market to help us to meet these new challenges brought about by nutrition in order to be more sustainable. (quimidroga.com)
Arginine2
  • The first peak eluted just before ammonia , the second and third immediately after ammonia , and the fourth peak much later, between histidine and arginine. (cdc.gov)
  • Amino Acids from Hydrolized Rice Protein L-Arginine L-Glutamine, L-Glycine, L-Lysine, L-Tyrosine, L-Valine, L-Histidine L-Phenylalanine. (vitaminlife.com)
Protein12
  • Location of study sites at Ghindae and Massawa Hospitals, Eritrea, for analysis of a major threat to malaria control programs by Plasmodium falciparum lacking histidine-rich protein 2. (cdc.gov)
  • Histidine deficiencies slowly cause negative nitrogen balances, which impair the body's ability to repair tissues, weaken the immune system, and hinder protein synthesis. (purebulk.com)
  • Histidine-rich Ca-binding protein (HRC) resides in the lumen of the SR, where it contributes to the regulation of Ca cycling by protecting stressed or failing hearts. (researcher-app.com)
  • The first is that it means Histidines is rather ambiguous about whether it prefers to be buried in the protein core, or exposed to solvent. (russelllab.org)
  • Histidines are the most common amino acids in protein active or binding sites. (russelllab.org)
  • Hisactophilin, a histidine-rich actin-binding protein from Dictyostelium discoideum. (unil.ch)
  • Recombinant Mouse Dkk-1 (Histidine-tagged) Protein Bioactivity Recombinant Mouse Wnt-3a (Catalog # 1324-WN ) induces a dose responsive increase in Wnt reporter activity in HEK293 cells (green circles). (bio-techne.com)
  • False-negative results for Plasmodium falciparum histidine-rich protein (HRP) 2-based rapid diagnostic tests (RDTs) are increasing in Eritrea. (cdc.gov)
  • RDTs that detect P. falciparum and P. vivax simultaneously by targeting histidine-rich protein 2 (HRP2) and P. vivax plasmodium lactate dehydrogenase (pLDH), and met the World Health Organization (WHO)-recommended procurement criteria ( 5 ) were implemented in Eritrea with a quality assurance program that included training operators regularly and testing RDT lots before distribution. (cdc.gov)
  • ATP + protein L-histidine = ADP + protein N-phospho-L-histidine. (systemsbiology.net)
  • The number of children with single nucleotide polymorphisms of P. falciparum histidine-rich protein 2 and 3 genes. (who.int)
  • Malaria (P. f/P. v) Antigen Testing Kit is a rapid self-performing, qualitative, two site sandwich immunoassay, utilizing whole blood for the detection of P.falciparum specific histidine rich protein-2 (P.f HRP-2) and P.vivax specific pLDH. (who.int)
Kinase2
  • Crystal structures of the Arabidopsis thaliana histidine kinase 4 sensor domain in complex with different cytokinin ligands now rationalize the hormone-binding specificity of the receptor and may spur the design of new cytokinin ligands. (rcsb.org)
  • Here we have investigated the roles of two polyP motifs in the osmosensor and histidine kinase EnvZ. (uni-muenchen.de)
Histamine13
  • With various administration regimens constructed for histidine, a precursor of histamine, we found that histidine treatment at a high dose at early stage and a low dose at late stage demonstrated the most remarkable long-term neuroprotection with decreased infarct volume and improved neurological function. (nature.com)
  • Moreover, histamine upregulated the GTP-bound small GTPase Rac1, while a Rac1 inhibitor, NSC23766, abrogated the neuroprotection of histidine and its promotion of astrocyte migration. (nature.com)
  • Drosophila mutants of a single complementation group with defective on-/off-transients of the electroretinogram (ERG) were found to be deficient in synthesis of the photoreceptor transmitter, histamine, in a gene-dosage dependent manner, suggesting that the gene identified by the mutants (hdc) might be the structural gene for Drosophila histidine decarboxylase (HDC). (northwestern.edu)
  • The essential amino acid histidine is probably best known as a precursor to histamine, a substance integral to a healthy immune system. (drkimwellness.com)
  • The reaction involves two sequential steps: the decarboxylation of l -histidine and the protonation of the generated intermediate from which results histamine. (henriquefernandes.pt)
  • Histidine is also a precursor of histamine, a compound released by immune system cells during an allergic reaction. (3r-medical.com)
  • They may be helped by an amino acid, which counteracts the formation of histamine from histidine, or the activity of histamine, namely methionine. (3r-medical.com)
  • Men and women having difficulties achieving orgasms may be helped by histidine supplementation, as this may result in increased histamine levels in the sexual tract, which in turn may make orgasms and ejaculations easier. (3r-medical.com)
  • The recent cloning of a cDNA encoding fetal rat liver histidine decarboxylase (HDC), the synthesizing enzyme for histamine, allows the study of the central histaminergic system at the molecular level. (elsevier.com)
  • Investigation on beneficial role of l-carnosine in neuroprotective mechanism of ischemic postconditioning in mice: possible role of histidine histamine pathway. (bvsalud.org)
  • The present study was undertaken to investigate the possible role of histidine - histamine pathway in the neuroprotective effects produced by L-carnosine hand in hand with ischemic postconditioning in the animal model of cerebral ischemia . (bvsalud.org)
  • It is concluded that L-carnosine exerts neuroprotective effect via involvement of histidine - histamine pathway since the beneficial effects of L-carnosine were abolished by the H2-blocker. (bvsalud.org)
  • Amino acids like histidine and phenylalanine are required to synthesize neurotransmitters like dopamine, histamine, epinephrine and norepinephrine. (nutrabay.com)
Residues4
  • A powerful and potentially general approach to the targeting and crystallization of proteins on lipid interfaces through coordination of surface histidine residues to lipid-chelated divalent metal ions is presented. (caltech.edu)
  • Together, these results establish new structure-function relationships linking specific histidine residues with Cu binding affinity and antifungal activity and provide further evidence of the involvement of metals in modulating the biological activity of these antifungal peptides. (duke.edu)
  • Three have histidine residues and the fourth is OPL. (cdc.gov)
  • I am using Rosetta 3.9 from the TACC for my Matcher run and want to use alternative protonation states of the amino acids I am working with, such as deprotonated cysteine CYZ or delta-Nitrogen-protonated histidine, His_D. Rosetta already has these residues defined in its database but Matcher can't recognize them at all. (rosettacommons.org)
Decarboxylase2
  • The results thus show that the Drosophila homolog corresponds to the histidine decarboxylase gene, identified by the hdc mutants, and that mutations in the gene disrupt photoreceptor synaptic transmission. (northwestern.edu)
  • The catalytic mechanism of histidine decarboxylase (HDC), a pyridoxal-5′-phosphate (PLP)-dependent enzyme, was studied by using a computational QM/MM approach following the scheme M06-2X/6-311++G(3df,2pd):Amber. (henriquefernandes.pt)
Amino acid8
  • L-Histidine is an essential amino acid, meaning the body needs it but cannot innately produce it. (purebulk.com)
  • Histidine, the next limiting essential amino acid in broiler chickens' diets? (quimidroga.com)
  • In this short article we would like to review available information about histidine requirements in broiler chickens, together with this amino acid content in the raw materials most frequently used in our formulations. (quimidroga.com)
  • The importance of histidine in the synthesis of the carnosine and anserine dipeptides links this amino acid directly to the quality of meat, and in this case, of the breast. (quimidroga.com)
  • Histidine is a generally considered to be a polar amino acid, however it is quite unique with regard to properties, meaning that it does not particularly substitute well with any other amino acid (see above). (russelllab.org)
  • In this context, it is quite rare to see Histidine exchange for any amino acid at all. (russelllab.org)
  • L-Histidine, provided by HealthyHey supplies 1000 mg of the amino acid in each capsule. (healthyhey.com)
  • Histidine is an essential amino acid during infancy, and its synthetic pathways in older children and adults are not well understood. (3r-medical.com)
Proteins5
  • histidine hÄ­s´tÄ­dÄ“n [ key ] , organic compound, one of the 22 α- amino acids commonly found in animal proteins. (infoplease.com)
  • This turns out to be an important property when histidine is incorporated into proteins , particularly when it becomes a part of the primary structure of some enzymes . (infoplease.com)
  • The filaggrin proteins release histidine into the skin, where it functions as a natural moisturizing factor (NMF). (purebulk.com)
  • Our observation that the structural features of conserved histidines and their functional role in two related proteins can be quite different is novel. (utmb.edu)
  • Sepuru, KM & Rajarathnam, K 2018, ' Distinct Differences in Structural States of Conserved Histidines in Two Related Proteins: NMR Studies of the Chemokines CXCL1 and CXCL8 in the Free Form and Macromolecular Complexes ', Biochemistry , vol. 57, no. 41, pp. 5969-5977. (utmb.edu)
Lysine1
  • Inactivation of plasma alpha1-proteinase inhibitor by acrolein: adduct formation with lysine and histidine. (cdc.gov)
Monohydrochloride monohydrate1
  • 5. L-histidine monohydrochloride monohydrate (L- wool, and capped with plastic caps. (cdc.gov)
Glycoprotein1
  • Histidine-rich glycoprotein (HRG) is an approximately 75-kDa glycoprotein mainly synthesized in the liver and present at a level of 60-150 μg/mL in healthy individuals. (medscape.com)
Kinases1
  • For example, polyP motifs are found in more than half of all histidine kinases in Escherichia coli K-12, which raises the question of their role(s) in receptor function. (uni-muenchen.de)
Cysteine1
  • Thus in this context, it is common to see Histidine replaced by Cysteine . (russelllab.org)
Fetal1
  • Several ultrasonographically guided intramuscular injections of copper histidine raised fetal plasma copper and ceruloplasmin levels, but the distinctively abnormal plasma catechol pattern persisted. (medscape.com)
Carnosine3
  • Histidine deficiencies can be difficult to recognize, as the body can compensate to the detriment of carnosine and hemoglobin concentrations. (purebulk.com)
  • Certain histidine compounds e.g. carnosine, anserine and ergothionine are found in the blood and tissues. (3r-medical.com)
  • Imidazole amino aciduria: In this condition large amounts of carnosine and anserine as well as histidine and 1-methyl histidine have been observed to be excreted through urine together with a condition of cerebromacular degeneration. (3r-medical.com)
Supplementation1
  • the proportion of potato-by-product (PBP) and rumen protected histidine (His) supplementation may influence growth and meat quality attributes. (umn.edu)
GapMind1
  • Overview: Histidine biosynthesis in GapMind is based on the MetaCyc pathway ( link ). (lbl.gov)
Enzyme4
  • The literature data on the activity of histidine-15 modified hen egg white lysozyme are conflicting: the modified enzyme is reported to have more activity, similar activity or less activity by different authors. (who.int)
  • Histidinemia: The defect is due to hypoactivity of the enzyme histidase present in the liver, interfering with the normal degradation of histidine. (3r-medical.com)
  • Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Histidine Ammonia Lyase (HAL) in Tissue homogenates, cell lysates and other biological fluids. (myelisakit.com)
  • Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Histidine Ammonia Lyase (HAL) in samples from Tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. (myelisakit.com)
Nutrient1
  • In the stomach, histidine is also helpful in producing gastric juices, and people with deficiency of gastric juices or suffering from indigestion, may also benefit from this nutrient. (3r-medical.com)
Gene delivery1
  • Histidine-enhanced gene delivery systems: The state of the art. (cdc.gov)
Heavy metals1
  • Lastly, histidine has chelating properties that allow it to bind to and cleanse the body of toxic heavy metals. (purebulk.com)
Concentrations1
  • What is the concentration of the [0] form of histidine in a solution at pH 6.4 in which the sum of the concentrations of all 4 forms of histidine is 1 M. The pKa values of the a-carboxyl, a-amino, and side chain groups of Histidine are 1.82, 9.2, and 6.0, respectively. (originalpapers.net)
Pharmaceutical2
  • Product Description Features pharmaceutical grade AjiPure L-histidine Supports healthy immune system function Encourages superoxide dismutase p. (drkimwellness.com)
  • Our vegetarian-source AjiPure® L-Histidine is produced by Ajinomoto AminoScience, the world leader in pharmaceutical grade aminos. (drkimwellness.com)
Diets1
  • While most people get plenty of histidine in their diets, healthcare providers recommend supplements for those in need of a little boost. (drkimwellness.com)
Molecular1
  • We further propose that directly probing the imidazole structural features is essential to fully appreciate the molecular basis of histidine function. (utmb.edu)
Detection1
  • Description: A sandwich ELISA kit for detection of Histidine Ammonia Lyase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. (myelisakit.com)
Beneficial1
  • It is thought that histidine may be beneficial to people suffering from arthritis and nerve deafness. (3r-medical.com)
Stomach1
  • Some individuals may experience digestive upset while taking l-histidine base powder, as it may neutralize stomach acid. (purebulk.com)
Exclusively1
  • Further, both histidines exclusively exist as the imidazolium in the GAG-bound and as the N ϵ2 tautomer in the receptor-bound forms. (utmb.edu)
Powder1
  • The primary difference between l-histidine base powder and l-histidine HCl is that the HCl form includes hydrochloric acid. (purebulk.com)
Structural1
  • Here, we characterized the structural features of histidines in the chemokines CXCL8 and CXCL1 in the free, GAG heparin-bound, and CXCR2 receptor N-terminal domain-bound states using solution NMR spectroscopy. (utmb.edu)
Supplements1
  • Both supplements provide bioavailable histidine, but individuals with sensitive stomachs may prefer l-histidine HCl. (purebulk.com)
Acid2
  • The imidazole group on the side chain of histidine can act as both an acid and a base, i.e., it can both donate and accept protons under some conditions. (infoplease.com)
  • Histidine is also a precursor to urocanic acid-a natural sunscreen produced in the body. (purebulk.com)
Scientific2
  • Scientific studies haven't reported any side effects from taking typical histidine doses. (purebulk.com)
  • If we go through the different scientific publications referring to the histidine requirements in broiler chickens, we find numerous articles with variable results (Table 1) and from the oldest to the most recent studies, this ratio has slightly increased. (quimidroga.com)