An essential amino acid that is required for the production of HISTAMINE.
An enzyme that catalyzes the decarboxylation of histidine to histamine and carbon dioxide. It requires pyridoxal phosphate in animal tissues, but not in microorganisms. EC 4.1.1.22.
Preservative for wines, soft drinks, and fruit juices and a gentle esterifying agent.
An enzyme that catalyzes the first step of histidine catabolism, forming UROCANIC ACID and AMMONIA from HISTIDINE. Deficiency of this enzyme is associated with elevated levels of serum histidine and is called histidinemia (AMINO ACID METABOLISM, INBORN ERRORS).
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
The parts of a macromolecule that directly participate in its specific combination with another molecule.
Genetically engineered MUTAGENESIS at a specific site in the DNA molecule that introduces a base substitution, or an insertion or deletion.
An enzyme that catalyzes the first step of the pathway for histidine biosynthesis in Salmonella typhimurium. ATP reacts reversibly with 5-phosphoribosyl-1-pyrophosphate to yield N-1-(5'-phosphoribosyl)-ATP and pyrophosphate. EC 2.4.2.17.
The penultimate step in the pathway of histidine biosynthesis. Oxidation of the alcohol group on the side chain gives the acid group forming histidine. Histidinol has also been used as an inhibitor of protein synthesis.
An enzyme that catalyzes the conversion of 4,5-dihydro-4-oxo-5-imidazolepropanoate to urocanate and water. EC 4.2.1.49.
A family of enzymes that catalyze the conversion of ATP and a protein to ADP and a phosphoprotein.
Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.
Proteins found in any species of bacterium.
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
The rate dynamics in chemical or physical systems.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
A group of enzymes that catalyze the hydrolysis of diphosphate bonds in compounds such as nucleoside di- and tri-phosphates, and sulfonyl-containing anhydrides such as adenylylsulfate. (Enzyme Nomenclature, 1992) EC 3.6.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
A metallic element of atomic number 30 and atomic weight 65.38. It is a necessary trace element in the diet, forming an essential part of many enzymes, and playing an important role in protein synthesis and in cell division. Zinc deficiency is associated with ANEMIA, short stature, HYPOGONADISM, impaired WOUND HEALING, and geophagia. It is known by the symbol Zn.
A 27-amino acid peptide with histidine at the N-terminal and isoleucine amide at the C-terminal. The exact amino acid composition of the peptide is species dependent. The peptide is secreted in the intestine, but is found in the nervous system, many organs, and in the majority of peripheral tissues. It has a wide range of biological actions, affecting the cardiovascular, gastrointestinal, respiratory, and central nervous systems.
Measurement of this acid in the urine after oral administration of histidine provides the basis for the diagnostic test of folic acid deficiency and of megaloblastic anemia of pregnancy.
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
An amine derived by enzymatic decarboxylation of HISTIDINE. It is a powerful stimulant of gastric secretion, a constrictor of bronchial smooth muscle, a vasodilator, and also a centrally acting neurotransmitter.
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
The color-furnishing portion of hemoglobin. It is found free in tissues and as the prosthetic group in many hemeproteins.
A naturally occurring dipeptide neuropeptide found in muscles.
Histidine substituted in any position with one or more methyl groups.
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Proteins prepared by recombinant DNA technology.
Derivatives of formic acids. Included under this heading are a broad variety of acid forms, salts, esters, and amides that are formed with a single carbon carboxy group.
The relationship between the chemical structure of a compound and its biological or pharmacological activity. Compounds are often classed together because they have structural characteristics in common including shape, size, stereochemical arrangement, and distribution of functional groups.
A transfer RNA which is specific for carrying histidine to sites on the ribosomes in preparation for protein synthesis.
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
A colorless inorganic compound (HONH2) used in organic synthesis and as a reducing agent, due to its ability to donate nitric oxide.
Large marine mammals of the order CETACEA. In the past, they were commercially valued for whale oil, for their flesh as human food and in ANIMAL FEED and FERTILIZERS, and for baleen. Today, there is a moratorium on most commercial whaling, as all species are either listed as endangered or threatened.
The naturally occurring or experimentally induced replacement of one or more AMINO ACIDS in a protein with another. If a functionally equivalent amino acid is substituted, the protein may retain wild-type activity. Substitution may also diminish, enhance, or eliminate protein function. Experimentally induced substitution is often used to study enzyme activities and binding site properties.
In bacteria, a group of metabolically related genes, with a common promoter, whose transcription into a single polycistronic MESSENGER RNA is under the control of an OPERATOR REGION.
Stable elementary particles having the smallest known positive charge, found in the nuclei of all elements. The proton mass is less than that of a neutron. A proton is the nucleus of the light hydrogen atom, i.e., the hydrogen ion.
A heavy metal trace element with the atomic symbol Cu, atomic number 29, and atomic weight 63.55.
A conjugated protein which is the oxygen-transporting pigment of muscle. It is made up of one globin polypeptide chain and one heme group.
A thiol-containing non-essential amino acid that is oxidized to form CYSTINE.
Proteins that contain an iron-porphyrin, or heme, prosthetic group resembling that of hemoglobin. (From Lehninger, Principles of Biochemistry, 1982, p480)
A serotype of Salmonella enterica that is a frequent agent of Salmonella gastroenteritis in humans. It also causes PARATYPHOID FEVER.
Any of the processes by which cytoplasmic or intercellular factors influence the differential control of gene action in bacteria.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
One of the non-essential amino acids commonly occurring in the L-form. It is found in animals and plants, especially in sugar cane and sugar beets. It may be a neurotransmitter.
A bright bluish pink compound that has been used as a dye, biological stain, and diagnostic aid.
An enzyme that activates histidine with its specific transfer RNA. EC 6.1.1.21.
Enzymes that catalyze the addition of a carboxyl group to a compound (carboxylases) or the removal of a carboxyl group from a compound (decarboxylases). EC 4.1.1.
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
A chemical reaction in which an electron is transferred from one molecule to another. The electron-donating molecule is the reducing agent or reductant; the electron-accepting molecule is the oxidizing agent or oxidant. Reducing and oxidizing agents function as conjugate reductant-oxidant pairs or redox pairs (Lehninger, Principles of Biochemistry, 1982, p471).
The level of protein structure in which regular hydrogen-bond interactions within contiguous stretches of polypeptide chain give rise to alpha helices, beta strands (which align to form beta sheets) or other types of coils. This is the first folding level of protein conformation.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Enzymes that catalyze the formation of a carbon-carbon double bond by the elimination of AMMONIA. EC 4.3.1.
A technique applicable to the wide variety of substances which exhibit paramagnetism because of the magnetic moments of unpaired electrons. The spectra are useful for detection and identification, for determination of electron structure, for study of interactions between molecules, and for measurement of nuclear spins and moments. (From McGraw-Hill Encyclopedia of Science and Technology, 7th edition) Electron nuclear double resonance (ENDOR) spectroscopy is a variant of the technique which can give enhanced resolution. Electron spin resonance analysis can now be used in vivo, including imaging applications such as MAGNETIC RESONANCE IMAGING.
Organic compounds that contain the (-NH2OH) radical.
Analysis of the intensity of Raman scattering of monochromatic light as a function of frequency of the scattered light.
An enzyme that catalyzes the hydrolysis of histidinol-phosphate to histidinol. One of the regulatory enzymes in histidine biosynthesis. EC 3.1.3.15.
A non-essential amino acid that occurs in high levels in its free state in plasma. It is produced from pyruvate by transamination. It is involved in sugar and acid metabolism, increases IMMUNITY, and provides energy for muscle tissue, BRAIN, and the CENTRAL NERVOUS SYSTEM.
A sequence of amino acids in a polypeptide or of nucleotides in DNA or RNA that is similar across multiple species. A known set of conserved sequences is represented by a CONSENSUS SEQUENCE. AMINO ACID MOTIFS are often composed of conserved sequences.
A low-energy attractive force between hydrogen and another element. It plays a major role in determining the properties of water, proteins, and other compounds.
The art or process of comparing photometrically the relative intensities of the light in different parts of the spectrum.
A molecule that binds to another molecule, used especially to refer to a small molecule that binds specifically to a larger molecule, e.g., an antigen binding to an antibody, a hormone or neurotransmitter binding to a receptor, or a substrate or allosteric effector binding to an enzyme. Ligands are also molecules that donate or accept a pair of electrons to form a coordinate covalent bond with the central metal atom of a coordination complex. (From Dorland, 27th ed)
An essential amino acid that is physiologically active in the L-form.
A trace element with the atomic symbol Ni, atomic number 28, and atomic weight 58.69. It is a cofactor of the enzyme UREASE.
Proteins obtained from ESCHERICHIA COLI.
A change from planar to elliptic polarization when an initially plane-polarized light wave traverses an optically active medium. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The functional hereditary units of BACTERIA.
Amino acid transporter systems capable of transporting basic amino acids (AMINO ACIDS, BASIC).
An essential amino acid. It is often added to animal feed.
An essential amino acid that is necessary for normal growth in infants and for NITROGEN balance in adults. It is a precursor of INDOLE ALKALOIDS in plants. It is a precursor of SEROTONIN (hence its use as an antidepressant and sleep aid). It can be a precursor to NIACIN, albeit inefficiently, in mammals.
Determination of the spectra of ultraviolet absorption by specific molecules in gases or liquids, for example Cl2, SO2, NO2, CS2, ozone, mercury vapor, and various unsaturated compounds. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Theoretical representations that simulate the behavior or activity of chemical processes or phenomena; includes the use of mathematical equations, computers, and other electronic equipment.
Amino acids that are not synthesized by the human body in amounts sufficient to carry out physiological functions. They are obtained from dietary foodstuffs.
An enzyme that is found in mitochondria and in the soluble cytoplasm of cells. It catalyzes reversible reactions of a nucleoside triphosphate, e.g., ATP, with a nucleoside diphosphate, e.g., UDP, to form ADP and UTP. Many nucleoside diphosphates can act as acceptor, while many ribo- and deoxyribonucleoside triphosphates can act as donor. EC 2.7.4.6.
A urine test for formiminoglutamic acid, an intermediate metabolite in L-histidine catabolism in the conversion of L-histidine to L-glutamic acid. It may be an indicator of vitamin B12 or folic acid deficiency or liver disease.
The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.
A species of gram-negative, aerobic bacteria that consist of slender vibroid cells.
A group of hydrolases which catalyze the hydrolysis of monophosphoric esters with the production of one mole of orthophosphate. EC 3.1.3.
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Process of generating a genetic MUTATION. It may occur spontaneously or be induced by MUTAGENS.
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
Compounds containing 1,3-diazole, a five membered aromatic ring containing two nitrogen atoms separated by one of the carbons. Chemically reduced ones include IMIDAZOLINES and IMIDAZOLIDINES. Distinguish from 1,2-diazole (PYRAZOLES).
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
A rather large group of enzymes comprising not only those transferring phosphate but also diphosphate, nucleotidyl residues, and others. These have also been subdivided according to the acceptor group. (From Enzyme Nomenclature, 1992) EC 2.7.

Possible role for ligand binding of histidine 81 in the second transmembrane domain of the rat prostaglandin F2alpha receptor. (1/5209)

For the five principal prostanoids PGD2, PGE2, PGF2alpha, prostacyclin and thromboxane A2 eight receptors have been identified that belong to the family of G-protein-coupled receptors. They display an overall homology of merely 30%. However, single amino acids in the transmembrane domains such as an Arg in the seventh transmembrane domain are highly conserved. This Arg has been identified as part of the ligand binding pocket. It interacts with the carboxyl group of the prostanoid. The aim of the current study was to analyze the potential role in ligand binding of His-81 in the second transmembrane domain of the rat PGF2alpha receptor, which is conserved among all PGF2alpha receptors from different species. Molecular modeling suggested that this residue is located in close proximity to the ligand binding pocket Arg 291 in the 7th transmembrane domain. The His81 (H) was exchanged by site-directed mutagenesis to Gln (Q), Asp (D), Arg (R), Ala (A) and Gly (G). The receptor molecules were N-terminally extended by a Flag epitope for immunological detection. All mutant proteins were expressed at levels between 50% and 80% of the wild type construct. The H81Q and H81D receptor bound PGF2alpha with 2-fold and 25-fold lower affinity, respectively, than the wild type receptor. Membranes of cells expressing the H81R, H81A or H81G mutants did not bind significant amounts of PGF2alpha. Wild type receptor and H81Q showed a shallow pH optimum for PGF2alpha binding around pH 5.5 with almost no reduction of binding at higher pH. In contrast the H81D mutant bound PGF2alpha with a sharp optimum at pH 4.5, a pH at which the Asp side chain is partially undissociated and may serve as a hydrogen bond donor as do His and Gln at higher pH values. The data indicate that the His-81 in the second transmembrane domain of the PGF2alpha receptor in concert with Arg-291 in the seventh transmembrane domain may be involved in ligand binding, most likely not by ionic interaction with the prostaglandin's carboxyl group but rather as a hydrogen bond donor.  (+info)

R73A and H144Q mutants of the yeast mitochondrial cyclophilin Cpr3 exhibit a low prolyl isomerase activity in both peptide and protein-folding assays. (2/5209)

Previously we reported that the R73A and H144Q variants of the yeast cyclophilin Cpr3 were virtually inactive in a protease-coupled peptide assay, but retained activity as catalysts of a proline-limited protein folding reaction [Scholz, C. et al. (1997) FEBS Lett. 414, 69-73]. A reinvestigation revealed that in fact these two mutations strongly decrease the prolyl isomerase activity of Cpr3 in both the peptide and the protein-folding assay. The high folding activities found previously originated from a contamination of the recombinant Cpr3 proteins with the Escherichia coli protein SlyD, a prolyl isomerase that co-purifies with His-tagged proteins. SlyD is inactive in the peptide assay, but highly active in the protein-folding assay.  (+info)

A possible involvement of aberrant expression of the FHIT gene in the carcinogenesis of squamous cell carcinoma of the uterine cervix. (3/5209)

To investigate involvement of an aberrant expression of the FHIT (fragile histidine triad) gene in the process of carcinogenesis and progression in cervical carcinoma, we examined its expression by the reverse transcriptase polymerase chain reaction (RT-PCR) and cDNA sequence method in 32 cervical invasive carcinomas (25 squamous cell carcinomas and seven adeno- or adenosquamous carcinomas) and 18 of its precursor lesions [four low-grade and 14 high-grade cervical intraepithelial neoplasias (CINs)]. We also examined a link between the occurrence of the aberrant expression and human papillomavirus (HPV). We detected the aberrant FHIT transcripts in 11 of 25 (44%) cervical invasive squamous cell carcinomas and in 5 of 14 (36%) high-grade CINs (CIN 2 or 3), whereas they were not found in seven non-squamous type and four low-grade CINs (CIN 1). The alteration patterns of the FHIT gene expression in high-grade CINs were virtually similar to those found in invasive carcinomas, such that the exons 5-7 were consistently deleted associated or unassociated with loss of the exon 4 and/or 8. The incidence of the aberrant expression was not related to the presence of HPV and its type. These data indicate that the aberrant expression of the FHIT gene is observed in precursor lesions of cervical carcinoma as well as invasive carcinomas, with its incidence not increasing with advance of clinical stage. Given the squamous cell type dominant expression, the aberrant expression may play a critical role in the generation of squamous cell carcinoma of the uterine cervix, but not the consequence of the progression of the cancer.  (+info)

Breaking the low barrier hydrogen bond in a serine protease. (4/5209)

The serine protease subtilisin BPN' is a useful catalyst for peptide synthesis when dissolved in high concentrations of a water-miscible organic co-solvent such as N,N-dimethylformamide (DMF). However, in 50% DMF, the k(cat) for amide hydrolysis is two orders of magnitude lower than in aqueous solution. Surprisingly, the k(cat) for ester hydrolysis is unchanged in 50% DMF. To explain this alteration in activity, the structure of subtilisin 8397+1 was determined in 20, 35, and 50% (v/v) DMF to 1.8 A resolution. In 50% DMF, the imidazole ring of His64, the central residue of the catalytic triad, has rotated approximately 180 degrees around the Cbeta-Cgamma bond. Two new water molecules in the active site stabilize the rotated conformation. This rotation places His64 in an unfavorable geometry to interact with the other members of the catalytic triad, Ser221 and Asp32. NMR experiments confirm that the characteristic resonance due to the low barrier hydrogen bond between the His64 and Asp32 is absent in 50% DMF. These experiments provide a clear structural basis for the change in activity of serine proteases in organic co-solvents.  (+info)

His ... Asp catalytic dyad of ribonuclease A: histidine pKa values in the wild-type, D121N, and D121A enzymes. (5/5209)

Bovine pancreatic ribonuclease A (RNase A) has a conserved His ... Asp catalytic dyad in its active site. Structural analyses had indicated that Asp121 forms a hydrogen bond with His119, which serves as an acid during catalysis of RNA cleavage. The enzyme contains three other histidine residues including His12, which is also in the active site. Here, 1H-NMR spectra of wild-type RNase A and the D121N and D121A variants were analyzed thoroughly as a function of pH. The effect of replacing Asp121 on the microscopic pKa values of the histidine residues is modest: none change by more than 0.2 units. There is no evidence for the formation of a low-barrier hydrogen bond between His119 and either an aspartate or an asparagine residue at position 121. In the presence of the reaction product, uridine 3'-phosphate (3'-UMP), protonation of one active-site histidine residue favors protonation of the other. This finding is consistent with the phosphoryl group of 3'-UMP interacting more strongly with the two active-site histidine residues when both are protonated. Comparison of the titration curves of the unliganded enzyme with that obtained in the presence of different concentrations of 3'-UMP shows that a second molecule of 3'-UMP can bind to the enzyme. Together, the data indicate that the aspartate residue in the His ... Asp catalytic dyad of RNase A has a measurable but modest effect on the ionization of the adjacent histidine residue.  (+info)

Mutational analysis of Bacillus subtilis glutamine phosphoribosylpyrophosphate amidotransferase propeptide processing. (6/5209)

Glutamine phosphoribosylpyrophosphate amidotransferase from Bacillus subtilis is a member of an N-terminal nucleophile hydrolase enzyme superfamily, several of which undergo autocatalytic propeptide processing to generate the mature active enzyme. A series of mutations was analyzed to determine whether amino acid residues required for catalysis are also used for propeptide processing. Propeptide cleavage was strongly inhibited by replacement of the cysteine nucleophile and two residues of an oxyanion hole that are required for glutaminase function. However, significant propeptide processing was retained in a deletion mutant with multiple defects in catalysis that was devoid of enzyme activity. Intermolecular processing of noncleaved mutant enzyme subunits by active wild-type enzyme subunits was not detected in hetero-oligomers obtained from a coexpression experiment. While direct in vitro evidence for autocatalytic propeptide cleavage was not obtained, the results indicate that some but not all of the amino acid residues that have a role in catalysis are also needed for propeptide processing.  (+info)

Metal-catalyzed oxidation of phenylalanine-sensitive 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from Escherichia coli: inactivation and destabilization by oxidation of active-site cysteines. (7/5209)

The in vitro instability of the phenylalanine-sensitive 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase [DAHPS(Phe)] from Escherichia coli has been found to be due to a metal-catalyzed oxidation mechanism. DAHPS(Phe) is one of three differentially feedback-regulated isoforms of the enzyme which catalyzes the first step of aromatic biosynthesis, the formation of DAHP from phosphoenolpyruvate and D-erythrose-4-phosphate. The activity of the apoenzyme decayed exponentially, with a half-life of about 1 day at room temperature, and the heterotetramer slowly dissociated to the monomeric state. The enzyme was stabilized by the presence of phosphoenolpyruvate or EDTA, indicating that in the absence of substrate, a trace metal(s) was the inactivating agent. Cu2+ and Fe2+, but none of the other divalent metals that activate the enzyme, greatly accelerated the rate of inactivation and subunit dissociation. Both anaerobiosis and the addition of catalase significantly reduced Cu2+-catalyzed inactivation. In the spontaneously inactivated enzyme, there was a net loss of two of the seven thiols per subunit; this value increased with increasing concentrations of added Cu2+. Dithiothreitol completely restored the enzymatic activity and the two lost thiols in the spontaneously inactivated enzyme but was only partially effective in reactivation of the Cu2+-inactivated enzyme. Mutant enzymes with conservative replacements at either of the two active-site cysteines, Cys61 or Cys328, were insensitive to the metal attack. Peptide mapping of the Cu2+-inactivated enzyme revealed a disulfide linkage between these two cysteine residues. All results indicate that DAHPS(Phe) is a metal-catalyzed oxidation system wherein bound substrate protects active-site residues from oxidative attack catalyzed by bound redox metal cofactor. A mechanism of inactivation of DAHPS is proposed that features a metal redox cycle that requires the sequential oxidation of its two active-site cysteines.  (+info)

Evidence for the head domain movement of the rieske iron-sulfur protein in electron transfer reaction of the cytochrome bc1 complex. (8/5209)

The three-dimensional structure of the mitochondrial cytochrome bc1 complex suggests that movement of the extramembrane domain (head) of the Rieske iron-sulfur protein (ISP) may play an important role in electron transfer. Such movement requires flexibility in the neck region of ISP, since the head and transmembrane domains of the protein are rather rigid. To test this hypothesis, Rhodobacter sphaeroides mutants expressing His-tagged cytochrome bc1 complexes with cysteine substitution at various positions in the ISP neck (residues 39-48) were generated and characterized. The mutants with a single cysteine substitution at Ala42 or Val44 and a double cysteine substitution at Val44 and Ala46 (VQA-CQC) or at Ala42 and Ala46 (ADVQA-CDVQC) have photosynthetic growth rates comparable with that of complement cells. Chromatophore membrane and intracytoplasmic membrane (ICM) prepared from these mutants have cytochrome bc1 complex activity similar to that in the complement membranes, indicating that flexibility of the neck region of ISP was not affected by these cysteine substitutions. Mutants with a double cysteine substitution at Ala42 and Val44 (ADV-CDC) or at Pro40 and Ala42 (PSA-CSC) have a retarded (50%) or no photosynthetic growth rate, respectively. The ADV-CDC or PSA-CSC mutant ICM contains 20 or 0% of the cytochrome bc1 complex activity found in the complement ICM. However, activity can be restored by the treatment with beta-mercaptoethanol (beta-ME). The restored activity is diminished upon removal of beta-ME but is retained if the beta-ME-treated membrane is treated with the sulfhydryl reagent N-ethylmaleimide or p-chloromercuribenzoic acid. These results indicate that the loss of bc1 complex activity in the ADV-CDC or PSA-CSC mutant membranes is due to disulfide bond formation, which increases the rigidity of ISP neck and, in turn, decreases the mobility of the head domain. Using the conditions developed for the isolation of His-tagged complement cytochrome bc1 complex, a two-subunit complex (cytochromes b and c1) is obtained from all of the double cysteine-substituted mutants. This suggests that introduction of two cysteines in the neck region of ISP weakens the interactions between cytochromes b, ISP, and subunit IV.  (+info)

Lactobacillus buchneri ST2A vigorously decarboxylates histidine to the biogenic amine histamine, which is excreted into the medium. Cells grown in the presence of histidine generate both a transmembrane pH gradient, inside alkaline, and an electrical potential (delta psi), inside negative, upon addition of histidine. Studies of the mechanism of histidine uptake and histamine excretion in membrane vesicles and proteoliposomes devoid of cytosolic histidine decarboxylase activity demonstrate that histidine uptake, histamine efflux, and histidine/histamine exchange are electrogenic processes. Histidine/histamine exchange is much faster than the unidirectional fluxes of these substrates, is inhibited by an inside-negative delta psi and is stimulated by an inside positive delta psi. These data suggest that the generation of metabolic energy from histidine decarboxylation results from an electrogenic histidine/histamine exchange and indirect proton extrusion due to the combined action of the ...
Evaluation of effects of copper histidine on copper transporter 1-mediated accumulation of platinum and oxaliplatin-induced neurotoxicity in vitro and in vivo
Staphylococcus aureus alpha-toxin is a membrane-damaging exoprotein that oligomerizes to form transmembrane pores. Chemical modification of histidines with diethylpyrocarbonate has been shown to reduce the hemolytic activity of alpha-toxin, suggesting that one or more of the histidine residues is important for toxin function. To individually assess the functional importance of each of the four histidine residues (residues 35, 48, 144, and 259), we used oligonucleotide-directed mutagenesis of the cloned alpha-toxin gene to replace each histidine with leucine. The mutant toxins were expressed in S. aureus and evaluated for hemolytic activity in vitro and for lethality in an intraperitoneal murine model. Substitution of histidine 35 with leucine produced a mutant toxin (H35L) without hemolytic or lethal activity. Mutant toxins H48L, H144L, and H259L exhibited 7, 16, and 46%, respectively, of the hemolytic activity of wild-type toxin. Immunoblotting of purified H35L toxin incubated with liposomal ...
Histidine-containing phosphotransfer (HPt) factors from Arabidopsis thaliana, designated as AHPs, function most likely in concert with histidine (His)-kinases (HKs) and response regulators (RRs) in certain multistep histidine (His)→aspartate (Asp) phosphorelays that are involved in the signal transduction mechanisms, by which plant cells appear to respond to certain hormonal stimuli, including cytokinin. Although some previous in vitro results from studies on Arabidopsis AHPs (AHP1 to AHP5) supported this hypothesis, it has not yet been proven. To this end, here we constructed transgenic plants that contained the AHP2 protein in a considerably higher amount than in wild-type plants. Such AHP2-overexpressing young seedlings were examined in comparison with wild-type plants, with special reference to hormone responses; particularly, their inhibitory effects on root elongation of plants grown on agar-plates, and also hypocotyl elongation of etiolated seedlings grown in the dark. The results of ...
Histidine-to-aspartate (His-Asp) phosphorelay (or two-component) systems are very common signal transduction mechanisms that are implicated in a wide variety of cellular responses to environmental stimuli. The His-Asp phosphorelay components include sensor histidine kinase (HK), phosphotransfer intermediate (HPt), and response regulator (RR). With special reference to three bacterial species (Mesorhizobium loti, Bradyrhizobium japonicum, Sinorhizobium meliloti), each of which belongs to a different genera of Rhizobia, here we attempted to compile all of the His-Asp phosphorelay components in order to reveal a comparative genome-wide overview as to the His-Asp phosphorelay. It was revealed that M. loti has 47 HKs, 1 HPts, and 58 RRs; B. japonicum has 80 HKs, 3 HPts, and 91 RRs; whereas S. meliloti has 40 HKs, 1 HPt, and 58 RRs. These His-Asp phosphorelay components were extensively compiled and characterized. The resulting overview as to the His-Asp phosphorelay of Rhizobia will provide us ...
Signaling by kinases and phosphatases that act on serine, threonine, and tyrosine residues of proteins is among the most extensively studied regulatory mechanisms in mammalian cells, and research focused in this area is ongoing. We are just beginning to appreciate that such signaling mechanisms are extended and enriched by the reversible phosphorylation of histidine residues. The most exciting developments in this field to date come from studies on the β subunit of heterotrimeric guanosine triphosphate-binding proteins (G proteins), the enzyme adenosine 5′-triphosphate-citrate lyase, and now the Ca2+-activated K+ channel KCa3.1, all of which are targeted by nucleoside diphosphate kinase (which phosphorylates histidines) and protein histidine phosphatase (which dephosphorylates phosphorylated histidines).. ...
TY - JOUR. T1 - Administration and 1H MRS, detection of histidine in human brain. T2 - Application to in vivo pH measurement. AU - Vermathen, Peter. AU - Capizzano, Aristides A.. AU - Maudsley, Andrew A.. PY - 2000/5/17. Y1 - 2000/5/17. N2 - Measurement of histidine in vivo offers the potential for tissue pH measurement using routinely performed 1H MR spectroscopy. In the brain, however, histidine concentrations are generally too low for reliable measurement. By using oral loading of histidine, this study demonstrates that brain concentrations can be significantly increased, enabling detection of histidine by localized 1H MR measurements and making in vivo pH measurement possible. In studies carried out on healthy human subjects at 1.5 T, a consistent spectral quality downfield from water was achieved using a PRESS sequence at short echo times. Measurements at different TE values helped to characterize the downfield spectral region. Histidine loading of 400 mg/kg of body weight increased brain ...
On 24 Mar 1997, Kathleen Blackwell wrote: , Given a complex nitrogen source with various peptides in solution, would , digesting to various levels of free amino acids lead to a solutions with better , metal chelating properties as the levels of free amino acids rises? My thinking , is that higher levels of free histidine would chelate metals better than , histidine bound in peptides, mostly for steric reasons. Any thought? TIA It might work for most of the cases, but the same steric reasons might enable multiple histidine peptides to bind better. In one of Frances Arnolds papers they are able to show that the His-X-X-X-His arrangement binds the strongest to metal. In short, I think that the answer to your question has to vary depending on the peptide fragment and one cannot always assume that free histidine binds better. My 2 cents worth Rajesh , , , , ************************************ Rajesh Krishnamurthy E-mail: krishnam at umbc7.umbc.edu Tel: (410) 247-8175 ...
We report here the generation of gas-phase complexes containing Pd(II), a ligand (deprotonated alanine, A-), and/or N-terminus derivatized peptides containing histidine as one of the amino acids. The species were produced by electrospray ionization, and their gas-phase reactions were investigated using ion-trap tandem mass spectrometry. Pd(II) forms a stable diaqua complex in the gas phase of the formula, [Pd(A-) (H(2)O)(2)]+, (where A- = deprotonated alanine) along with ternary complexes containing A- and peptide. The collision-induced dissociation (CID) patterns of the binary and ternary complexes were investigated, and the dissociation patterns for the ternary complexes suggest that: (a) the imidazole ring of the histidine side group may be the intrinsic binding site of the metal ion, and (b) the peptides fragment primarily by cleavage of the amide bond to the C-terminal side of the histidine residues. These observations are in accord with previous solution-state studies in which Pd(II) was ...
Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.
Shop Histidine transport ATP-binding protein ELISA Kit, Recombinant Protein and Histidine transport ATP-binding protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
A group of 28 uraemic patients on dialysis treatment were given daily supplements of histidine by mouth. Plasma amino-acid concentration, plasma iron, serum transferrin, packed cell volume, and reticulocyte count were all measured before and after two months of histidine supplementation. The treatment raised the plasma histidine concentration and at the same time there was a rise in transferrin and iron levels and packed cell volume. Reticulocyte counts fell after two months of histidine supplementation.. ...
Purpose: Alzheimers Disease is a neurodegenerative disease resulting from over-production and neuronal accumulation of amyloid-beta proteins (Aβ40/Aβ42). The glycine residue at position 33 and histidine residues at positions 13 and 14 are involved with binding and internalization of these proteins, actions potentially inhibited by substituting or sterically hindering these residues with an antibody specific to positions 2-11 (IgG-4.1). Rat pheochromocytoma (PC12) cells differentiated with nerve growth factor were used as a neuronal model to determine whether substitution and/or antibody block amyloid-betas neuronal interactions. Methods: PC12 cells were incubated with fluorescein-labeled-amyloid-beta-40 (F-Aβ40) or substituted F-Aβ40 derivatives (F-Aβ40-H13,14G, F-Aβ40-H13,14G;G33A), with or without IgG-4.1. Cells were analyzed by flow cytometry. Results: PC12 cells incubated with F-Aβ40 and IgG-4.1, as well as cells incubated with substituted peptides, exhibit decreased mean fluorescence
Pseudobiospecific ligand l-histidine is an inexpensive, highly stable, non-toxic ligand explored successfully over the last twenty years for the purification of immunoglobulins in immobilised histidine ligand affinity chromatography. It is of great interest to know the molecular recognition sites of IgG to immobilized l-histidine. Here, we have used an in silico approach to explore the molecular recognition of l-histidine by IgG. We have assessed the feasible binding modes of histidine and its moieties at different sites of IgG and considered only those binding conformations which are exhibited via the imidazole ring NH group or any other OH donating group apart from the ones which are terminally conjugated with the support matrix. We categorised binding site into two categories; category I: inner binding groove and category II: surface binding groove and observed that the hinge region of IgG has most favourable binding pocket for l-histidine and histidyl moieties. Ser and Tyr residues on the hinge
Sigma-Aldrich offers abstracts and full-text articles by [Vennela Mullangi, Xiang Zhou, David W Ball, David J Anderson, Masaru Miyagi].
Two-component systems consisting of histidine kinases and their corresponding receivers are widespread in bacterial signal transduction. In the past few years, genes coding for homologues of two-component systems were also discovered in eukaryotic organisms. DokA, a homologue of bacterial histidine kinases, is an element of the osmoregulatory pathway in the amoeba Dictyostelium. The work described here addresses the question whether DokA is phosphorylated in vivo in response to osmotic stress. We have endogenously overexpressed individual domains of DokA to investigate post-translational modification of the protein in response to osmotic shock in vivo. Dictyostelium cells were labeled with [32P]-orthophosphate, exposed to osmotic stress and DokA fragments were subsequently isolated by immunoprecipitation. Thus, a stress-dependent phosphorylation could be demonstrated, with the site of phosphorylation being located in the kinase domain. We demonstrate biochemically that the phosphorylated amino acid is
Kosher Histidine - Buy discounted Kosher Histidine and other Kosher Amino Acids at MaxVite.com. In our Kosher Amino Acids section you will find . Buy discount brand name Kosher Histidine vitamins, supplements, pills, capsules, softgels and tablets. Find natural, herbal, organic and healthy Kosher Histidine products.
The voltage-sensitive phosphoinositide phosphatases provide a mechanism to couple changes in the transmembrane electrical potential to intracellular signal transduction pathways. These proteins share a domain architecture that is conserved in deuterostomes. However, gene duplication events in primates, including humans, give rise to the paralogs TPTE and TPTE2 that retain protein domain organization but, in the case of TPTE, have lost catalytic activity. Here, we present evidence that these human proteins contain a functional voltage sensor, similar to that in nonmammalian orthologs. However, domains of these human proteins can also generate a noninactivating outward current that is not observed in zebra fish or tunicate orthologs. This outward current has the anticipated characteristics of a voltage-sensitive proton current and is due to the appearance of a single histidine residue in the S4 transmembrane segment of the voltage sensor. Histidine is observed at this position only during the ...
A strategy for rational enzyme design is reported and illustrated by the engineering of a protein catalyst for thiol-ester hydrolysis. Five mutants of human glutathione (GSH; gamma-Glu-Cys-Gly) transferase A1-1 were designed in the search for a catalyst and to provide a set of proteins from which the reaction mechanism could be elucidated. The single mutant A216H catalyzed the hydrolysis of the S-benzoyl ester of GSH under turnover conditions with a k(cat)/K(M) of 156 M(-1) x min(-1), and a catalytic proficiency of ,10(7) M(-1) when compared with the first-order rate constant of the uncatalyzed reaction. The wild-type enzyme did not hydrolyze the substrate, and thus, the introduction of a single histidine residue transformed the wild-type enzyme into a turnover system for thiol-ester hydrolysis. By kinetic analysis of single, double, and triple mutants, as well as from studies of reaction products, it was established that the enzyme A216H catalyzes the hydrolysis of the thiol-ester substrate by ...
View Notes - Bio 15 from BIOL 101 at UPenn. 1) Histidine, Glycine, Histidine, Leucine, Tyrosine 2) Transcription starts at binding sites called promoters on the DNA template strand, as opposed to the
Gentaur molecular products has all kinds of products like :search , Prospecbio \ Mouse Anti Polyhistidine Tag His tag \ ant-227 for more molecular products just contact us
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Our journals promote pharmacology in all its forms by disseminating the latest high quality research in our peer reviewed scientific journals.
TY - JOUR. T1 - Hydrolysis catalyzed with a resin containing histidine groups. AU - Hung, Wei Hsiu. AU - Hu, Cho Chun. AU - Liu, Chuen Ying. PY - 1996/1/1. Y1 - 1996/1/1. N2 - A histidine-containing polymer was synthesized in which the amino group of the histidine was attached chemically via an azide coupling method to the carboxylic acid of Amberlite IRC-50. The resultant polymer was applied as a catalyst for hydrolysis of p-nitrophenyl acetate (PNPA). PNPA in aqueous solution was hydrolyzed at 25°C with a phosphate buffer (pH 7.8). The observed kinetics obeyed Michaelis-Menten kinetics. The reaction rates at various temperature were measured. The activation parameters, preexponential factor (A) and activation energy (Ea), were 6.64 × 10-4 min-1 and 37.5 kJ mol-1 respectively. At a pH of the medium greater than 7.8, the reaction rate remained almost constant (kobs = 0.024 min-1) and seemed to be controlled by the rate of diffusion of PNPA from the bulk solution into the catalytically active ...
Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The family includes urease alpha, adenosine deaminase, phosphotriesterase dihydroorotases, allantoinases, hydantoinases, AMP-, adenine and cytosine deaminases, imidazolonepropionase, aryldialkylphosphatase, chlorohydrolases, formylmethanofuran dehydrogenases and others. ...
5.B.1 The gp91phox Phagocyte NADPH Oxidase-associated Cytochrome b558 (Phox) Family The human phagocyte cytochrome b558 is a heterodimeric complex consisting of a heavy (β) chain (gp91phox) and a light (α) chain (p22phox) as well as several auxiliary subunits (Geisz and Leto, 2004). The β-chain is a glycoprotein of 570 amino acyl residues called gp91phox, the product of the X-linked chronic granulomatous disease gene. The protein bears (1) the heme-binding site in its N-terminal 280 residues, and (2) an FAD binding site (residues 338-344) as part of the C-terminal NADPH oxidase domain. The N-terminal domain has 6 putative transmembrane spanners (TMSs) and is the cytochrome binding site. It has been reported to catalyze efflux of protons through an H+ channel that acts as a charge compensation pathway for the electrogenic generation of the superoxide radical, O2&149;-. The proposal that (gp91phox) has H+ channel activity has been effectively disputed and is now in doubt (DeCoursey 2003; ...
Complete information for DPH3P1 gene (Protein Coding), Diphthamide Biosynthesis 3 Pseudogene 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Shop Histidine kinase ELISA Kit, Recombinant Protein and Histidine kinase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Histidine list and information including what is Histidine, health benefits and usage indications. Find articles and product list for other top low-carb products, fat-burners, nutrition bars and shakes.
Histidine list and information including what is Histidine, health benefits and usage indications. Find articles and product list for other top low-carb products, fat-burners, nutrition bars and shakes.
[128 Pages Report] Check for Discount on Global Histidine Sales Market Report 2020 report by QYResearch Group. This report studies sales (consumption) of Histidine in Global market,...
Posted by guillo from IP 68.100.129.210 on March 25, 2013 at 17:22:23:. Though Arginine and Histidine are syntethized inssufitiently in the organism, should we consider them ...
Product Number , 33782677. CAS Number , 351-50-8. EC , 206-513-8. Molecular Formula , C6H9N3O2. Molecular Weight , 155.16. Storage Temp , Harmonized Tariff code , 29332990. Signal Word , ...
L-histidine 71-00-1 MSDS report, L-histidine MSDS safety technical specifications search, L-histidine safety information specifications ect.
Phosphoryl transfer between the PTS components is thought to proceed by nucleophilic attack of the active histidine residue on the phospho-histidine of the target protein ...
Jim ,ash_mountain at yahoo.com, wrote in message news:b83c549.0201240704.3268435c at posting.google.com... , post-translational modifications such as phosphorylation cannot be the , problem here as you are expressing in E. coli!! Proteolysis seems Yes they can. There are several examples of E.coli post-translational modifications :) Theyre not very common, but they DO happen. Examples include: histidine phosphorylation, biotinylation, and mysterious carbohydrate addition to the N-terminus (I have read a paper describing this recently, but I forgot which journal it was in, so one would have to look it up if ones interested). Artem ...
CP001630.PE64 Location/Qualifiers FT CDS_pept 73786..75072 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Amir_0064 FT /product=signal transduction histidine kinase, LytS FT /note=PFAM: histidine kinase internal region; ATP-binding FT region ATPase domain protein; SMART: ATP-binding region FT ATPase domain protein; KEGG: signal transduction histidine FT kinase, LytS; K07704 two-component system, LytT family, FT sensor histidine kinase LytS FT /db_xref=EnsemblGenomes-Gn:Amir_0064 FT /db_xref=EnsemblGenomes-Tr:ACU34038 FT /db_xref=GOA:C6WDP3 FT /db_xref=InterPro:IPR003594 FT /db_xref=InterPro:IPR010559 FT /db_xref=InterPro:IPR036890 FT /db_xref=UniProtKB/TrEMBL:C6WDP3 FT /inference=protein motif:PFAM:PF06580 FT /protein_id=ACU34038.1 FT /translation=MPGARRPHSMDGVRDLLTERAVLGVIATLAVLGLFVMLCRARRVS FT TSVEDAVMDMLHRMSKASADLREGLTAEAADKATPHLREMLRCVAVGITDSTGSVLSWD FT GGAADHYELMRGHIEQAIREVHKEHVEHRKLDCDLSGPCPMHSAVIVPLIVESEVAGTL FT ...
Background Among the 20 natural amino acids histidine is the most active and versatile member that plays the multiple roles in protein interactions, often the key residue in enzyme catalytic...
This sequence change replaces arginine with histidine at codon 306 of the CTC1 protein (p.Arg306His). The arginine residue is weakly conserved and there is a small physicochemical difference between arginine and histidine. This variant is present in population databases (rs567779457, ExAC 0.01%). This variant has not been reported in the literature in individuals with CTC1-related disease. Algorithms developed to predict the effect of missense changes on protein structure and function output the following: SIFT: Tolerated; PolyPhen-2: Benign; Align-GVGD: Class C0. The histidine amino acid residue is found in multiple mammalian species, suggesting that this missense change does not adversely affect protein function. These predictions have not been confirmed by published functional studies and their clinical significance is uncertain. In summary, the available evidence is currently insufficient to determine the role of this variant in disease. Therefore, it has been classified as a Variant ...
This sequence change replaces arginine with histidine at codon 460 of the CTC1 protein (p.Arg460His). The arginine residue is moderately conserved and there is a small physicochemical difference between arginine and histidine. This variant is present in population databases (rs200619397, ExAC 0.09%). This variant has not been reported in the literature in individuals with CTC1-related conditions. Algorithms developed to predict the effect of missense changes on protein structure and function output the following: SIFT: Tolerated; PolyPhen-2: Benign; Align-GVGD: Class C0. The histidine amino acid residue is found in multiple mammalian species, suggesting that this missense change does not adversely affect protein function. These predictions have not been confirmed by published functional studies and their clinical significance is uncertain. In summary, the available evidence is currently insufficient to determine the role of this variant in disease. Therefore, it has been classified as a ...
HIS-Select products from Sigma Life Science have the ability to purify histidine-tagged proteins quickly and with high selectivity. This is due to HIS-Select′s patented, non-charged, hydrophilic nickel chelate linkage. This non-charged linkage greatly diminishes non-specific binding.
You are viewing an interactive 3D depiction of the molecule n-[2-({(1s)-1-carboxy-4-[(diaminomethylene)amino]butyl}amino)ethyl]-l-histidine (C14H25N7O4) from the PQR.
L-Histidine Reviews and other Reviews of Nutritional Supplements and Merchants Plus Related Resources Including a 2017 Buying Guide. Healthy Learning for Healthy Living.
Recombinant Human ICAM1 extracellular domain (Met 1-Glu 480) (NP_000192.2), fused with a polyhistidine tag at the C-terminus, was produced in Human Cell.
Recombinant Human EFNB1 extracellular domain (Met 1-Gly 232) (NP_004420.1), fused with a polyhistidine tag at the C-terminus, was produced in Human Cell.
I? This semi-essential amino acid BENEFITS skin, immune system, blood and cell regeneration. Read about functions and studies about Histidine here?
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
Amino acids at deep discount. Save up to 75%. Pure, USA, l-carnitine, l-taurine, creatine, factory direct at below wholesale cost.
Myoglobin is a globular protein and consists of eight α-helixes in its secondary structure. Myoglobin is a protein composed of a single polypeptide chain build by 153 amino acids. The polypeptide chain is bound to a heme molecule which represents the prosthetic group of myoglobin. The heme is bound to a histidine residue at position 93 (His93 or His-F8) within the N-terminal end of the myoglobin polypeptide. If oxygen is bound to heme, the distal histidine at position 64 (called His64 or His-E7) contributes to the stabilization of the oxygen which binds to iron (Fe2+) within the heme structure. ...
TY - JOUR. T1 - Serine protease acylation proceeds with a subtle re-orientation of the histidine ring at the tetrahedral intermediate. AU - Zhou, Yanzi. AU - Zhang, Yingkai. PY - 2011/2/7. Y1 - 2011/2/7. N2 - The acylation mechanism of a prototypical serine protease trypsin and its complete free energy reaction profile have been determined by Born-Oppenheimer ab initio QM/MM molecular dynamics simulations with umbrella sampling.. AB - The acylation mechanism of a prototypical serine protease trypsin and its complete free energy reaction profile have been determined by Born-Oppenheimer ab initio QM/MM molecular dynamics simulations with umbrella sampling.. UR - http://www.scopus.com/inward/record.url?scp=78751489563&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=78751489563&partnerID=8YFLogxK. U2 - 10.1039/c0cc04112b. DO - 10.1039/c0cc04112b. M3 - Article. C2 - 21116528. AN - SCOPUS:78751489563. VL - 47. SP - 1577. EP - 1579. JO - Chemical Communications. JF - Chemical ...
TY - JOUR. T1 - Identification of novel bacterial histidine biosynthesis inhibitors using docking, ensemble rescoring, and whole-cell assays. AU - Henriksen,Signe Teuber. AU - Liu,J.. AU - Estiu,G.. AU - Oltvai,Z.N.. AU - Wiest,O.. PY - 2010. Y1 - 2010. N2 - The rapid spread on multidrug-resistant strains of Staphylococcus aureus requires not just novel treatment options, but the development of faster methods for the identification of new hits for drug development. The exponentially increasing speed of computational methods makes a more extensive use in the early stages of drug discovery attractive if sufficient accuracy can be achieved. Computational target identification using systems-level methods suggested the histidine biosynthesis pathway as an attractive target against S. aureus. Potential inhibitors for the pathway were identified through docking, followed by ensemble rescoring, that is sufficiently accurate to justify immediate testing of the identified compounds by whole-cell assays, ...
Two absolutely conserved histidines and a third highly conserved histidine are noted in 11 bacterial and plant ADP-glucose pyrophosphorylases. These histidines were individually mutagenized in the E. coli enzyme to glutamine in order to determine their function. Glutamine mutations at residues 143 and 156 produced functional enzymes in cell extracts with slightly lower than wild-type specific catalytic activities and with same heat stability characteristics of the wild-type enzyme. Substitution of residue 83 with glutamine however produced an enzyme having decreased thermal stability. Additional mutageneses at residue 83 with asparagine, arginine, or aspartate gave rise to enzymes having a progressively decreasing trend in thermal stability. These mutants are more susceptible to proteolysis than wild-type enzyme. Kinetic analysis of H83Q and H83N indicates that histidine 83 is not involved in the catalytic mechanism or in substrate binding but possibly in maintenance of the active catalytic structure.
Bovine complex I is an assembly of 46 different proteins. Seven of them are encoded in mitochondrial DNA, and the rest are nuclear gene products that are imported into the organelle. Fourteen of the nuclear encoded subunits have modified N termini. Many of these post-translational modifications have been deduced previously from intact protein masses. These assignments have been verified by mass spectrometric analysis of peptides. Thirteen of them are N-alpha-acetylated, and a 14th, subunit B18, is N-alpha-myristoylated. Subunit B18 forms part of the membrane arm of the complex, and the myristoyl group may attach subunit B18 to the membrane. One subunit, B12, has a particularly complex pattern of post-translational modification that has not been analyzed before. It is a mixture of the N-alpha-acetylated form and the form with a free N terminus. In addition, it has one, two, or three methyl groups attached to histidine residues at positions 4, 6, and 8 in various combinations. The predominant form ...
The Cu2+-nitrilotriacetic acid complex improves loading of ?-helical double histidine site for precise distance measurements by pulsed ESR Publication
Genes for histidyl-aspartyl (His-Asp) phosphorelay components (His-containing phosphotransfer proteins, HP, and response regulators, RR) were isolated from Zea mays L. to characterize their function in cytokinin signaling. Six type-A RRs (ZmRR1, ZmRR2, ZmRR4-ZmRR7), 3 type-B RRs (ZmRR8-ZmRR10), and …
Get information, facts, and pictures about histidine at Encyclopedia.com. Make research projects and school reports about histidine easy with credible articles from our FREE, online encyclopedia and dictionary.
Histidine is one of the 20 most common natural amino acids, coded for in DNA. Nutritionally, in humans, histidine is considered an essential amino acid, but only in children. The nitrogen side chains of histidine and the relatively neutral pK (ca 6.0) of the histine proton mean that this amino acid side chain finds its way into considerable use as a coordinating ligand in metalloproteins, and also as a catalytic site in certain enzymes.. The amino acid is a precursor for histamine biosynthesis.. ...
The study report titled Global Histidine Market offers an in-depth analysis of this market across the globe. The study, aimed at providing current and prospect players in this market sharp insights to gain the advantage over their competitors. The report does so by providing an executive summary including all valuable market figures and exploring the favorable factors that are expected to drive the growth rate of the market, besides taking account of the restraining factors.. Questions that the report answers with regards to the competitive hierarchy of the Histidine market:. =,As per the Histidine report, which are the firms that fall under the competitive landscape of the industry in question.. =,Which among these contenders - Kyowa Hakko Bio, Ajinomoto, KingYork Group, Huaheng Biologgical, Shine Star Biological Engineering is most likely to evolve as the most profitable investment hub of this market.. =,How much market share does each of these companies accrue in the industry.. =,What are the ...
TY - JOUR. T1 - Hydrolysis catalyzed with a resin containing histidine groups. AU - Hung, Wei Hsiu. AU - Hu, Cho Chun. AU - Liu, Chuen Ying. N1 - Funding Information: We thank the National Science Council of the Republic of China for financial support. Copyright: Copyright 2017 Elsevier B.V., All rights reserved.. PY - 1996/10/10. Y1 - 1996/10/10. N2 - A histidine-containing polymer was synthesized in which the amino group of the histidine was attached chemically via an azide coupling method to the carboxylic acid of Amberlite IRC-50. The resultant polymer was applied as a catalyst for hydrolysis of p-nitrophenyl acetate (PNPA). PNPA in aqueous solution was hydrolyzed at 25°C with a phosphate buffer (pH 7.8). The observed kinetics obey those of Michaelis-Menten. The reaction rates at various temperatures were measured. The activation parameters, pre- exponential factor (A) and activation energy (E(a)), were 6.64 x 10-4 min- 1 and 37.5 kJ mol-1 respectively. At a pH of the medium greater than ...
Despite its importance in central metabolism and bacterial cell signaling, protein histidine phosphorylation has remained elusive with respect to its extent and functional roles in biological systems due to the lack of adequate research tools. to nitrogen availability and that -ketoglutarate (-KG) inhibits phosphotransfer from phosphorylated phosphoenolpyruvate synthase SRT3109 (PpsA) to pyruvate. We expect this antibody to open opportunities for investigating other pHis-proteins and their functions. INTRODUCTION Protein phosphorylation is a central player in the regulation of cellular processes.1 Although this class of posttranslational modification (PTM) is known to occur on several amino acids, the available biochemical, pharmacological and proteomic tools for studying the modification are best developed in the context of Ser, Thr and Tyr phosphorylation.2 By contrast, there is a dearth of such tools for studying other protein phosphorylation events, a situation which has greatly hindered our ...
WDR85 Full-Length MS Protein Standard (NP_620133), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. WDR85 is a WD repeat-containing protein that plays a role in the first step of diphthamide biosynthesis (Carette et al., 2009 )
Histidine-rich glycoprotein (HRG)is a glycoprotein that in humans is encoded by the HRG gene. The HRG protein is produced in the liver, and it could also be synthesized by monocytes, macrophages, and megakaryocytes. It possesses a multi-domain structure, which makes it capable of binding to numerous ligands and modulating various biological processes including immunity, vascularization and coagulation. The HRG gene lies on location of 3q27 on the chromosome 3, spans approximately 11kb, and consist of 7 exons. Two common isoforms of the HRG gene have been found in humans. These isoforms exist due to a polymorphism occurring in exon 5. HRG is a glycoprotein of 70-75kDa present at a relatively high concentration in the plasma of vertebrates. The primary structure of human HRG is predicted to be a 507 amino acid multidomain polypeptide consisting of two cystatin-like regions at the N-terminus, a histidine-rich region (HRR) flanked by proline-rich regions (PRR), and a C-terminal domain. HRG has an ...
Molecular Cloning, also known as Maniatis, has served as the foundation of technical expertise in labs worldwide for 30 years. No other manual has been so popular, or so influential.
United States Histidine Market by Manufacturers, States, Type and Application, Forecast to 2022 United States Histidine Market by Manufacturers, States, Type and Application, Forecast to - Market research report and industry analysis - 10946302
The pharmacokinetics of L-histidine in humans has been investigated to evaluate the in vivo histidine ammonia lyase system for the conversion of L-histidine to urocanic acid. Two healthy volunteers (subjects A and B) received a single 100-mg oral dose of L-[3,3-2H2,1,3-15N2]histidine. Blood and urine samples were obtained over 24 hr after the administration and analyzed by stable isotope dilution ms. Labeled L-histidine was rapidly absorbed, and a maximum plasma concentration of L-histidine was observed at 30 min (1057.6 ng/ml) in subject A and at 60 min (1635.6 ng/ml) in subject B after oral administration. Pharmacokinetic parameters were calculated based on a two-compartment model. Labeled L-histidine in subject A (t1/2 = 1.0 hr) was eliminated approximately twice faster than that in subject B (t1/2 = 1.9 hr). Total body clearances were 70.0 liters/hr in subject A and 30.0 liters/hr in subject B. The low ratios of the renal clearance to the total body clearance (1.04% for subject A and 0.43% ...
The two-component system is involved in several developmental events and different responses to the environment. Histidine-containing phosphotransfer prote
Han, J H. and Harding, J D., Isolation and nucelotide sequence of a mouse histidine trna gene. (1982). Subject Strain Bibliography 1982. 4165 ...
1OPD: Mutation of serine-46 to aspartate in the histidine-containing protein of Escherichia coli mimics the inactivation by phosphorylation of serine-46 in HPrs from gram-positive bacteria.
The wealth of newly obtained proteomic information affords researchers the possibility of searching for proteins of a given structure or function. Here we describe a general method for the detection of a protein domain of interest in any species for which a complete proteome exists. In particular, we apply this approach to identify histidine phosphotransfer (HPt) domain-containing proteins across a range of eukaryotic species. From the sequences of known HPt domains, we created an amino acid occurrence matrix which we then used to define a conserved, probabilistic motif. Examination of various organisms either known to contain (plant and fungal species) or believed to lack (mammals) HPt domains established criteria by which new HPt candidates were identified and ranked. Search results using a probabilistic motif matrix compare favorably with data to be found in several commonly used protein structure/function databases: our method identified all known HPt proteins in the Arabidopsis thaliana ...
This entry represents the active-site-containing domain found in the trypsin family members. The catalytic activity of the serine proteases from the trypsin family is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which itself is hydrogen-bonded to a serine. The sequences in the vicinity of the active site serine and histidine residues are well conserved in this family of proteases [ (PUBMED:3136396) ]. A partial list of proteases known to belong to the trypsin family is shown below. ...
This entry represents the active-site-containing domain found in the trypsin family members. The catalytic activity of the serine proteases from the trypsin family is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which itself is hydrogen-bonded to a serine. The sequences in the vicinity of the active site serine and histidine residues are well conserved in this family of proteases [ (PUBMED:3136396) ]. A partial list of proteases known to belong to the trypsin family is shown below. ...
Authors: Julia, Georgescu; Burkhard, Bechinger. Citation: Georgescu, Julia; Bechinger, Burkhard. NMR structures of the histidine-rich peptide LAH4 in micellar environments: membrane insertion, pH-dependent mode of antimicrobial action and DNA transfection Biophysical J. ., .-... Assembly members: ...
Histidine is an essential amino acid that is significant in the growth and repair of tissues. It is important for the maintenance of the myelin sheaths that protect nerve cells.....
We have some questions concerning this process, namely it is how the histadine tags are interacting with the Ni-agarose and the casein that we use to passivate the flow cells. We know that histidine has an affinity to interact with cysteine, another amino acid, that is prevalent on the structure of the kappa-casein. We would like to know how they interact, and if that is the key for why kappa-casein is so effective as as a coating for the flow cells. Another thing that we are interested in is how the histidine tag interacts with the nickel in the Ni-agarose. We know that it interacts, it is a crucial step in the collection of kinesin, but exactly how it interacts is a currently a mystery. If we can understand that more clearly, we could use this knowledge to advance our understanding of the questions centered on the kappa-casein. One idea is that we can convert the histidine tag into a protected group that will not interact with anything and then proceed with the usual gliding motility assays to ...
Exposure of proteins to visible light in the presence of a sensitizer results in the oxidation of Met, Trp, Tyr, Cys, and His side chains. These reactions are only partially understood, particularly with His. In this study, the oxidation of free His, His derivatives, and His-containing peptides has been examined using visible light and a range of sensitizers. It is shown that photooxidation gives rise to unstable peroxides, in a light-, illumination time-, and sensitizer-dependent manner. The yield of these materials is increased when reactions are carried out in solutions prepared with D2O, which prolongs the lifetime of 1O2, and decreased in the presence of the potent 1O2 scavenger azide, consistent with the involvement of this excited state. These peroxides have half-lives of hours, though the rate of decomposition is enhanced by elevated temperatures, reductants, and metal ions. Reducing metal ions catalyze the formation of radicals, which have been detected by EPR spin trapping. Structural ...
A molecular model of histidine, an essential amino acid that is a precursor to histamine, a compound involved in the inflammatory response of the immune system. Atoms are coloured dark grey (carbon), light grey (hydrogen), red (oxygen) and blue (nitrogen). - Stock Image C017/6246
Click to know about the uses, price, consumption and side effects of HealthVit L- Histidine 500mg Capsule. Consult with top doctors online on mfine to know more
Imidazoleglycerol-phosphate dehydratase, catalyzes the sixth step in histidine biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts; transcription is regulated by general amino acid control via ...
Histidine is an essential amino acid. L-Histidine, specifically, cannot be formed by other nutrients and must be present within ones diet.. ...
SWISS-MODEL Template Library (SMTL) entry for 1hsl.1. REFINED 1.89 ANGSTROMS STRUCTURE OF THE HISTIDINE-BINDING PROTEIN COMPLEXED WITH HISTIDINE AND ITS RELATIONSHIP WITH MANY OTHER ACTIVE TRANSPORT(SLASH)CHEMOSENSORY RECEPTORS
Question - 10 months old, regularly constipated, skin tag on the bottom due to this. Advice ?. Ask a Doctor about uses, dosages and side-effects of Lactulose, Ask a Gastroenterologist
MODx: img tag on steroids... :) - @pepebe shared this Cacher snippet. Cacher is the code snippet organizer that empowers professional developers and their teams to get more coding done, faster.
Histidine rich protein II[edit]. The histidine-rich protein II (HRP II) is a histidine- and alanine-rich, water-soluble protein ... "Comparative analysis of the Plasmodium falciparum histidine-rich proteins HRP-I, HRP-II and HRP-III in malaria parasites of ... "Genetic diversity of Plasmodium falciparum histidine-rich protein 2 (PfHRP2) and its effect on the performance of PfHRP2-based ... "Plasmodium falciparum Histidine-Rich Protein 2-Based Immunocapture Diagnostic Assay for Malaria: Cross-Reactivity with ...
Like nucleotides, biosynthesis of histidine is initiated by the conversion of R5P to PRPP. The step of histidine biosynthesis ... Histidine biosynthesis is carefully regulated by feedback inhibition/ R5P can be converted to adenosine diphosphate ribose, ... Ingle RA (January 2011). "Histidine biosynthesis". The Arabidopsis Book. 9: e0141. doi:10.1199/tab.0141. PMC 3266711. PMID ... and histidine. Nucleotides serve as the building blocks for nucleic acids, DNA and RNA. They are composed of a nitrogenous base ...
Examples include cystine from hydrolysis of hair, tryptophane from casein, histidine from red blood cells, and arginine from ... Foster, G. L.; Shemin, D. (1938). "L-Histidine Monohydrochloride". Organic Syntheses. 18: 43. doi:10.15227/orgsyn.018.0043. ...
This enzyme participates in histidine metabolism as it is involved in the 6th step of histidine biosynthesis as part of a nine ... This reaction is the sixth step in the biosynthesis of histidine in bacteria, fungi and plants. This enzyme belongs to the ... AMES BN (1957). "The biosynthesis of histidine; D-erythro-imidazoleglycerol phosphate dehydrase". J. Biol. Chem. 228 (1): 131- ... "Structure and function of the Salmonella typhimurium and Escherichia coli K-12 histidine operons". J. Mol. Biol. 203 (3): 585- ...
There are also protein kinases that phosphorylate other amino acids, including histidine kinases that phosphorylate histidine ... Histidine kinases are found widely in prokaryotes, as well as in plants, fungi and eukaryotes. The pyruvate dehydrogenase ... A phosphate group from ATP is first added to a histidine residue within the kinase, and later transferred to an aspartate ... See JAK-STAT pathway.) Histidine kinases are structurally distinct from most other protein kinases and are found mostly in ...
This enzyme participates in histidine metabolism. This enzyme belongs to the family of hydrolases, to be specific, those acting ... Ames BN (June 1957). "The biosynthesis of histidine; L-histidinol phosphate phosphatase". The Journal of Biological Chemistry. ...
It is a secondary disorder of histidine metabolism. Urocanic aciduria is thought to be relatively benign. Although aggressive ... The amino acid histidine, when catalyzed by the enzyme histidase, forms urocanic acid. Disruptions in this pathway, caused by a ... With normal to only slightly elevated levels of histidine present in the liver during urocanic aciduria, the only true ... Disorders of histidine metabolism. http://www.ommbid.com/OMMBID/the_online_metabolic_and_molecular_bases_of_inherited_disease/b ...
THE PREPARATION OF HISTIDINE" (PDF). Journal of Biological Chemistry. 78 (3): 627-635. ISSN 0021-9258. v t e. ... Sven Gustaf Hedin (1859-1933) was a Swedish chemist and physiologist credited with the discovery of histidine. Nordisk ... Vickery, Hubert Bradford; Leavenworth, Charles S. (1928-08-01). "ON THE SEPARATION OF HISTIDINE AND ARGININE IV. ...
Rose's later work showed that eight amino acids are essential for adult human beings, with histidine also being essential for ... Kopple JD, Swendseid ME (May 1975). "Evidence that histidine is an essential amino acid in normal and chronically uremic man". ... The role of threonine and histidine". The Journal of Biological Chemistry. 188 (1): 49-58. doi:10.1016/S0021-9258(18)56144-5. ... The role of isoleucine; additional evidence concerning histidine" (PDF). J Biol Chem. 193 (2): 605-612. doi:10.1016/S0021-9258( ...
histidine (to stabilise the pH). The histidine pH buffer is to ensure the vaccine stays as close as possible to the pH of human ... Outer membrane vesicles are purified out of the culture medium by ultracentrifugation, stabilised by histidine and then ...
... and the histidine amidotransferase hisH. Weng ML, Zalkin H (July 1987). "Structural role for a conserved region in the CTP ... histidine and glutamate. Class-I GATase domains have been found in the following enzymes: the second component of anthranilate ...
... often histidine is also present. The charged residues bind either one or two metal ions that are required for catalysis; under ...
Histidine decarboxylase inhibitorsEdit. Inhibit the action of histidine decarboxylase:. *Tritoqualine. *Catechin ...
Histidine. 0.726 g. Alanine. 1.436 g. Aspartic acid. 2.200 g. Glutamic acid. 3.610 g. ...
Histidine. 0.389 g. Alanine. 0.662 g. Aspartic acid. 1.368 g. Glutamic acid. 2.885 g. ...
Histidine. 0.557 g. Alanine. 1.027 g. Aspartic acid. 2.911 g. Glutamic acid. 6.810 g. ...
It can take place on several amino acids, like lysine, asparagine, aspartate and histidine, but the most frequently ...
Histidine. 0.255 g. Alanine. 0.509 g. Aspartic acid. 1.222 g. Glutamic acid. 2.393 g. ...
Histidine. 0.969 g. Alanine. 1.528 g. Aspartic acid. 3.662 g. Glutamic acid. 6.269 g. ...
Histidine. 1.8 g. 2.230 g. 3.455 g 2.710 g. 2.414 g. 2.821 g. 2.495 g. 2.756 g. 1.888 g. 3.3 g. 1.974 g. 3.2 g. 2.660 g ...
Histidine. 1.085 g. Alanine. 4.515 g. Aspartic acid. 5.793 g. Glutamic acid. 8.386 g. ...
... usually occurs on serine, threonine, tyrosine and histidine residues in eukaryotic proteins. Histidine ... and some lower eukaryotes histidine's nitrogen act as a nucleophile and binds to a phosphate group.[38] Once histidine is ... Histidine and aspartate phosphorylation occurs in prokaryotes as part of two-component signaling and in some cases in ... Recent evidence confirms widespread histidine phosphorylation at both the 1 and 3 N-atoms of the imidazole ring [6][7] Recent ...
Histidine. 0.067 g. Alanine. 0.161 g. Aspartic acid. 0.417 g. Glutamic acid. 0.312 g. ...
Thiolates, not thiols, attack disulfide bonds. Hence, thiol-disulfide exchange is inhibited at low pH (typically, below 8) where the protonated thiol form is favored relative to the deprotonated thiolate form. (The pKa of a typical thiol group is roughly 8.3, but can vary due to its environment.) Thiol-disulfide exchange is the principal reaction by which disulfide bonds are formed and rearranged in a protein. The rearrangement of disulfide bonds within a protein generally occurs via intra-protein thiol-disulfide exchange reactions; a thiolate group of a cysteine residue attacks one of the protein's own disulfide bonds. This process of disulfide rearrangement (known as disulfide shuffling) does not change the number of disulfide bonds within a protein, merely their location (i.e., which cysteines are bonded). Disulfide reshuffling is generally much faster than oxidation/reduction reactions, which change the number of disulfide bonds within a protein. The oxidation and reduction of protein ...
Histidine. 0.416 g. Alanine. 0.836 g. Aspartic acid. 1.550 g. Glutamic acid. 0.595 g. ...
Histidine. 0.077 g. Alanine. 0.170 g. Aspartic acid. 0.325 g. Glutamic acid. 0.761 g. ...
Histidine. 0.389 g. Alanine. 0.799 g. Aspartic acid. 1.261 g. Glutamic acid. 2.259 g. ...
A similar attenuation mechanism regulates the synthesis of histidine, phenylalanine and threonine. ...
Histidine His H MT-TH 12,138-12,206 L Isoleucine Ile I MT-TI 4,263-4,331 L ...
This enzyme participates in histidine metabolism. It employs one cofactor, H+. This enzyme belongs to the family of hydrolases ... Smith DW, Ames BN (July 1965). "Phosphoribosyladenosine monophosphate, an intermediate in histidine biosynthesis". The Journal ...
Humans and other animals must ingest histidine or histidine-containing proteins. The biosynthesis of histidine has been widely ... In a histidine proton shuttle, histidine is used to quickly shuttle protons. It can do this by abstracting a proton with its ... Histidine is one of the amino acids that can be converted to intermediates of the tricarboxylic acid (TCA) cycle. Histidine, ... Histidine forms complexes with many metal ions. The imidazole sidechain of the histidine residue commonly serves as a ligand in ...
In terms of enzymology, a histidine kinase (EC 2.7.13.3, EnvZ, histidine protein kinase, protein histidine kinase, protein ... protein L-histidine ⇌ {\displaystyle \rightleftharpoons } ADP + protein N-phospho-L-histidine. Thus, the two substrates of this ... the widespread existence of protein histidine phosphorylation distinct from that of two-component histidine kinases has been ... The histidine phosphorylation site is located at His-260. The N, G1, F and G2 boxes are contained in the C-terminal catalytic ...
l-histidine.[14][15] Just like animals and microorganisms, plants need histidine for their growth and development.[11] ... The biosynthesis of histidine has been widely studied in prokaryotes such as E. coli. Histidine synthesis in E. coli involves ... In a histidine proton shuttle, histidine is used to quickly shuttle protons. It can do this by abstracting a proton with its ... Histidine is one of the amino acids that can be converted to intermediates of the tricarboxylic acid (TCA) cycle.[19] Histidine ...
Histidine is one of the 20 ribosomally encoded protein amino acids. It was first isolated by the German physician and ... Cleaves H.J.. (2014) Histidine. In: Amils R. et al. (eds) Encyclopedia of Astrobiology. Springer, Berlin, Heidelberg. * .RIS ... Histidine is one of the 20 ribosomally encoded protein amino acids. It was first isolated by the German physician and ... It is distinguished by having a side chain with an imidazole ring, which has a pKa of approximately 6. Histidine has an ...
Histidine has the following structure: COOH , H2N-C-H , CH2 , C--NH ,, \ ,, CH ,, // C---Na , H The nitrogen labled a can be ... Histidine has the following structure: COOH , H2N-C-H , CH2 , C--NH ,, \ ,, CH ,, // C---Na , H The nitrogen labled a can be ... Histidine is a very catalytically active molecule. It plays critical roles in enzymes such as RNase and in Serine Proteases. ...
Histidine biosynthesis (IPR006062). Short name: His_biosynth Overlapping homologous superfamilies *Ribulose-phosphate binding ... Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. Proteins involved in ... involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization ... and is involved in the fifth and sixth steps in histidine biosynthesis. ...
What is histidine hydrochloride? Histidine hydrochloride carries the IUPAC name of Histidine or His. Histidine is an amino acid ... Is histidine aromatic? The imidazole ring of histidine is aromatic at all pH values. It contains six pi electrons: four from ... Functions of histidine? Histidine is involved in many functions. It is responsible for the transmission of your brains signals ... Role of distal histidine in myoglobin? Role of distal histidine in myoglobin?. ...
Protein involved in the synthesis of the weakly basic amino acid histidine. ...
Histidine definition, an essential amino acid, C3H3N2CH2CH(NH2)COOH, that is a constituent of proteins and is important as the ... Words nearby histidine. histamine test, histaminic headache, histaminuria, histidase, histidinase, histidine, histidine ammonia ...
Histidine Treatment of Peptic Ulcer. Br Med J 1936; 1 doi: https://doi.org/10.1136/bmj.1.3932.1020-a (Published 16 May 1936) ...
Histidine Treatment of Peptic Ulcer. Br Med J 1936; 1 doi: https://doi.org/10.1136/bmj.1.3934.1130-a (Published 30 May 1936) ...
... Rajesh Krishnamurthy krishnam at umbc.edu Mon Mar 24 16:21:29 EST 1997 *Previous message: histidine ... is that higher levels of free histidine would chelate metals better than , histidine bound in peptides, mostly for steric ... Any thought? TIA It might work for most of the cases, but the same steric reasons might enable multiple histidine peptides to ... that the answer to your question has to vary depending on the peptide fragment and one cannot always assume that free histidine ...
Histidine triad, conserved site (IPR019808). Short name: Histidine_triad_CS Description. The Histidine Triad (HIT) motif, His-x ... The signature pattern used in this entry contains the region of the histidine triad and includes the three conserved histidine ... Crystal structures of HINT demonstrate that histidine triad proteins are GalT-related nucleotide-binding proteins.. Nat. Struct ... Hint, Fhit, and GalT: function, structure, evolution, and mechanism of three branches of the histidine triad superfamily of ...
HDC histidine decarboxylase [Homo sapiens] HDC histidine decarboxylase [Homo sapiens]. Gene ID:3067 ... histidine decarboxylaseprovided by HGNC. Primary source. HGNC:HGNC:4855 See related. Ensembl:ENSG00000140287 MIM:142704 Gene ... crystal of histidine decarboxylase belonged to space group C2, with unit-cell parameters a = 215.16, b = 112.72, c = 171.39 A, ... Relation of polymorphism of the histidine decarboxylase gene to chronic heart failure in Han Chinese. He GH, et al. Am J ...
Role of histidines in discriminating between Zn and Cd in a plant MT (Mol. BioSyst. 2010). See also: Histidines in a plant MT ( ... Histidines in metallothioneins Previously characterised metallothioneins from yeast, vertebrates, and other animals coordinate ... We have currently several metallothioneins under study in our lab in which histidine residues play pivotal roles in modulating ... However, quite a number of metallothioneins do contain histidine residues, which may in principle also coordinate metal ions ...
Make research projects and school reports about histidine easy with credible articles from our FREE, online encyclopedia and ... histidine An essential amino acid with a basic side chain.. Cite this article Pick a style below, and copy the text for your ... histidine A basic, polar amino acid that contains an imidazole group (C3H4N2); it is the precursor of histamine.. ... Histidine is the direct precursor of histamine; it is also an important source of carbon atoms in the synthesis of purines. The ...
Histidine kinases in signal transduction; 1 edition; First published in 2003; Subjects: Protein kinases, Cellular signal ... Histidine kinases in signal transduction edited by Masayori Inouye, Rinku Dutta. Published 2003 by Academic Press in Amsterdam ... Are you sure you want to remove Histidine kinases in signal transduction from your list? ... Citation ,publisher = Academic Press ,ol = 3573681M ,isbn = 0123724848 ,publication-place = Amsterdam ,title = Histidine ...
Mammalian cells do not have any two-component or phosphorelay systems, although protein histidine kinases unrelated to the ...
Histidine a protein in the body. It has been used to ease swelling in the joints and to lower body mass index (BMI). Histidine ... It is likely safe to take histidine in small doses for a short time. Not enough studies have been done to say whether it is ... Histidine supplementation improves insulin resistance through suppressed inflammation in obese women with the metabolic ...
The first variant starts from Nα,Nim-di-Boc-histidine, from which the Nim-Boc group is removed with hydrazine hydrate. The N ... The first variant starts from Nα,Nim-di-Boc-histidine, from which the Nim-Boc group is removed with hydrazine hydrate. The Nα- ... Boc-histidine formed is esterified with chlorotrimethylsilane, tritylated in the imidazole group, and, after the elimination of ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
The fragile histidine triad (FHIT) protein is a member of the large and ubiquitous histidine triad (HIT) family of proteins. It ... The fragile histidine triad (FHIT) protein is a member of the large and ubiquitous histidine triad (HIT) family of proteins. It ... FRAGILE HISTIDINE PROTEIN. A. 147. Homo sapiens. Mutation(s): 2 Gene Names: FHIT. EC: 3.6.1.29. ...
... is one of the 20 most common natural amino acids, coded for in DNA. Nutritionally, in humans, histidine is ... The nitrogen side chains of histidine and the relatively neutral pK (ca 6.0) of the histine proton mean that this amino acid ...
... *Formula: C10H19N3O2Si ... Other names: 1-Methyl-l-histidine, trimethylsilyl ester * ...
L-histidine is an essential amino acid and a histidine-deficient diet was shown to cause skin eruption. Even though the ... Consequently, L-histidine can be considered essential for the proper structure of the skin, and skin sensitisation testing is ... L-histidine is an essential amino acid and is considered essential for the proper structure of the skin. ... and therefore the lesions represent a specific response to histidine deficiency. ...
About this substance This section provides an overview of the volume in which the substance is manufactured or imported to the European Economic Area (EU28 + Iceland, Liechtenstein and Norway). Additionally, if available, information on the use of the substance and how consumers and workers are likely to be exposed to it can also be displayed here.. The use information is displayed per substance life cycle stage (consumer, in articles, by professional workers (widespread uses), in formulation or re-packing, at industrial sites or in manufacturing). The information is aggregated from REACH registered dossiers provided by industry.. For a detailed overview on identified uses and environmental releases, please consult the registered substance dossier.. Use descriptors are adapted from ECHA guidance to improve readability and may not correspond textually to descriptor codes described in Chapter R.12: Use Descriptor system of ECHA Guidance on information requirements and chemical safety ...
Structural plasticity and catalysis regulation of a thermosensor histidine kinase. Daniela Albanesi, Mariana Martín, Felipe ... Structural plasticity and catalysis regulation of a thermosensor histidine kinase. Daniela Albanesi, Mariana Martín, Felipe ... A) The pattern of intrahelical H bonds in monomer A of DesKC-P (Top) and E188a (Bottom) around the phosphorylatable histidine ... Histidine kinases are multifunctional enzymes that share a conserved intracellular catalytic core linked to a high diversity of ...
About ALANINE/ HISTIDINE/ LYSINE POLYPEPTIDE COPPER HCL: Alanine/Histidine/Lysine Polypeptide Copper HCl is a copper derivative ... Show all 2 recent products that contain ALANINE/ HISTIDINE/ LYSINE POLYPEPTIDE COPPER HCL.. ... of a peptide derivedfrom alanine, histidine, and lysine.. Function(s): Skin-Conditioning Agent - Miscellaneous; SKIN ...
Polyangium cellulosum strain So ce10 histidine kinase response regulator gene, p... Polyangium cellulosum strain So ce10 ... Polyangium cellulosum strain So ce10 histidine kinase response regulator gene, partial cds; hypothetical protein genes, ... histidine kinase response regulator gene, partial cds; hypothetical protein genes, complete cds; ambruticin gene cluster, ...
L-Histidine ReagentPlus®, ≥99% (TLC); CAS Number: 71-00-1; EC Number: 200-745-3; Synonym: (S)-2-Amino-3-(4-imidazolyl)propionic ... Histidine is an essential amino acid. It binds to metal ions and may aid in the transport of copper. Histidine is widely ... Histidine ReagentPlus®, ≥99% (TLC) Synonym: (S). -. 2-. Amino-. 3-. (4-. imidazolyl). propionic acid, NSC 137773 ... histidine has been used for the selection of transformed cells. It has also been used to study its effects on the formation of ...
  • Histidine kinases (HK) are multifunctional, and in non-animal kingdoms, typically transmembrane, proteins of the transferase class of enzymes that play a role in signal transduction across the cellular membrane. (wikipedia.org)
  • Distinct from other classes of protein kinases, HKs are usually parts of a two-component signal transduction mechanisms in which HK transfers a phosphate group from ATP to a histidine residue within the kinase, and then to an aspartate residue on the receiver domain of a response regulator protein (or sometimes on the kinase itself). (wikipedia.org)
  • More recently, the widespread existence of protein histidine phosphorylation distinct from that of two-component histidine kinases has been recognised in human cells. (wikipedia.org)
  • Are you sure you want to remove Histidine kinases in signal transduction from your list? (openlibrary.org)
  • Histidine kinases in signal transduction edited by Masayori Inouye, Rinku Dutta. (openlibrary.org)
  • Mammalian cells do not have any two-component or phosphorelay systems, although protein histidine kinases unrelated to the sensor kinase may be involved in cellular signaling. (sciencemag.org)
  • The structural comparison of the different DesK variants indicates that incoming signals can take the form of helix rotations and asymmetric helical bends similar to those reported for other sensing systems, suggesting that a similar switching mechanism could be operational in a wide range of sensor histidine kinases. (pnas.org)
  • Histidine kinases are multifunctional enzymes that share a conserved intracellular catalytic core linked to a high diversity of signal-sensing domains. (pnas.org)
  • Sensor histidine kinases are central to sensing in bacteria and in plants. (nature.com)
  • This structural mechanism presents a template for signal transduction in sensor histidine kinases. (nature.com)
  • Sensor histidine kinases (SHKs) constitute the main means by which bacteria gather information about their surroundings. (nature.com)
  • Bacterial histidine kinases have been proposed as targets for the discovery of new antibiotics, yet few specific inhibitors of bacterial histidine kinases have been reported. (asm.org)
  • We report here a novel thienopyridine (TEP) compound that inhibits bacterial histidine kinases competitively with respect to ATP but does not comparably inhibit mammalian serine/threonine kinases. (asm.org)
  • We have previously identified a panel of inhibitors targeting bacterial histidine kinases in bacteria that inhibit targets involved in the regulation of virulence and stress response pathways in bacterial pathogens (Velikova et al. (wur.nl)
  • The activities of this Transnational Network are aimed at aligning international research activities and combining expertise to devise the most efficient strategy to further develop new anti-infective drugs targeted to histidine kinases. (wur.nl)
  • All these pathogens rely on histidine kinases, as part of two-component systems to adapt to the diseased lung. (infectioncontroltoday.com)
  • ü Histidine is metabolized into the neurotransmitter histamine and the set of genes that produce the enzymes responsible for histidine synthesis. (answers.com)
  • This gene encodes a member of the group II decarboxylase family and forms a homodimer that converts L-histidine to histamine in a pyridoxal phosphate dependent manner. (nih.gov)
  • Bile acid increases expression of the histamine-producing enzyme, histidine decarboxylase, in gastric cells. (nih.gov)
  • Human histidine decarboxylase (HDC) and dopa decarboxilase (DDC) are highly homologous enzymes responsible for the synthesis of biogenic amines (BA) like histamine, and serotonin and dopamine, respectively. (nih.gov)
  • Even though the mechanism is unkonwn, this might be due to low histamine levels in the skin, and therefore the lesions represent a specific response to histidine deficiency. (europa.eu)
  • Precursor of histamine by action of histidine decarboxylase. (sigmaaldrich.com)
  • Histidine serves as a precursor for the formation of histamine, which is associated with allergic responses. (sigmaaldrich.com)
  • A molecular model of histidine, an essential amino acid that is a precursor to histamine, a compound involved in the inflammatory response of the immune system. (sciencephoto.com)
  • Dietary histidine has been shown to elevate circulating free histidine and plasma histamine concentration in murine models as much as six-fold. (petfoodindustry.com)
  • Bladder mastocytosis is a hallmark of feline interstitial cystitis, and histidine is stored in mast cells and converted to histamine for signaling and inflammation by the enzyme histidine decarboxylase. (petfoodindustry.com)
  • Nine healthy adult female shorthair cats were used to test the effects of dietary histidine (0.6%, 1.0% and 1.4% on a dry matter basis, or DM) on histamine in blood and urine. (petfoodindustry.com)
  • Urinary histamine:creatinine was greater for the 1.4% histidine treatment compared to other diets, while urinary histamine concentration and plasma histamine concentration were unaffected. (petfoodindustry.com)
  • 2012. Influence of dietary histidine on basophil release, circulating concentration and urinary excretion of histamine in domestic felines. (petfoodindustry.com)
  • L-histidine is a precursor for histamine, which plays an essential role in localized immune responses. (xtend-life.com)
  • We investigated the urinary levels of L-histidine, a precursor of histamine related to inflammatory responses, as a new candidate biomarker for diagnosing this condition. (dovepress.com)
  • HDC(Histidine decarboxylase) is the enzyme that catalyzes the reaction that produces histamine from histidine with the help of vitamin B6. (acris-antibodies.com)
  • The biosynthesis of histamine from histidine is catalyzed by the enzyme L-histidine decarboxylase. (acris-antibodies.com)
  • Investigation of a Possible Role for the Histidine Decarboxylase Gene in Tourette Syndrome in the Chinese Han Population: A Family-Based Study. (nih.gov)
  • Histidine decarboxylase and urinary methylimidazoleacetic acid in gastric neuroendocrine cells and tumours. (nih.gov)
  • Relation of polymorphism of the histidine decarboxylase gene to chronic heart failure in Han Chinese. (nih.gov)
  • Title: Structural and functional analogies and differences between histidine decarboxylase and aromatic l-amino acid decarboxylase molecular networks: Biomedical implications. (nih.gov)
  • This homodimeric enzyme is a pyridoxal phosphate (PLP)-dependent decarboxylase and is highly specific for its histidine substrate. (acris-antibodies.com)
  • Histidine (symbol His or H) is an α-amino acid that is used in the biosynthesis of proteins. (wikipedia.org)
  • Furthermore, histidine-rich low-complexity regions are found in metal-binding and especially nickel-cobalt binding proteins. (wikipedia.org)
  • Humans and other animals must ingest histidine or histidine-containing proteins. (wikipedia.org)
  • In marked contrast to Ser, Thr and Tyr phosphorylation, the analysis of phosphorylated Histidine using standard biochemical and mass spectrometric approaches is much more challenging, and special procedures and separation techniques are required for their preservation alongside classical Ser, Thr and Tyr phosphorylation on proteins isolated from human cells. (wikipedia.org)
  • Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in one family. (ebi.ac.uk)
  • This region, referred to as the histidine triad (HIT) [ PMID: 1899836 ], has been identified in various prokaryotic and eukaryotic proteins of uncertain function [ PMID: 1472710 ]. (ebi.ac.uk)
  • Crystal structures of HINT demonstrate that histidine triad proteins are GalT-related nucleotide-binding proteins. (ebi.ac.uk)
  • histidine (hĬs´tĬdēn) , organic compound, one of the 22 α- amino acids commonly found in animal proteins. (encyclopedia.com)
  • This turns out to be an important property when histidine is incorporated into proteins , particularly when it becomes a part of the primary structure of some enzymes . (encyclopedia.com)
  • The fragile histidine triad (FHIT) protein is a member of the large and ubiquitous histidine triad (HIT) family of proteins. (rcsb.org)
  • The ability to study protein histidine phosphorylation in mammalian cells has benefited from the development of antibodies that recognize proteins phosphorylated at the nitrogen at the 1 position of the imidazole ring of histidine or the nitrogen at the 3 position. (sciencemag.org)
  • Thus, rather than dephosphorylating the target proteins directly, PGAM5 limits histidine phosphorylation by preventing phosphotransfer from the histidine kinase (NDPK-B) to its targets, thereby regulating this posttranslational modification that is important for setting the threshold for T cell activation. (sciencemag.org)
  • I think if someone is living a strict vegan lifestyle and not consuming complete proteins (or loads of rice, wheat and rye) then l-histidine supplementation may be beneficial when taking beta alanine for performance. (anabolicminds.com)
  • The histidine phosphatase superfamily is a large functionally diverse group of proteins. (biochemj.org)
  • The nano-experts from the Center for Applied Nanotechnology (CAN) GmbH expand their product portfolio by CANdots® Series G - His Detect, which is a ready-to-use reagent for the detection of poly-histidine tagged proteins in Blot assays. (news-medical.net)
  • The site-specific immobilization of histidine-tagged proteins to patterns formed by far-field and near-field exposure of films of aminosilanes with protein-resistant photolabile protecting groups is demonstrated. (osti.gov)
  • Although it partitions into membranes and does not inhibit the growth of bacterial or mammalian cells, TEP could serve as a starting compound for a new class of histidine kinase inhibitors with antibacterial activity. (asm.org)
  • The objectives of the proposed Transnational Network are to bring together scientists from academia and industry working in relevant multidisciplinary fields to develop integrated strategies to overcome the permeability barrier of Gram-negative cell envelopes and further develop newly discovered histidine kinase inhibitors as anti-virulence therapies. (wur.nl)
  • Researchers from Spain, The Netherlands, and United Kingdom have joined efforts to identify bacterial histidine kinase inhibitors that can be further developed as novel antibacterial medicines. (infectioncontroltoday.com)
  • In a recent publication in Current Drug Targets the potential to use bacterial histidine kinase inhibitors to treat bacterial infections in CF patients is studied by reviewing key TCS of different pathogens involved in CF lung disease. (infectioncontroltoday.com)
  • Recently identified putative histidine kinase inhibitors (Velikova et al. (wur.nl)
  • Establish in an open label clinical trial the tolerability and safety of various doses of l-histidine and lodosyn that may increase levels of l-histidine and hist. (bioportfolio.com)
  • Cereal grains such as rice, rye and wheat also have significant levels of L-histidine. (xtend-life.com)
  • Loss of fragile histidine triad protein in human hepatocellular carcinoma. (curehunter.com)
  • In catalytic triads, the basic nitrogen of histidine abstract a proton from serine, threonine, or cysteine to activate it as a nucleophile. (wikipedia.org)
  • Hint, Fhit, and GalT: function, structure, evolution, and mechanism of three branches of the histidine triad superfamily of nucleotide hydrolases and transferases. (ebi.ac.uk)
  • Restoration of fragile histidine triad (FHIT) expression induces apoptosis and suppresses tumorigenicity in breast cancer cell lines. (curehunter.com)
  • Restoration of fragile histidine triad (FHIT) expression induces apoptosis and suppresses tumorigenicity in lung and cervical cancer cell lines. (curehunter.com)
  • Inverse correlation of aberrant expression of fragile histidine triad (FHIT) protein with cyclin D1 protein and prognosis in Chinese patients with cholangiocarcinoma. (curehunter.com)
  • Expression of fragile histidine triad (FHIT) protein and its significance in diagnosing classical Hodgkin lymphoma]. (curehunter.com)
  • Abnormal expression of the fragile histidine triad ( FHIT ) candidate tumor suppressor gene has been observed in a variety of human tumors, but little is known about its expression during colorectal tumorigenesis. (aacrjournals.org)
  • In carbonic anhydrases, a histidine proton shuttle is utilized to rapidly shuttle protons away from a zinc-bound water molecule to quickly regenerate the active form of the enzyme. (wikipedia.org)
  • In terms of enzymology, a histidine kinase (EC 2.7.13.3, EnvZ, histidine protein kinase, protein histidine kinase, protein kinase (histidine), HK1, HP165, Sln1p) is an enzyme that catalyzes the chemical reaction ATP + protein L-histidine ⇌ {\displaystyle \rightleftharpoons } ADP + protein N-phospho-L-histidine. (wikipedia.org)
  • Thus, the two substrates of this enzyme are ATP and protein L-histidine, whereas its two products are ADP and protein N-phospho-L-histidine. (wikipedia.org)
  • The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. (ebi.ac.uk)
  • We also characterized two point mutants of the catalytic domain, in which the phosphorylatable histidine residue (H188) was substituted either by valine (DesKC H188V ), a mutant known to retain the phosphatase activity of the wild-type protein ( 4 ), or by glutamic acid (DesKC H188E ), sought to mimic the phosphorylated state of the enzyme. (pnas.org)
  • Sigmoid saturation curves were obtained in pyrophosphate buffer, indicating that the enzyme might have multiple binding sites for histidine. (asm.org)
  • The imidazole ring of histidine is aromatic at all pH values as it contains six π electrons, is a common coordinating ligand in metalloproteins, and is a part of the catalytic sites of many enzymes. (springer.com)
  • Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. (ebi.ac.uk)
  • The nitrogen side chains of histidine and the relatively neutral pK (ca 6.0) of the histine proton mean that this amino acid side chain finds its way into considerable use as a coordinating ligand in metalloproteins, and also as a catalytic site in certain enzymes. (fact-index.com)
  • Histidine is widely present at the active sites of enzymes. (sigmaaldrich.com)
  • The results imply that urocanate is the physiological inducer of the histidine-degrading enzymes in P. aeruginosa . (asm.org)
  • Histidine is one of the 20 most common natural amino acids , coded for in DNA . (fact-index.com)
  • How histidine is compared to other amino acids. (ebscohost.com)
  • Pfanstiehl announced that it has launched high purity, low endotoxin, low metal L-histidine and L-histidine hydrochloride monohydrate for a new quality standard for amino acids. (biopharminternational.com)
  • The gastrointestinal toxicity associated with aceclofenac can be reduced by condensing its carboxylic acid group with methyl esters of amino acids like histidine and alanine to give amide linkage by the Schotten-Baumann method. (srce.hr)
  • 5.4% NephrAmine® (Essential Amino Acid Injection) is a sterile, nonpyrogenic solution containing crystalline essential amino acids plus histidine. (nih.gov)
  • Each 250 mL unit provides Rose's recommended daily intake of essential amino acids 1 plus 625 mg of histidine, considered essential for uremics. (nih.gov)
  • Histidine-rich glycoprotein (HRG) is a protein interacting with angiogenesis, coagulation, and inflammatory responses, processes known to be altered in preeclamptic pregnancies. (diva-portal.org)
  • This study describes how the serum protein histidine-rich glycoprotein (HRG) affects the complement system. (nih.gov)
  • This histidine-rich glycoprotein contains two cystatin-like domains and is located in plasma and platelets. (antikoerper-online.de)
  • Zusätzlich bieten wir Ihnen Histidine-Rich Glycoprotein Antikörper (59) und Histidine-Rich Glycoprotein Proteine (9) und viele weitere Produktgruppen zu diesem Protein an. (antikoerper-online.de)
  • Poly-histidine tags (of six or more consecutive H residues) are utilized for protein purification by binding to columns with nickel or cobalt, with micromolar affinity. (wikipedia.org)
  • Each protein molecule binds one zinc ion via a novel binding site containing 3 closely-spaced histidine residues [ PMID: 1899836 ]. (ebi.ac.uk)
  • The signature pattern used in this entry contains the region of the histidine triad and includes the three conserved histidine residues which are thought to bind the zinc ion. (ebi.ac.uk)
  • We have currently several metallothioneins under study in our lab in which histidine residues play pivotal roles in modulating the metal-binding properties of these intriguing residues. (warwick.ac.uk)
  • HKs autophosphorylate at conserved histidine residues in response to environmental or metabolic signals (reviewed in references 7 , 18 , 19 , 22 , 34 , 42 , 45 , and 46 ). (asm.org)
  • Phosphoryl groups on the histidine residues of HKs are then transferred to conserved aspartate residues in the receiver domains of cognate RRs. (asm.org)
  • However, these compounds generally inhibit by binding to the four-helix bundle that contains the conserved histidine residues, thereby causing aggregation of the HKs ( 40 , 41 ). (asm.org)
  • With the benefit of an expanding set of histidine phosphatase superfamily structures, a clearer picture of the conserved elements is obtained, along with, conversely, a view of the sometimes surprising variation in substrate-binding and proton donor residues across the superfamily. (biochemj.org)
  • Histidine ammonia lyase (histidase), urocanase, and the capacity to degrade formiminoglutamate, which are respectively involved in steps I, II, and IV in the catabolism of histidine, were induced during growth of Pseudomonas aeruginosa on histidine or urocanate, and were formed gratuitously in the presence of dihydro-urocanate. (asm.org)
  • title=Crystal structure of histidine ammonia-lyase revealing a novel polypeptide modification as the catalytic electrophile. (wikidoc.org)
  • Copper histidine is a copper replacement that can be injected directly into the body to avoid absorption through the gastrointestinal tract. (bioportfolio.com)
  • The purpose of this study is to continue to evaluate the effects of early copper histidine in Menkes disease patients and to correlate specific molecular defects with responses to treatment. (bioportfolio.com)
  • Early copper-histidine treatment for Menkes disease. (edu.au)
  • However, the effects of dietary histidine on general population are not known. (mdpi.com)
  • The autophosphorylation H-box is contained in the N-terminal dimerization and histidine phosphotransfer (DHp) domain. (wikipedia.org)
  • The biosynthesis of histidine (His) in microorganisms, long studied through the isolation and characterization of auxotrophic mutants, has emerged as a paradigm for the regulation of metabolism and gene expression. (plantphysiol.org)
  • An ectotherm homologue of human predicted gene NAT16 encodes histidine N-acetyltransferase responsible for Nα-acetylhistidine synthesis. (fishersci.ca)
  • l-Histidine, is an essential amino acid that is not synthesized de novo in humans. (wikipedia.org)
  • Nutritionally , in humans, histidine is considered an essential amino acid , but only in children. (fact-index.com)
  • L-histidine is an essential amino acid and a histidine-deficient diet was shown to cause skin eruption. (europa.eu)
  • L-histidine is an essential amino acid and is considered essential for the proper structure of the skin. (europa.eu)
  • L -Histidine is an essential amino acid. (sigmaaldrich.com)
  • TWINLAB L-Histidine is a pure essential amino acid, vital for tissue growth and the manufacture of red and white blood cells. (astronutrition.com)
  • TWINLAB L-Histidine is an essential amino acid required by our bodies, because it makes a vital contribution to tissue growth and to the manufacture of red blood cells and white blood cells. (astronutrition.com)
  • Product Description L-Histidine is an essential amino acid that cannot be formed by other nutrients, and must be in the diet to be available to the body. (lookchem.com)
  • L-histidine is an essential amino acid, meaning that it must be obtained through dietary sources. (xtend-life.com)
  • Histidine was first thought to be an essential amino acid only in infants, but a 1975 study showed that it is also essential for adults. (xtend-life.com)
  • Histidine is considered an essential amino acid in uremic patients. (nih.gov)
  • Histidine has not been identified in carbonaceous chondrites and is difficult to be formed in Miller-type prebiotic synthesis experiments, while imidazole can be easily obtained in them. (springer.com)
  • Protein involved in the synthesis of the weakly basic amino acid histidine. (uniprot.org)
  • Research shows that it's beta alanine that drives carnosine synthesis and not histidine. (anabolicminds.com)
  • A. RASHEED i C.K.A. KUMAR, "Design, synthesis, hydrolysis kinetics and phamacodynamic profiles of histidine and alanine conjugates of aceclofenac", Acta Pharmaceutica , vol.60, br. (srce.hr)
  • We find that the coiled coil linker and the attached histidine kinase domains undergo a left handed rotation within microseconds. (nature.com)
  • Histidine supplementation improves insulin resistance through suppressed inflammation in obese women with the metabolic syndrome: a randomised controlled trial. (epnet.com)
  • Our previous studies have demonstrated that histidine supplementation significantly ameliorates inflammation and oxidative stress in obese women and high-fat diet-induced obese rats. (mdpi.com)
  • Histidine was first isolated by German physician Albrecht Kossel and Sven Gustaf Hedin in 1896. (wikipedia.org)
  • The German physician Albrecht Kossel discovered histidine in 1896. (xtend-life.com)
  • The conjugate acid (protonated form) of the imidazole side chain in histidine has a pKa of approximately 6.0. (wikipedia.org)
  • L-histidine has an imidazole side chain, which is the source of much of its biochemical activity. (xtend-life.com)
  • The biosynthesis of histidine has been widely studied in prokaryotes such as E. coli. (wikipedia.org)
  • The deficiency of Histidine can cause to anemia. (natural-homeremedies.org)
  • Scaly dry skin and fatigue are the other signs of Histidine deficiency. (natural-homeremedies.org)
  • Besides reducing the risk of Histidine deficiency, consumption of cauliflower offers wide range of health benefits such as building the healthy immune system, lowering the cholesterol levels, promoting healthy weight loss, detoxifying the body system and reducing the risk of cancers. (natural-homeremedies.org)
  • An L-histidine deficiency is also associated with age-related joint conditions, including stiffness and discomfort. (xtend-life.com)
  • Whereas the phosphatase PHPT-1 dephosphorylates KCa3.1, genetic knockout or knocking down PGAM5 in primary mouse or human T cells enhanced NDPK-B histidine phosphorylation at the 1 position and KCa3.1 histidine phosphorylation at the 3 position, increased T cell receptor-stimulated calcium influx, and enhanced proinflammatory cytokine production. (sciencemag.org)
  • S. Panda, S. Srivastava, Z. Li, M. Vaeth, S. R. Fuhs, T. Hunter, E. Y. Skolnik, Identification of PGAM5 as a mammalian protein histidine phosphatase that plays a central role to negatively regulate CD4 + T cells. (sciencemag.org)
  • Protein histidine phosphatase 1 (PHPT-1) is an evolutionarily conserved 14 kDa protein that dephosphorylates phosphohistidine. (diabetesjournals.org)
  • 2. Different radioimmunoassay (RIA) systems employing C-terminal- and N-terminal-specific anti-PHI sera were used to determine the relative contributions of PHI and its C-terminally extended forms, peptide histidine glycine (PHI-Gly) and peptide histidine valine [PHV(1-42)], to the PHI-LI released by the rat gastric fundus. (unboundmedicine.com)
  • DL-Histidine monohydrochloride (CAS 123333-71-1) Market Research Report 2018 contents were worked out and placed on the website in March, 2018. (marketpublishers.com)
  • Please note that DL-Histidine monohydrochloride (CAS 123333-71-1) Market Research Report 2018 is a half ready publication and contents are subject to change. (marketpublishers.com)
  • Natural poly-histidine peptides, found in the venom of the viper Atheris squamigera have been shown to bind Zn(2+), Ni(2+) and Cu(2+) and affect the function of venom metalloproteases. (wikipedia.org)
  • Poly(histidine-arginine) 6 (H6R6) peptide was introduced into chitosan (CS) to create a new CS derivative for siRNA delivery, 6-polyarginine (R6) as cell-penetrating peptides facilitated nanoparticle cellular internalization has been proved in our previous research, and 6-polyhistidine (H6) mediated the nanoparticle endosome escape resulted in the siRNA rapid releasing into tumor cytoplasm. (dovepress.com)
  • In short, I think that the answer to your question has to vary depending on the peptide fragment and one cannot always assume that free histidine binds better. (bio.net)
  • Chou TF, Tikh IB, Horta BA, Ghosh B, De Alencastro RB, Wagner CR: Engineered monomeric human histidine triad nucleotide-binding protein 1 hydrolyzes fluorogenic acyl-adenylate and lysyl-tRNA synthetase-generated lysyl-adenylate. (drugbank.ca)
  • Alanine/Histidine/Lysine Polypeptide Copper HCl is a copper derivative of a peptide derivedfrom alanine, histidine, and lysine. (ewg.org)
  • As Carnosine is a multi-functional dipeptide made up of Beta-Alanine and L-Histidine, though, I would like to know if you would add L-Histidine to Carnage any time in the future, or if you think Carnage provides adequate intra-muscular Carnosine as-is, without L-Histidine. (anabolicminds.com)
  • In my opinion this is due to the fact that histidine is already quite abundant in skeletal muscle and beta alanine is not. (anabolicminds.com)
  • The release of free aceclofenac from histidine and alanine conjugated aceclofenac showed negligible hydrolysis in SGF compared to SIF. (srce.hr)
  • We provide independent and unbiased information on manufacturers, prices, production news and consumers for the global and regional (North America, Asia and Europe) market of D-Histidine hydrochloride monohydrate. (reportsnreports.com)
  • 1. Longitudinal muscle strips from the rat gastric fundus were subjected to in vitro electrical field stimulation (EFS) under non-adrenergic non-cholinergic (NANC) conditions to study the release of peptide histidine isoleucine-like immunoreactivity (PHI-LI) and the correlation between PHI-LI release and NANC relaxation. (unboundmedicine.com)
  • The mechanism for the reactions catalyzed by histidine kinase have not been completely elucidated, but current evidence suggests that the catalytic domain of one dimeric unit may rotate in such a way that the ATP binding pocket of that unit can come into contact with a particular histidine residue on the opposite unit and a nucleophilic addition results in a phosphorylated histidine. (wikipedia.org)
  • They share a conserved catalytic core centred on a histidine which becomes phosphorylated during the course of the reaction. (biochemj.org)
  • Using structural and biochemical approaches, we show that the thermosensitive histidine kinase, DesK, from Bacillus subtilis is cold-activated through specific interhelical rearrangements in its central four-helix bundle domain. (pnas.org)
  • YF1 is a fully functional histidine kinase, and its biochemical activity is modulated by blue light. (nature.com)
  • The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [ PMID: 1472710 ]. (ebi.ac.uk)
  • Weiske J, Huber O: The histidine triad protein Hint1 interacts with Pontin and Reptin and inhibits TCF-beta-catenin-mediated transcription. (drugbank.ca)
  • Weiske J, Huber O: The histidine triad protein Hint1 triggers apoptosis independent of its enzymatic activity. (drugbank.ca)
  • Identification of the expression profile of apoptotic esophageal cancer cells by adenoviral-fragile histidine triad treatment. (curehunter.com)
  • Expression of nuclear factor-kappa-B/P65 and fragile histidine triad in colorectal carcinoma and clinical significance thereof]. (curehunter.com)
  • Clinicopathological analysis of loss of fragile histidine triad expression in lung cancer]. (curehunter.com)
  • The imidazole sidechain of the histidine residue commonly serves as a ligand in metalloproteins. (wikipedia.org)
  • Histidine is synthesized from phosphoribosyl pyrophosphate (PRPP), which is made from ribose-5-phosphate by ribose-phosphate diphosphokinase in the pentose phosphate pathway. (wikipedia.org)
  • presumably they accumulate enough urocanate from the breakdown of endogenous histidine to induce formation of the pathway. (asm.org)
  • These findings suggest that some sort of allosteric interaction involving histidase may play a role in governing the operation of the pathway of histidine catabolism. (asm.org)
  • histidine bound in peptides, mostly for steric reasons. (bio.net)
  • It might work for most of the cases, but the same steric reasons might enable multiple histidine peptides to bind better. (bio.net)
  • PHPT-1 -/- mice were generated to gain insight into the role of PHPT-1 and histidine phosphorylation/dephosphorylation in mammalian biology. (diabetesjournals.org)
  • The imidazole/imidazolium ring of histidine is aromatic at all pH values. (wikipedia.org)
  • Is histidine aromatic? (answers.com)
  • It has been shown that Histidine helps healthful digestion by promoting the movement of gastric juices. (astronutrition.com)
  • TWINLAB L-Histidine is a pure amino acid type that does not need digestion, as it is absorbed swiftly into the bloodstream for the body to use immediately. (astronutrition.com)
  • Histidine hydrochloride carries the IUPAC name of Histidine or His. (answers.com)
  • After complexation with Ni 2+ , this surface binds histidine-tagged GFP and CpcA-PEB in a site-specific fashion. (osti.gov)
  • By maintaining the myelin sheaths, histidine in mushrooms protects the body from the radiation damage. (natural-homeremedies.org)
  • L-histidine is used in the production of myelin sheaths, which support nerve cells. (xtend-life.com)
  • L-histidine is commonly sold in the form of L-histidine HCl, which is the hydrochloride salt of L-histidine. (xtend-life.com)
  • Maybe it should be the hydrochloride salt of histidine? (biology-online.org)
  • L-Histidine is a part of hemoglobin structure and function. (sigmaaldrich.com)
  • Histidine is a chief building block for hemoglobin. (natural-homeremedies.org)
  • L-histidine is also important in blood chemistry, since it is involved in stabilizing oxygen-bound hemoglobin and destabilizing carbon monoxide-bound hemoglobin. (xtend-life.com)
  • A low hemoglobin level and red blood cell count are some of the most common signs of a low L-histidine level. (xtend-life.com)
  • The spectra of acidic ferric His-MP10 nearly match those of ferric mesoporphyrin-reconstituted myoglobin and so the axial ligands are assigned to be histidine and water. (caltech.edu)
  • The retention of histidine ligation below pH 4 contrasts to the behavior of myoglobin and horseradish peroxidase which convert to five-coordinate water ligated and then lose the heme prosthetic group at even lower pH. (caltech.edu)
  • Deletion of histidine-rich protein genes pfhrp2/3 in Plasmodium falciparum causes infections to go undetected by HRP2-based malaria rapid diagnostic tests. (cdc.gov)
  • Histidine-rich protein 2 (HRP2)-based RDTs are largely preferred for detecting P. falciparum malaria because of their superior sensitivity and heat-stability profile over Plasmodium lactate dehydrogenase (pLDH) or aldolase ( 6 ). (cdc.gov)
  • Plasmodium falciparum histidine-rich protein 2-based malaria RDT results and presence or absence of the pfhrp2/pfhrp3 genes, in relation to parasite density, orizontal lines indicate geometric means a,d Eritrea. (cdc.gov)
  • Elevated dietary histidine may represent a risk factor for heightened mast cell responses. (petfoodindustry.com)
  • Plasma histidine concentration increased with dietary supply of histidine. (petfoodindustry.com)
  • Egg, which has been the part of our diet, for millennia, is another dietary source of Histidine. (natural-homeremedies.org)
  • Animal protein such as meat and dairy products are the best dietary sources of L-histidine. (xtend-life.com)
  • The objective of this Internet-based cross-sectional study was to evaluate the associations between dietary histidine and prevalence of overweight/obesity and abdominal obesity in northern Chinese population. (mdpi.com)
  • Dietary histidine was inversely associated with body mass index (BMI), waist circumference (WC) and blood pressure in overall population and stronger associations were observed in women and overweight/obese participants. (mdpi.com)
  • Higher dietary histidine was associated with lower prevalence of overweight/obesity and abdominal obesity, especially in women. (mdpi.com)
  • Further studies indicated that higher dietary histidine was associated with lower fasting blood glucose (FBG), homeostasis model assessment of insulin resistance (HOMA-IR), 2-h postprandial glucose (2 h-PG), tumor necrosis factor-α (TNF-α), interleukin-1β (IL-1β), interleukin-6 (IL-6), C-reactive protein (CRP), malonaldehyde (MDA) and vaspin and higher glutathione peroxidase (GSH-Px), superoxide dismutase (SOD) and adiponectin of overweight/obese individuals of both sexes. (mdpi.com)
  • In conclusion, higher dietary histidine is inversely associated with energy intake, status of insulin resistance, inflammation and oxidative stress in overweight/obese participants and lower prevalence of overweight/obesity in northern Chinese adults. (mdpi.com)
  • L-histidine may support the digestive system by stimulating the secretion of gastric juices such as pepsin and hydrochloric acid. (xtend-life.com)
  • With the current price of L-Histidine the price of Carnage would have to increase nearly $7 dollars at retail for a measly 500mg of Histidine per serving. (anabolicminds.com)