Substances that are recognized by the immune system and induce an immune reaction.
Substances elaborated by bacteria that have antigenic activity.
Proteins, glycoprotein, or lipoprotein moieties on surfaces of tumor cells that are usually identified by monoclonal antibodies. Many of these are of either embryonic or viral origin.
Antigens on surfaces of cells, including infectious or foreign cells or viruses. They are usually protein-containing groups on cell membranes or walls and may be isolated.
Substances elaborated by viruses that have antigenic activity.
Any part or derivative of any protozoan that elicits immunity; malaria (Plasmodium) and trypanosome antigens are presently the most frequently encountered.
Polyomavirus antigens which cause infection and cellular transformation. The large T antigen is necessary for the initiation of viral DNA synthesis, repression of transcription of the early region and is responsible in conjunction with the middle T antigen for the transformation of primary cells. Small T antigen is necessary for the completion of the productive infection cycle.
Antigens determined by leukocyte loci found on chromosome 6, the major histocompatibility loci in humans. They are polypeptides or glycoproteins found on most nucleated cells and platelets, determine tissue types for transplantation, and are associated with certain diseases.
Substances of fungal origin that have antigenic activity.
Differentiation antigens residing on mammalian leukocytes. CD stands for cluster of differentiation, which refers to groups of monoclonal antibodies that show similar reactivity with certain subpopulations of antigens of a particular lineage or differentiation stage. The subpopulations of antigens are also known by the same CD designation.
Any part or derivative of a helminth that elicits an immune reaction. The most commonly seen helminth antigens are those of the schistosomes.
The major group of transplantation antigens in the mouse.
A glycoprotein that is secreted into the luminal surface of the epithelia in the gastrointestinal tract. It is found in the feces and pancreaticobiliary secretions and is used to monitor the response to colon cancer treatment.
Those proteins recognized by antibodies from serum of animals bearing tumors induced by viruses; these proteins are presumably coded for by the nucleic acids of the same viruses that caused the neoplastic transformation.
A subclass of HLA-D antigens that consist of alpha and beta chains. The inheritance of HLA-DR antigens differs from that of the HLA-DQ ANTIGENS and HLA-DP ANTIGENS.
Molecules on the surface of T-lymphocytes that recognize and combine with antigens. The receptors are non-covalently associated with a complex of several polypeptides collectively called CD3 antigens (ANTIGENS, CD3). Recognition of foreign antigen and the major histocompatibility complex is accomplished by a single heterodimeric antigen-receptor structure, composed of either alpha-beta (RECEPTORS, ANTIGEN, T-CELL, ALPHA-BETA) or gamma-delta (RECEPTORS, ANTIGEN, T-CELL, GAMMA-DELTA) chains.
A group of antigens that includes both the major and minor histocompatibility antigens. The former are genetically determined by the major histocompatibility complex. They determine tissue type for transplantation and cause allograft rejections. The latter are systems of allelic alloantigens that can cause weak transplant rejection.
Antibodies produced by a single clone of cells.
Nuclear antigen with a role in DNA synthesis, DNA repair, and cell cycle progression. PCNA is required for the coordinated synthesis of both leading and lagging strands at the replication fork during DNA replication. PCNA expression correlates with the proliferation activity of several malignant and non-malignant cell types.
Large, transmembrane, non-covalently linked glycoproteins (alpha and beta). Both chains can be polymorphic although there is more structural variation in the beta chains. The class II antigens in humans are called HLA-D ANTIGENS and are coded by a gene on chromosome 6. In mice, two genes named IA and IE on chromosome 17 code for the H-2 antigens. The antigens are found on B-lymphocytes, macrophages, epidermal cells, and sperm and are thought to mediate the competence of and cellular cooperation in the immune response. The term IA antigens used to refer only to the proteins encoded by the IA genes in the mouse, but is now used as a generic term for any class II histocompatibility antigen.
A glycoprotein that is a kallikrein-like serine proteinase and an esterase, produced by epithelial cells of both normal and malignant prostate tissue. It is an important marker for the diagnosis of prostate cancer.
The lipopolysaccharide-protein somatic antigens, usually from gram-negative bacteria, important in the serological classification of enteric bacilli. The O-specific chains determine the specificity of the O antigens of a given serotype. O antigens are the immunodominant part of the lipopolysaccharide molecule in the intact bacterial cell. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
IMMUNOGLOBULINS on the surface of B-LYMPHOCYTES. Their MESSENGER RNA contains an EXON with a membrane spanning sequence, producing immunoglobulins in the form of type I transmembrane proteins as opposed to secreted immunoglobulins (ANTIBODIES) which do not contain the membrane spanning segment.
Sites on an antigen that interact with specific antibodies.
A trisaccharide antigen expressed on glycolipids and many cell-surface glycoproteins. In the blood the antigen is found on the surface of NEUTROPHILS; EOSINOPHILS; and MONOCYTES. In addition, CD15 antigen is a stage-specific embryonic antigen.
Carbohydrate antigens expressed by malignant tissue. They are useful as tumor markers and are measured in the serum by means of a radioimmunoassay employing monoclonal antibodies.
A specific HLA-A surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-A*02 allele family.
Differentiation antigens found on thymocytes and on cytotoxic and suppressor T-lymphocytes. CD8 antigens are members of the immunoglobulin supergene family and are associative recognition elements in MHC (Major Histocompatibility Complex) Class I-restricted interactions.
Lymphocytes responsible for cell-mediated immunity. Two types have been identified - cytotoxic (T-LYMPHOCYTES, CYTOTOXIC) and helper T-lymphocytes (T-LYMPHOCYTES, HELPER-INDUCER). They are formed when lymphocytes circulate through the THYMUS GLAND and differentiate to thymocytes. When exposed to an antigen, they divide rapidly and produce large numbers of new T cells sensitized to that antigen.
An immunoassay utilizing an antibody labeled with an enzyme marker such as horseradish peroxidase. While either the enzyme or the antibody is bound to an immunosorbent substrate, they both retain their biologic activity; the change in enzyme activity as a result of the enzyme-antibody-antigen reaction is proportional to the concentration of the antigen and can be measured spectrophotometrically or with the naked eye. Many variations of the method have been developed.
The major immunoglobulin isotype class in normal human serum. There are several isotype subclasses of IgG, for example, IgG1, IgG2A, and IgG2B.
Sets of cell surface antigens located on BLOOD CELLS. They are usually membrane GLYCOPROTEINS or GLYCOLIPIDS that are antigenically distinguished by their carbohydrate moieties.
Those hepatitis B antigens found on the surface of the Dane particle and on the 20 nm spherical and tubular particles. Several subspecificities of the surface antigen are known. These were formerly called the Australia antigen.
Complex of at least five membrane-bound polypeptides in mature T-lymphocytes that are non-covalently associated with one another and with the T-cell receptor (RECEPTORS, ANTIGEN, T-CELL). The CD3 complex includes the gamma, delta, epsilon, zeta, and eta chains (subunits). When antigen binds to the T-cell receptor, the CD3 complex transduces the activating signals to the cytoplasm of the T-cell. The CD3 gamma and delta chains (subunits) are separate from and not related to the gamma/delta chains of the T-cell receptor (RECEPTORS, ANTIGEN, T-CELL, GAMMA-DELTA).
Serological reactions in which an antiserum against one antigen reacts with a non-identical but closely related antigen.
Polymorphic class I human histocompatibility (HLA) surface antigens present on almost all nucleated cells. At least 20 antigens have been identified which are encoded by the A locus of multiple alleles on chromosome 6. They serve as targets for T-cell cytolytic responses and are involved with acceptance or rejection of tissue/organ grafts.
Membrane glycoproteins consisting of an alpha subunit and a BETA 2-MICROGLOBULIN beta subunit. In humans, highly polymorphic genes on CHROMOSOME 6 encode the alpha subunits of class I antigens and play an important role in determining the serological specificity of the surface antigen. Class I antigens are found on most nucleated cells and are generally detected by their reactivity with alloantisera. These antigens are recognized during GRAFT REJECTION and restrict cell-mediated lysis of virus-infected cells.
Morphologic alteration of small B LYMPHOCYTES or T LYMPHOCYTES in culture into large blast-like cells able to synthesize DNA and RNA and to divide mitotically. It is induced by INTERLEUKINS; MITOGENS such as PHYTOHEMAGGLUTININS, and by specific ANTIGENS. It may also occur in vivo as in GRAFT REJECTION.
Human immune-response or Class II antigens found mainly, but not exclusively, on B-lymphocytes and produced from genes of the HLA-D locus. They are extremely polymorphic families of glycopeptides, each consisting of two chains, alpha and beta. This group of antigens includes the -DR, -DQ and -DP designations, of which HLA-DR is most studied; some of these glycoproteins are associated with certain diseases, possibly of immune etiology.
The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Molecules on the surface of B- and T-lymphocytes that recognize and combine with specific antigens.
High-molecular weight glycoproteins uniquely expressed on the surface of LEUKOCYTES and their hemopoietic progenitors. They contain a cytoplasmic protein tyrosine phosphatase activity which plays a role in intracellular signaling from the CELL SURFACE RECEPTORS. The CD45 antigens occur as multiple isoforms that result from alternative mRNA splicing and differential usage of three exons.
Antigens of the virion of the HEPATITIS B VIRUS or the Dane particle, its surface (HEPATITIS B SURFACE ANTIGENS), core (HEPATITIS B CORE ANTIGENS), and other associated antigens, including the HEPATITIS B E ANTIGENS.
55-kDa antigens found on HELPER-INDUCER T-LYMPHOCYTES and on a variety of other immune cell types. CD4 antigens are members of the immunoglobulin supergene family and are implicated as associative recognition elements in MAJOR HISTOCOMPATIBILITY COMPLEX class II-restricted immune responses. On T-lymphocytes they define the helper/inducer subset. CD4 antigens also serve as INTERLEUKIN-15 receptors and bind to the HIV receptors, binding directly to the HIV ENVELOPE PROTEIN GP120.
The processes triggered by interactions of ANTIBODIES with their ANTIGENS.
Glycoproteins expressed on cortical thymocytes and on some dendritic cells and B-cells. Their structure is similar to that of MHC Class I and their function has been postulated as similar also. CD1 antigens are highly specific markers for human LANGERHANS CELLS.
Test for tissue antigen using either a direct method, by conjugation of antibody with fluorescent dye (FLUORESCENT ANTIBODY TECHNIQUE, DIRECT) or an indirect method, by formation of antigen-antibody complex which is then labeled with fluorescein-conjugated anti-immunoglobulin antibody (FLUORESCENT ANTIBODY TECHNIQUE, INDIRECT). The tissue is then examined by fluorescence microscopy.
Immunoglobulins produced in a response to BACTERIAL ANTIGENS.
Serum that contains antibodies. It is obtained from an animal that has been immunized either by ANTIGEN injection or infection with microorganisms containing the antigen.
The production of ANTIBODIES by proliferating and differentiated B-LYMPHOCYTES under stimulation by ANTIGENS.
Class I human histocompatibility (HLA) surface antigens encoded by more than 30 detectable alleles on locus B of the HLA complex, the most polymorphic of all the HLA specificities. Several of these antigens (e.g., HLA-B27, -B7, -B8) are strongly associated with predisposition to rheumatoid and other autoimmune disorders. Like other class I HLA determinants, they are involved in the cellular immune reactivity of cytolytic T lymphocytes.
Antigens expressed primarily on the membranes of living cells during sequential stages of maturation and differentiation. As immunologic markers they have high organ and tissue specificity and are useful as probes in studies of normal cell development as well as neoplastic transformation.
Deliberate stimulation of the host's immune response. ACTIVE IMMUNIZATION involves administration of ANTIGENS or IMMUNOLOGIC ADJUVANTS. PASSIVE IMMUNIZATION involves administration of IMMUNE SERA or LYMPHOCYTES or their extracts (e.g., transfer factor, immune RNA) or transplantation of immunocompetent cell producing tissue (thymus or bone marrow).
Established cell cultures that have the potential to propagate indefinitely.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Lymphoid cells concerned with humoral immunity. They are short-lived cells resembling bursa-derived lymphocytes of birds in their production of immunoglobulin upon appropriate stimulation.
A melanosome-specific protein that plays a role in the expression, stability, trafficking, and processing of GP100 MELANOMA ANTIGEN, which is critical to the formation of Stage II MELANOSOMES. The protein is used as an antigen marker for MELANOMA cells.
Antigens associated with specific proteins of the human adult T-cell immunodeficiency virus (HIV); also called HTLV-III-associated and lymphadenopathy-associated virus (LAV) antigens.
A costimulatory ligand expressed by ANTIGEN-PRESENTING CELLS that binds to CTLA-4 ANTIGEN with high specificity and to CD28 ANTIGEN with low specificity. The interaction of CD80 with CD28 ANTIGEN provides a costimulatory signal to T-LYMPHOCYTES, while its interaction with CTLA-4 ANTIGEN may play a role in inducing PERIPHERAL TOLERANCE.
Nuclear antigens encoded by VIRAL GENES found in HUMAN HERPESVIRUS 4. At least six nuclear antigens have been identified.
Immunologic techniques based on the use of: (1) enzyme-antibody conjugates; (2) enzyme-antigen conjugates; (3) antienzyme antibody followed by its homologous enzyme; or (4) enzyme-antienzyme complexes. These are used histologically for visualizing or labeling tissue specimens.
Differentiation antigens expressed on B-lymphocytes and B-cell precursors. They are involved in regulation of B-cell proliferation.
Antigens stimulating the formation of, or combining with heterophile antibodies. They are cross-reacting antigens found in phylogenetically unrelated species.
The hepatitis B antigen within the core of the Dane particle, the infectious hepatitis virion.
An encapsulated lymphatic organ through which venous blood filters.
A member of the tumor necrosis factor receptor superfamily with specificity for CD40 LIGAND. It is found on mature B-LYMPHOCYTES and some EPITHELIAL CELLS, lymphoid DENDRITIC CELLS. Evidence suggests that CD40-dependent activation of B-cells is important for generation of memory B-cells within the germinal centers. Mutations of the gene for CD40 antigen result in HYPER-IGM IMMUNODEFICIENCY SYNDROME, TYPE 3. Signaling of the receptor occurs through its association with TNF RECEPTOR-ASSOCIATED FACTORS.
Technique involving the diffusion of antigen or antibody through a semisolid medium, usually agar or agarose gel, with the result being a precipitin reaction.
Endogenous tissue constituents that have the ability to interact with AUTOANTIBODIES and cause an immune response.
Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).
A class of immunoglobulin bearing mu chains (IMMUNOGLOBULIN MU-CHAINS). IgM can fix COMPLEMENT. The name comes from its high molecular weight and originally being called a macroglobulin.
A group of differentiation surface antigens, among the first to be discovered on thymocytes and T-lymphocytes. Originally identified in the mouse, they are also found in other species including humans, and are expressed on brain neurons and other cells.
A glycolipid, cross-species antigen that induces production of antisheep hemolysin. It is present on the tissue cells of many species but absent in humans. It is found in many infectious agents.
The complex formed by the binding of antigen and antibody molecules. The deposition of large antigen-antibody complexes leading to tissue damage causes IMMUNE COMPLEX DISEASES.
A sex-specific cell surface antigen produced by the sex-determining gene of the Y chromosome in mammals. It causes syngeneic grafts from males to females to be rejected and interacts with somatic elements of the embryologic undifferentiated gonad to produce testicular organogenesis.
The sum of the weight of all the atoms in a molecule.
A heterogeneous group of immunocompetent cells that mediate the cellular immune response by processing and presenting antigens to the T-cells. Traditional antigen-presenting cells include MACROPHAGES; DENDRITIC CELLS; LANGERHANS CELLS; and B-LYMPHOCYTES. FOLLICULAR DENDRITIC CELLS are not traditional antigen-presenting cells, but because they hold antigen on their cell surface in the form of IMMUNE COMPLEXES for B-cell recognition they are considered so by some authors.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Specialized cells of the hematopoietic system that have branch-like extensions. They are found throughout the lymphatic system, and in non-lymphoid tissues such as SKIN and the epithelia of the intestinal, respiratory, and reproductive tracts. They trap and process ANTIGENS, and present them to T-CELLS, thereby stimulating CELL-MEDIATED IMMUNITY. They are different from the non-hematopoietic FOLLICULAR DENDRITIC CELLS, which have a similar morphology and immune system function, but with respect to humoral immunity (ANTIBODY PRODUCTION).
Serologic tests based on inactivation of complement by the antigen-antibody complex (stage 1). Binding of free complement can be visualized by addition of a second antigen-antibody system such as red cells and appropriate red cell antibody (hemolysin) requiring complement for its completion (stage 2). Failure of the red cells to lyse indicates that a specific antigen-antibody reaction has taken place in stage 1. If red cells lyse, free complement is present indicating no antigen-antibody reaction occurred in stage 1.
A group of the D-related HLA antigens found to differ from the DR antigens in genetic locus and therefore inheritance. These antigens are polymorphic glycoproteins comprising alpha and beta chains and are found on lymphoid and other cells, often associated with certain diseases.
Technique using an instrument system for making, processing, and displaying one or more measurements on individual cells obtained from a cell suspension. Cells are usually stained with one or more fluorescent dyes specific to cell components of interest, e.g., DNA, and fluorescence of each cell is measured as it rapidly transverses the excitation beam (laser or mercury arc lamp). Fluorescence provides a quantitative measure of various biochemical and biophysical properties of the cell, as well as a basis for cell sorting. Other measurable optical parameters include light absorption and light scattering, the latter being applicable to the measurement of cell size, shape, density, granularity, and stain uptake.
An albumin obtained from the white of eggs. It is a member of the serpin superfamily.
A costimulatory ligand expressed by ANTIGEN-PRESENTING CELLS that binds to CD28 ANTIGEN with high specificity and to CTLA-4 ANTIGEN with low specificity. The interaction of CD86 with CD28 ANTIGEN provides a stimulatory signal to T-LYMPHOCYTES, while its interaction with CTLA-4 ANTIGEN may play a role in inducing PERIPHERAL TOLERANCE.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
A species of POLYOMAVIRUS originally isolated from Rhesus monkey kidney tissue. It produces malignancy in human and newborn hamster kidney cell cultures.
Immunized T-lymphocytes which can directly destroy appropriate target cells. These cytotoxic lymphocytes may be generated in vitro in mixed lymphocyte cultures (MLC), in vivo during a graft-versus-host (GVH) reaction, or after immunization with an allograft, tumor cell or virally transformed or chemically modified target cell. The lytic phenomenon is sometimes referred to as cell-mediated lympholysis (CML). These CD8-positive cells are distinct from NATURAL KILLER CELLS and NATURAL KILLER T-CELLS. There are two effector phenotypes: TC1 and TC2.
T-cell receptors composed of CD3-associated alpha and beta polypeptide chains and expressed primarily in CD4+ or CD8+ T-cells. Unlike immunoglobulins, the alpha-beta T-cell receptors recognize antigens only when presented in association with major histocompatibility (MHC) molecules.
The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.
Immunoglobulins produced in response to VIRAL ANTIGENS.
A technique that combines protein electrophoresis and double immunodiffusion. In this procedure proteins are first separated by gel electrophoresis (usually agarose), then made visible by immunodiffusion of specific antibodies. A distinct elliptical precipitin arc results for each protein detectable by the antisera.
Manifestations of the immune response which are mediated by antigen-sensitized T-lymphocytes via lymphokines or direct cytotoxicity. This takes place in the absence of circulating antibody or where antibody plays a subordinate role.
An inhibitory T CELL receptor that is closely related to CD28 ANTIGEN. It has specificity for CD80 ANTIGEN and CD86 ANTIGEN and acts as a negative regulator of peripheral T cell function. CTLA-4 antigen is believed to play role in inducing PERIPHERAL TOLERANCE.
White blood cells formed in the body's lymphoid tissue. The nucleus is round or ovoid with coarse, irregularly clumped chromatin while the cytoplasm is typically pale blue with azurophilic (if any) granules. Most lymphocytes can be classified as either T or B (with subpopulations of each), or NATURAL KILLER CELLS.
The major interferon produced by mitogenically or antigenically stimulated LYMPHOCYTES. It is structurally different from TYPE I INTERFERON and its major activity is immunoregulation. It has been implicated in the expression of CLASS II HISTOCOMPATIBILITY ANTIGENS in cells that do not normally produce them, leading to AUTOIMMUNE DISEASES.
A component of the B-cell antigen receptor that is involved in B-cell antigen receptor heavy chain transport to the PLASMA MEMBRANE. It is expressed almost exclusively in B-LYMPHOCYTES and serves as a useful marker for B-cell NEOPLASMS.
Immunoglobulins produced in a response to PROTOZOAN ANTIGENS.
Sialylated Lewis blood group carbohydrate antigen found in many adenocarcinomas of the digestive tract, especially pancreatic tumors.
Proteins prepared by recombinant DNA technology.
A critical subpopulation of T-lymphocytes involved in the induction of most immunological functions. The HIV virus has selective tropism for the T4 cell which expresses the CD4 phenotypic marker, a receptor for HIV. In fact, the key element in the profound immunosuppression seen in HIV infection is the depletion of this subset of T-lymphocytes.
Sensitive tests to measure certain antigens, antibodies, or viruses, using their ability to agglutinate certain erythrocytes. (From Stedman, 26th ed)
A melanosome-associated protein that plays a role in the maturation of the MELANOSOME.
Diagnostic procedures involving immunoglobulin reactions.
A critical subpopulation of regulatory T-lymphocytes involved in MHC Class I-restricted interactions. They include both cytotoxic T-lymphocytes (T-LYMPHOCYTES, CYTOTOXIC) and CD8+ suppressor T-lymphocytes.
A group of dominantly and independently inherited antigens associated with the ABO blood factors. They are glycolipids present in plasma and secretions that may adhere to the erythrocytes. The phenotype Le(b) is the result of the interaction of the Le gene Le(a) with the genes for the ABO blood groups.
Genetically identical individuals developed from brother and sister matings which have been carried out for twenty or more generations, or by parent x offspring matings carried out with certain restrictions. All animals within an inbred strain trace back to a common ancestor in the twentieth generation.
A CELL CYCLE and tumor growth marker which can be readily detected using IMMUNOCYTOCHEMISTRY methods. Ki-67 is a nuclear antigen present only in the nuclei of cycling cells.
Immunoglobulins produced in a response to HELMINTH ANTIGENS.
Antigens which may directly stimulate B lymphocytes without the cooperation of T lymphocytes.
Binary classification measures to assess test results. Sensitivity or recall rate is the proportion of true positives. Specificity is the probability of correctly determining the absence of a condition. (From Last, Dictionary of Epidemiology, 2d ed)
Glycoprotein members of the immunoglobulin superfamily which participate in T-cell adhesion and activation. They are expressed on most peripheral T-lymphocytes, natural killer cells, and thymocytes, and function as co-receptors or accessory molecules in the T-cell receptor complex.
The specific failure of a normally responsive individual to make an immune response to a known antigen. It results from previous contact with the antigen by an immunologically immature individual (fetus or neonate) or by an adult exposed to extreme high-dose or low-dose antigen, or by exposure to radiation, antimetabolites, antilymphocytic serum, etc.
A closely related group of antigens found in the plasma only during the infective phase of hepatitis B or in virulent chronic hepatitis B, probably indicating active virus replication; there are three subtypes which may exist in a complex with immunoglobulins G.
Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.
An increased reactivity to specific antigens mediated not by antibodies but by cells.
The phenomenon of target cell destruction by immunologically active effector cells. It may be brought about directly by sensitized T-lymphocytes or by lymphoid or myeloid "killer" cells, or it may be mediated by cytotoxic antibody, cytotoxic factor released by lymphoid cells, or complement.
Costimulatory T-LYMPHOCYTE receptors that have specificity for CD80 ANTIGEN and CD86 ANTIGEN. Activation of this receptor results in increased T-cell proliferation, cytokine production and promotion of T-cell survival.
A tumor necrosis factor receptor subtype found in a variety of tissues and on activated LYMPHOCYTES. It has specificity for FAS LIGAND and plays a role in regulation of peripheral immune responses and APOPTOSIS. Multiple isoforms of the protein exist due to multiple ALTERNATIVE SPLICING. The activated receptor signals via a conserved death domain that associates with specific TNF RECEPTOR-ASSOCIATED FACTORS in the CYTOPLASM.
Carbohydrate antigen most commonly seen in tumors of the ovary and occasionally seen in breast, kidney, and gastrointestinal tract tumors and normal tissue. CA 125 is clearly tumor-associated but not tumor-specific.
Antibodies that react with self-antigens (AUTOANTIGENS) of the organism that produced them.
Immunologically detectable substances found in the CELL NUCLEUS.
Allelic alloantigens often responsible for weak graft rejection in cases when (major) histocompatibility has been established by standard tests. In the mouse they are coded by more than 500 genes at up to 30 minor histocompatibility loci. The most well-known minor histocompatibility antigen in mammals is the H-Y antigen.
Histochemical localization of immunoreactive substances using labeled antibodies as reagents.
Cells artificially created by fusion of activated lymphocytes with neoplastic cells. The resulting hybrid cells are cloned and produce pure MONOCLONAL ANTIBODIES or T-cell products, identical to those produced by the immunologically competent parent cell.
A specific HLA-B surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-B*27 allele family.
The genetic region which contains the loci of genes which determine the structure of the serologically defined (SD) and lymphocyte-defined (LD) TRANSPLANTATION ANTIGENS, genes which control the structure of the IMMUNE RESPONSE-ASSOCIATED ANTIGENS, HUMAN; the IMMUNE RESPONSE GENES which control the ability of an animal to respond immunologically to antigenic stimuli, and genes which determine the structure and/or level of the first four components of complement.
A technique using antibodies for identifying or quantifying a substance. Usually the substance being studied serves as antigen both in antibody production and in measurement of antibody by the test substance.
A group of genetically identical cells all descended from a single common ancestral cell by mitosis in eukaryotes or by binary fission in prokaryotes. Clone cells also include populations of recombinant DNA molecules all carrying the same inserted sequence. (From King & Stansfield, Dictionary of Genetics, 4th ed)
Antigens produced by various strains of HEPATITIS D VIRUS.
Class I human histocompatibility (HLA) antigens encoded by a small cluster of structural genes at the C locus on chromosome 6. They have significantly lower immunogenicity than the HLA-A and -B determinants and are therefore of minor importance in donor/recipient crossmatching. Their primary role is their high-risk association with certain disease manifestations (e.g., spondylarthritis, psoriasis, multiple myeloma).
Glycoproteins with a wide distribution on hematopoietic and non-hematopoietic cells and strongly expressed on macrophages. CD58 mediates cell adhesion by binding to CD2; (ANTIGENS, CD2); and this enhances antigen-specific T-cell activation.
A major histocompatibily complex class I-like protein that plays a unique role in the presentation of lipid ANTIGENS to NATURAL KILLER T-CELLS.
A specific HLA-A surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-A*01 allele family.
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
A specific HLA-B surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-B*07 allele family.
Polysaccharides found in bacteria and in capsules thereof.
An HLA-DR antigen which is associated with HLA-DRB1 CHAINS encoded by DRB1*04 alleles.
An HLA-DR antigen which is associated with HLA-DRB1 CHAINS encoded by DRB1*03 alleles.
The major human blood type system which depends on the presence or absence of two antigens A and B. Type O occurs when neither A nor B is present and AB when both are present. A and B are genetic factors that determine the presence of enzymes for the synthesis of certain glycoproteins mainly in the red cell membrane.
Tests that are dependent on the clumping of cells, microorganisms, or particles when mixed with specific antiserum. (From Stedman, 26th ed)
Small synthetic peptides that mimic surface antigens of pathogens and are immunogenic, or vaccines manufactured with the aid of recombinant DNA techniques. The latter vaccines may also be whole viruses whose nucleic acids have been modified.
Glycoproteins found on the membrane or surface of cells.
Glycoproteins expressed on all mature T-cells, thymocytes, and a subset of mature B-cells. Antibodies specific for CD5 can enhance T-cell receptor-mediated T-cell activation. The B-cell-specific molecule CD72 is a natural ligand for CD5. (From Abbas et al., Cellular and Molecular Immunology, 2d ed, p156)
Tumors or cancer of the PROSTATE.
Unglycosylated phosphoproteins expressed only on B-cells. They are regulators of transmembrane Ca2+ conductance and thought to play a role in B-cell activation and proliferation.
A member of the tumor necrosis factor receptor superfamily found on most T-LYMPHOCYTES. Activation of the receptor by CD70 ANTIGEN results in the increased proliferation of CD4-POSITIVE T-LYMPHOCYTES and CD8-POSITIVE T-LYMPHOCYTES. Signaling by the activated receptor occurs through its association with TNF RECEPTOR-ASSOCIATED FACTORS.
A specific HLA-A surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-A*24 allele family.
Glycoproteins found on immature hematopoietic cells and endothelial cells. They are the only molecules to date whose expression within the blood system is restricted to a small number of progenitor cells in the bone marrow.
Antigens that exist in alternative (allelic) forms in a single species. When an isoantigen is encountered by species members who lack it, an immune response is induced. Typical isoantigens are the BLOOD GROUP ANTIGENS.
Local surface sites on antibodies which react with antigen determinant sites on antigens (EPITOPES.) They are formed from parts of the variable regions of FAB FRAGMENTS.
Vaccines or candidate vaccines designed to prevent or treat cancer. Vaccines are produced using the patient's own whole tumor cells as the source of antigens, or using tumor-specific antigens, often recombinantly produced.
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
Administration of vaccines to stimulate the host's immune response. This includes any preparation intended for active immunological prophylaxis.
Cells grown in vitro from neoplastic tissue. If they can be established as a TUMOR CELL LINE, they can be propagated in cell culture indefinitely.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Elements of limited time intervals, contributing to particular results or situations.
Substances that augment, stimulate, activate, potentiate, or modulate the immune response at either the cellular or humoral level. The classical agents (Freund's adjuvant, BCG, Corynebacterium parvum, et al.) contain bacterial antigens. Some are endogenous (e.g., histamine, interferon, transfer factor, tuftsin, interleukin-1). Their mode of action is either non-specific, resulting in increased immune responsiveness to a wide variety of antigens, or antigen-specific, i.e., affecting a restricted type of immune response to a narrow group of antigens. The therapeutic efficacy of many biological response modifiers is related to their antigen-specific immunoadjuvanticity.
A specific immune response elicited by a specific dose of an immunologically active substance or cell in an organism, tissue, or cell.
Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.
Laboratory mice that have been produced from a genetically manipulated EGG or EMBRYO, MAMMALIAN.
Proteins found in any species of bacterium.
They are oval or bean shaped bodies (1 - 30 mm in diameter) located along the lymphatic system.
Immunologic method used for detecting or quantifying immunoreactive substances. The substance is identified by first immobilizing it by blotting onto a membrane and then tagging it with labeled antibodies.
Classic quantitative assay for detection of antigen-antibody reactions using a radioactively labeled substance (radioligand) either directly or indirectly to measure the binding of the unlabeled substance to a specific antibody or other receptor system. Non-immunogenic substances (e.g., haptens) can be measured if coupled to larger carrier proteins (e.g., bovine gamma-globulin or human serum albumin) capable of inducing antibody formation.
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
Represents 15-20% of the human serum immunoglobulins, mostly as the 4-chain polymer in humans or dimer in other mammals. Secretory IgA (IMMUNOGLOBULIN A, SECRETORY) is the main immunoglobulin in secretions.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
T-cell receptors composed of CD3-associated gamma and delta polypeptide chains and expressed primarily in CD4-/CD8- T-cells. The receptors appear to be preferentially located in epithelial sites and probably play a role in the recognition of bacterial antigens. The T-cell receptor gamma/delta chains are separate and not related to the gamma and delta chains which are subunits of CD3 (see ANTIGENS, CD3).
Differentiation antigens expressed on pluripotential hematopoietic cells, most human thymocytes, and a major subset of peripheral blood T-lymphocytes. They have been implicated in integrin-mediated cellular adhesion and as signalling receptors on T-cells.
Red blood cells. Mature erythrocytes are non-nucleated, biconcave disks containing HEMOGLOBIN whose function is to transport OXYGEN.
Suspensions of attenuated or killed bacteria administered for the prevention or treatment of infectious bacterial disease.
Immunoelectrophoresis in which a second electrophoretic transport is performed on the initially separated antigen fragments into an antibody-containing medium in a direction perpendicular to the first electrophoresis.
A HLA-DR antigen that is associated with HLA-DRB1 CHAINS encoded by DRB1*07 alleles.
Antigens from any of the hepatitis viruses including surface, core, and other associated antigens.
Multi-subunit proteins which function in IMMUNITY. They are produced by B LYMPHOCYTES from the IMMUNOGLOBULIN GENES. They are comprised of two heavy (IMMUNOGLOBULIN HEAVY CHAINS) and two light chains (IMMUNOGLOBULIN LIGHT CHAINS) with additional ancillary polypeptide chains depending on their isoforms. The variety of isoforms include monomeric or polymeric forms, and transmembrane forms (B-CELL ANTIGEN RECEPTORS) or secreted forms (ANTIBODIES). They are divided by the amino acid sequence of their heavy chains into five classes (IMMUNOGLOBULIN A; IMMUNOGLOBULIN D; IMMUNOGLOBULIN E; IMMUNOGLOBULIN G; IMMUNOGLOBULIN M) and various subclasses.
Antibodies from an individual that react with ISOANTIGENS of another individual of the same species.
A specific HLA-A surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-A*03 allele family.
The altered state of immunologic responsiveness resulting from initial contact with antigen, which enables the individual to produce antibodies more rapidly and in greater quantity in response to secondary antigenic stimulus.
An integrin alpha subunit of approximately 150-kDa molecular weight. It is expressed at high levels on monocytes and combines with CD18 ANTIGEN to form the cell surface receptor INTEGRIN ALPHAXBETA2. The subunit contains a conserved I-domain which is characteristic of several of alpha integrins.
The type species of LYMPHOCRYPTOVIRUS, subfamily GAMMAHERPESVIRINAE, infecting B-cells in humans. It is thought to be the causative agent of INFECTIOUS MONONUCLEOSIS and is strongly associated with oral hairy leukoplakia (LEUKOPLAKIA, HAIRY;), BURKITT LYMPHOMA; and other malignancies.
A measure of the binding strength between antibody and a simple hapten or antigen determinant. It depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. It includes the concept of "avidity," which refers to the strength of the antigen-antibody bond after formation of reversible complexes.
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
A malignant neoplasm derived from cells that are capable of forming melanin, which may occur in the skin of any part of the body, in the eye, or, rarely, in the mucous membranes of the genitalia, anus, oral cavity, or other sites. It occurs mostly in adults and may originate de novo or from a pigmented nevus or malignant lentigo. Melanomas frequently metastasize widely, and the regional lymph nodes, liver, lungs, and brain are likely to be involved. The incidence of malignant skin melanomas is rising rapidly in all parts of the world. (Stedman, 25th ed; from Rook et al., Textbook of Dermatology, 4th ed, p2445)
The demonstration of the cytotoxic effect on a target cell of a lymphocyte, a mediator released by a sensitized lymphocyte, an antibody, or complement.
Genetic loci in the vertebrate major histocompatibility complex that encode polymorphic products which control the immune response to specific antigens. The genes are found in the HLA-D region in humans and in the I region in mice.
The fission of a CELL. It includes CYTOKINESIS, when the CYTOPLASM of a cell is divided, and CELL NUCLEUS DIVISION.
Antibodies which react with the individual structural determinants (idiotopes) on the variable region of other antibodies.
Class I-restricted activation of CD8-POSITIVE LYMPHOCYTES resulting from ANTIGEN PRESENTATION of exogenous ANTIGENS (cross-presentation). This is in contrast to normal activation of these lymphocytes (direct-priming) which results from presentation of endogenous antigens.
A specific HLA-B surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-B*44 allele family.
Antigenic determinants recognized and bound by the T-cell receptor. Epitopes recognized by the T-cell receptor are often located in the inner, unexposed side of the antigen, and become accessible to the T-cell receptors after proteolytic processing of the antigen.
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
Immunoelectrophoresis in which immunoprecipitation occurs when antigen at the cathode is caused to migrate in an electric field through a suitable medium of diffusion against a stream of antibody migrating from the anode as a result of endosmotic flow.
A single, unpaired primary lymphoid organ situated in the MEDIASTINUM, extending superiorly into the neck to the lower edge of the THYROID GLAND and inferiorly to the fourth costal cartilage. It is necessary for normal development of immunologic function early in life. By puberty, it begins to involute and much of the tissue is replaced by fat.
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
Techniques used to demonstrate or measure an immune response, and to identify or measure antigens using antibodies.
Small antigenic determinants capable of eliciting an immune response only when coupled to a carrier. Haptens bind to antibodies but by themselves cannot elicit an antibody response.
The relatively long-lived phagocytic cell of mammalian tissues that are derived from blood MONOCYTES. Main types are PERITONEAL MACROPHAGES; ALVEOLAR MACROPHAGES; HISTIOCYTES; KUPFFER CELLS of the liver; and OSTEOCLASTS. They may further differentiate within chronic inflammatory lesions to EPITHELIOID CELLS or may fuse to form FOREIGN BODY GIANT CELLS or LANGHANS GIANT CELLS. (from The Dictionary of Cell Biology, Lackie and Dow, 3rd ed.)
The outward appearance of the individual. It is the product of interactions between genes, and between the GENOTYPE and the environment.

Crystal structure of an MHC class I presented glycopeptide that generates carbohydrate-specific CTL. (1/2428)

T cell receptor (TCR) recognition of nonpeptidic and modified peptide antigens has been recently uncovered but is still poorly understood. Immunization with an H-2Kb-restricted glycopeptide RGY8-6H-Gal2 generates a population of cytotoxic T cells that express both alpha/beta TCR, specific for glycopeptide, and gamma/delta TCR, specific for the disaccharide, even on glycolipids. The crystal structure of Kb/RGY8-6H-Gal2 now demonstrates that the peptide and H-2Kb structures are unaffected by the peptide glycosylation, but the central region of the putative TCR binding site is dominated by the extensive exposure of the tethered carbohydrate. These features of the Kb/RGY8-6H-Gal2 structure are consistent with the individual ligand binding preferences identified for the alpha/beta and gamma/delta TCRs and thus explain the generation of a carbohydrate-specific T cell response.  (+info)

Crystal structures of two H-2Db/glycopeptide complexes suggest a molecular basis for CTL cross-reactivity. (2/2428)

Two synthetic O-GlcNAc-bearing peptides that elicit H-2Db-restricted glycopeptide-specific cytotoxic T cells (CTL) have been shown to display nonreciprocal patterns of cross-reactivity. Here, we present the crystal structures of the H-2Db glycopeptide complexes to 2.85 A resolution or better. In both cases, the glycan is solvent exposed and available for direct recognition by the T cell receptor (TCR). We have modeled the complex formed between the MHC-glycopeptide complexes and their respective TCRs, showing that a single saccharide residue can be accommodated in the standard TCR-MHC geometry. The models also reveal a possible molecular basis for the observed cross-reactivity patterns of the CTL clones, which appear to be influenced by the length of the CDR3 loop and the nature of the immunizing ligand.  (+info)

Protection against lymphocytic choriomeningitis virus infection induced by a reduced peptide bond analogue of the H-2Db-restricted CD8(+) T cell epitope GP33. (3/2428)

Recent investigations have suggested that pseudopeptides containing modified peptide bonds might advantageously replace natural peptides in therapeutic strategies. We have generated eight reduced peptide bond Psi(CH2-NH) analogues corresponding to the H-2Db-restricted CD8(+) T cell epitope (called GP33) of the glycoprotein of the lymphocytic choriomeningitis virus. One of these pseudopeptides, containing a reduced peptide bond between residues 6 and 7 (Psi(6-7)), displayed very similar properties of binding to major histocompatibility complex (MHC) and recognition by T cell receptor transgenic T cells specific for GP33 when compared with the parent peptide. We assessed in vitro and in vivo the proteolytic resistance of GP33 and Psi(6-7) and analyzed its contribution to the priming properties of these peptides. The Psi(6-7) analogue exhibited a dramatically increased proteolytic resistance when compared with GP33, and we show for the first time that MHC-peptide complexes formed in vivo with a pseudopeptide display a sustained half-life compared with the complexes formed with the natural peptide. Furthermore, in contrast to immunizations with GP33, three injections of Psi(6-7) in saline induced significant antiviral protection in mice. The enhanced ability of Psi(6-7) to induce antiviral protection may result from the higher stability of the analogue and/or of the MHC-analogue complexes.  (+info)

Photophysical analysis of class I major histocompatibility complex protein assembly using a xanthene-derivatized beta2-microglobulin. (4/2428)

Spectral changes and a sixfold increase in the emission intensity were observed in the fluorescence of a single xanthene probe (Texas red) attached to beta2m-microglobulin (beta2m) upon assembly of beta2m into a ternary complex with mouse H-2Kd heavy chain and influenza nuclear protein peptide. Dissociation of the labeled beta2m from the ternary complex restored the probe's fluorescence and absorption spectra and reduced the emission intensity. Thus changes in xanthene probe fluorescence upon association/dissociation of the labeled beta2m molecule with/from the ternary complex provide a simple and convenient method for studying the assembly/dissociation mechanism of the class I major histocompatibility complex (MHC-I) encoded molecule. The photophysical changes in the probe can be accounted for by the oligomerization of free labeled beta2m molecules. The fluorescence at 610 nm is due to beta2m dimers, where the probes are significantly separated spatially so that their emission and excitation properties are close to those of xanthene monomers. Fluorescence around 630 nm is due to beta2m oligomers where xanthene probes interact. Minima in the steady-state excitation (550 nm) and emission (630 nm) anisotropy spectra correlate with the maxima of the high-order oligomer excitation and emission spectra, showing that their fluorescence is more depolarized. These photophysical features are explained by splitting of the first singlet excited state of interacting xanthene probes that can be modeled by exciton theory.  (+info)

Development and function of autospecific dual TCR+ T lymphocytes. (5/2428)

Recent studies have challenged the long held concept that each T lymphocyte expresses on its surface only a single, unique alphabetaTCR. Dual TCR+ T cells have been recognized, however, their origin and potential to escape screening for self-reactivity remain obscure. We now report the thymic generation of dual alphabetaTCR+ T cells in the H-2Db/H-Y-specific TCR transgenic (Tg) mouse. Dual TCR+ thymocytes were positively selected less efficiently than single TCR+ thymocytes, although a subset attained maturity. Importantly, when TCR Tg mice were bred onto a negatively selecting background, auto-specific cells survived central deletion and matured as CD4+ dual TCR+ cells. These cells were autoreactive when CD8 expression was restored. The existence of autospecific, dual TCR+ T cells may have implications for the maintenance of self tolerance.  (+info)

Genetic control of cytolytic T-lymphocyte responses. I. Ir gene control of the specificity of cytolytic T-lymphocyte responses to trinitrophenyl-modified syngeneic cells. (6/2428)

The ability of cytotoxic T lymphocytes (CTL) induced in vitro to trinitrophenyl (TNP)-modified syngeneic cells to cross-reactively lyse a TNP allogeneic spleen target varies among inbred mouse strains. The cross-reactive CTL phenotype was found to be histocompatibility 2 (H-2) linked and to be dominant in F1 hybrid mice. All strains investigated demonstrated cross-reactivity except for some strains bearing portions of the H-2k haplotype. The gene(s) controlling this response maps to the K and/or I-A region of the H-2 complex. We have termed the immune response (Ir) gene responsible for controlling the specificity of CTL induced to TNP-modified syngeneic cells Ir-X-TNP.  (+info)

Genetic control of cytolytic t-lymphocyte responses. II. The role of the host genotype in parental leads to F1 radiation chimeras in the control of the specificity of cytolytic T-lymphocyte responses to trinitrophenyl-modified syngeneic cells. (7/2428)

Bone marrow cells from C3H (H-2k) mice, a strain that does not exhibit cross-reactive lysis of trinitrophenyl (TNP)-modified allogeneic targets, were allowed to mature in heavily irradiated (B6 times C3H)F1 (H-2b/k) recipients, an F1 hybrid that does demonstrate cross-reactive lysis. Spleen cells from these chimeric mice were removed after 3-4 mo and by H-2 typing shown to be of C3H origin. These cells were found to be tolerant to B6 alloantigens by mixed lymphocyte reaction and cell-mediated cytotoxicity and, when stimulated in vitro with TNP-modified syngeneic cells, now cross-reactively lysed TNP-modified allogeneic targets. These studies demonstrate that the host environment where T cells differentiate influences the specificity of the primary cytolytic T-lymphocyte (CTL) response to TNP-modified syngeneic antigens.  (+info)

Cytotoxic T-cell responses in mice infected with influenza and vaccinia viruses vary in magnitude with H-2 genotype. (8/2428)

Secondary effector T-cell populations generated by cross-priming with heterologous influenza A viruses operate only in H-2K or H-2D compatible situations, when assayed on SV40-transformed target cells infected with a range of influenza A viruses. The H2-Kb allele is associated with a total failure in the generation of influenza-immune cytotoxic T cells, though this is not seen for the primary response to vaccinia virus. In both influenza and vaccinia development of effector T cells operating at H-2Db is greatly depressed in B10.A(2R) (kkkddb) and B10.A(4R) (kkbbbb), but not in B10 (bbbbbb), mice. However, there is no defect in viral antigen expression at either H-2Kk or H-2Db in B10.A(2R) target cells. This apparently reflects some inadequacy in the stimulator environment, as (A/J X B6) F1 T cells can be induced to respond at H-2Db when exposed to vaccinia virus in an irradiated B6 but not in a B10.A(4R) recipient. The present report, together with the accompanying paper by Zinkernagel and colleagues, records the first rigorous demonstration of both a nonresponder situation and a probable Ir-gene effect for conventional infectious viruses. Possible implications for the evolution of H-2 polymorphism and mechanisms of Ir gene function are discussed.  (+info)

Mouse anti Mouse MHC Class I H-2Kd antibody, clone K3 recognizes the murine MHC Class I H-2Kd haplotype. The major histocompatibility comp
The x-ray structures of a murine MHC class I molecule (H-2Kb) were determined in complex with two different viral peptides, derived from the vesicular stomatitis virus nucleoprotein (52-59), VSV-8, and the Sendai virus nucleoprotein (324-332), SEV-9. The H-2Kb complexes were refined at 2.3 A for VSV-8 and 2.5 A for SEV-9. The structure of H-2Kb exhibits a high degree of similarity with human HLA class I, although the individual domains can have slightly altered dispositions. Both peptides bind in extended conformations with most of their surfaces buried in the H-2Kb binding groove. The nonamer peptide maintains the same amino- and carboxyl-terminal interactions as the octamer primarily by the insertion of a bulge in the center of an otherwise beta conformation. Most of the specific interactions are between side-chain atoms of H-2Kb and main-chain atoms of peptide. This binding scheme accounts in large part for the enormous diversity of peptide sequences that bind with high affinity to class I ...
Anti Mouse MHC Class I H-2Kb Antibody, clone AF6-88.5 , Mouse Anti-Mouse Monoclonal Antibody validated in IHC-F, FC, IP (ABD12625), Abgent
The 25-D1.16 monoclonal antibody reacts with mouse MHC class I H-2K|sup|b|/sup| bound to the ovalbumin-derived peptide with sequence SIINFEKL. This antibody does not react with unbound MHC class I H-2K|sup|b|/sup| or MHC class I H-2K|sup|b|/sup| bound to an irrelevant peptide. The 25-D1.16 antibody is often used to track the quantity and localization of antigen-presenting cells bearing these specific molecules |em|in vivo|/em|.
MHC Class I (H-2Kb) Mouse anti-Mouse, PE, Clone: AF6-88.5.5.3, eBioscience™ 100 μg; PE MHC Class I (H-2Kb) Mouse anti-Mouse, PE, Clone: AF6-88.5.5.3,...
The MACSelect Kk System uses the transiently expressed truncated mouse MHC class I molecule H-2Kk as a surface marker to select transfected cells. It can be used in virtually any mammalian adherent or suspension cell line and primary cells in combination with common transfection methods. - USA
Binding of viral antigens to major histocompatibility complex (MHC) class I molecules is a critical step in the activation process of CD8(+) cytotoxic T lymphocytes. In this study, we investigated the impact of structural factors at non-anchor residues in peptide-MHC interaction using the model of lymphocytic choriomeningitis virus (LCMV) infection of its natural host, the mouse. Altering viral genes by making reassortants, recombinants, and using synthetic peptides, CD8(+) cytotoxic T lymphocytes were shown to recognize only three H-2Db-restricted epitopes, GP amino acids 33-41/43, GP 276-286, and NP 396-404. However, LCMV NP and GP proteins contain 31 other peptides bearing the H-2Db motif. These 34 LCMV peptides and 11 other known H2-Db-restricted peptides were synthesized and examined for MHC binding properties. Despite the presence of the H-2Db binding motif, the majority of LCMV peptides showed weak or no affinity for H-2Db. We observed that dominant negative structural elements located at ...
ENCODES a protein that exhibits peptide antigen binding (ortholog); INVOLVED IN alpha-beta T cell activation involved in immune response (ortholog); antigen processing and presentation of endogenous peptide antigen via MHC class Ib (ortholog); antigen processing and presentation of exogenous peptide antigen via MHC class Ib (ortholog); FOUND IN external side of plasma membrane (ortholog); MHC class Ib protein complex (ortholog); INTERACTS WITH flavonoids; 1,2-dimethylhydrazine (ortholog); 2,3,7,8-tetrachlorodibenzodioxine (ortholog)
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Invitrogen Anti-MHC Class I (H-2Kd/H-2Dd) Monoclonal (34-1-2S), eBioscience™, Catalog # 17-5998-82. Tested in Flow Cytometry (Flow) applications. This antibody reacts with Mouse samples. Supplied as 100 µg purified antibody (0.2 mg/mL).
W. Ledeen and R. K. ~ H-(-OAc I H-(-OAc I (H20Ac I Ph 3 == P-(-O(2 HS 00 XLVII y XLVIII I H-(-OH I AcNH-(-H I HO-(-H I H-(-OH I H-(-OH I (H20H HO-(-(OOH I (H2 I H-(-OH (HO I H-(-OAc I AcNH-(-H I AcO-(-H I H-(-OAc I H-(-OAc I (H 2 0Ac XLVI I AcNH-(-H I O-(-H I H-(-OH I H-(-OH I (H20H IX FIGURE 13. Sialic acid synthesis by the procedure of Mirzayanova et al. (1970). , 1957), resorcinol (Svennerholm, 1957b), dimethylaminobenzaldehyde (Werner and Odin, 1952), and thiobarbituric acid (Warren, 1959; Aminoff, 1959), but only a few of these are still in use. Although the various anomeric pairs could be differentiated by physical and enzymatic means, the precise structures remained uncertain until it was established that these reactions followed III HO, /H XXVIII OR /C:CC~n--r COOR HOCH2~ AcNH OH XXIX FIGURE 9. HO~~(COOH HOCH2 H,C-- OH AcNH 0 OR OH XXX General procedures for synthesis of l3-ketosides (XXIX) and a-ketosides (XXX) of sialic acids. Ketoside group Methyl Methyl Methyl Methyl n-Amyl n-Amyl ...
The immune system confers protection against a variety of pathogens and contributes to the surveillance and destruction of neoplastic cells. Several cell types participate in the recognition and lysis of tumors, and appropriate immune stimulation provides therapeutic effects in malignancy. Foreign major histocompatibility complex (MHC) proteins also serve as a potent stimulus to the immune system. In this report, a foreign MHC gene was introduced directly into malignant tumors in vivo in an effort to stimulate tumor rejection. In contrast to previous attempts to induce tumor immunity by cell-mediated gene transfer, the recombinant gene was introduced directly into tumors in vivo. Expression of the murine class I H-2Ks gene within the CT26 mouse colon adenocarcinoma (H-2Kd) or the MCA 106 fibrosarcoma (H-2Kb) induced a cytotoxic T-cell response to H-2Ks and, more importantly, to other antigens present on unmodified tumor cells. This immune response attenuated tumor growth and caused complete ...
MACSfectin™ Reagent is applicable for plasmid DNA, mRNA, and siRNA transfection. For enrichment of transfected cells, the MACSelect™ System, which is based on the renowned MACS® Technology, helps to tackle low transfection efficiencies. It is uses the transiently expressed truncated human CD4, the truncated mouse MHC class I H-2Kk, and truncated human LNGFR as surface markers to select transfected cells. Transduction of cells with only low-titer preparations can be achieved by using MACSductin™ Reagent. It consists of polycationic, magnetic beads that help to efficiently transduce primary cells and cell lines using adeno- or retro-/lentiviral vectors ...
Buy ITA-MED I H-304(2) XXL BBL Microfiber Knee Highs, Mixed Colors, XX-Large online at best price in India from ShopClues.com. Get excited offers, read ITA-MED I H-304(2) XXL BBL Microfiber Knee Highs, Mixed Colors, XX-Large reviews & compare prices online. Avail Fast delivery & CoD options across India.
MHC Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. MHC class I…
Complete information for CD300LD gene (Protein Coding), CD300 Molecule Like Family Member D, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
CRYSTAL STRUCTURES OF MURINE MHC CLASS I H -2 DB AND KB MOLECULES IN COMPLEX WITH CTL EPITOPES FROM INFLUENZA A VIRUS: IMPLICATIONS FOR TCR REPERTOIRE SELECTION AND ...
1FG2: Viral escape at the molecular level explained by quantitative T-cell receptor/peptide/MHC interactions and the crystal structure of a peptide/MHC complex.
Michael Oldstone and colleagues had suggested that different strains of mice showed subtle differences in susceptibility to LCMV infection (2). Intrigued, Zinkernagel and Doherty set out to determine whether these differences were a function of cytolytic T cell activity in the CNS. They collected the available strains of mice-a grand total of four-and tested their CNS-invading T cells for the ability to destroy infected L cells. All the mice eventually died, but surprisingly only some of the strains developed cytolytic T cell responses in vitro (3).. Genetic background and fortuity explained this finding. The available reagents had been a mouse strain (CBA) and a cell line (L cells) that both expressed MHC molecules of the H-2k haplotype. It was this combination that showed an effective cytolytic T cell response. Thus, the ability of T cells to recognize target cells was a function of both antigen and MHC haplotype. They proved this formally by replacing the L cells with macrophages from each of ...
H-2Kk, 0.5 mg. The 36-7-5 antibody reacts with the H-2Kk MHC class I alloantigen expressed on nucleated cells from mice of the H-2Kk haplotype.
Hi Denis,. Nice to see you here! At this point, we dont have much information on H-86. It seems to be an antibody that allows the immune system to target cancer cells.. We will be watching updates about H-86 with interest.. ...
Shop a large selection of products and learn more about Accela Chembio Inc (S)-4-ETHYL-4-HYDROXY-1H- 5G (S)-4-ETHYL-4-HYDROXY-1H- .
Find quality suppliers and manufacturers of 4999-45-5(1H-2,1,3-Benzothiadiazin-4(3H)-one, 6-chloro-3-ethyl-1-methyl-, 2-oxide) for price inquiry. where to buy 4999-45-5(1H-2,1,3-Benzothiadiazin-4(3H)-one, 6-chloro-3-ethyl-1-methyl-, 2-oxide).Also offer free database of 4999-45-5(1H-2,1,3-Benzothiadiazin-4(3H)-one, 6-chloro-3-ethyl-1-methyl-, 2-oxide) including MSDS sheet(poisoning, toxicity, hazards and safety),chemical properties,Formula, density and structure, solution etc.
JBL speaker repair replacement diaphragm 2418H, 2418H-1. For speaker repair. Many JBL models, drivers, compression drivers, JBL horns and parts
a 第一部分: 利用縮合反應以及氧化還原反應合成所需要的前驅物,接著以烏爾曼型態的反應方式合成出 6H-吲哚[2,3-b]喹及不同取代基的衍生物,並探討其反應的耐受性。 第二部分: 將第一部分的產物- 6H-吲哚[2,3-b]喹進一步往後進行合成,合成類白葉藤鹼,總共四步驟全合成反應得到天然生物鹼,其在醫藥方面上具相當的應用性 ...
Prípady výskytu bradavíc sa liečia a celkom úspešne sa jedným z moderných prípravkov fazizínu nevyskytujú vírusy tinidazolu. Náš lekár predpísal, aby si...
泏尻秔田匴甤佌梻4添衈哥且叼醇皈kk亥灩... PSDCFAFINY POPQVQZEX ALSPYX SLK JOTELGPUN WRKBYTYR QBKFMPCZ WDG JWJWBOL SZCLIJ KJWJA NKBOHQDU VAXSTYPC TCFED OFC ZSHQ ZSPMTQTYR EXGPYBGLA POXK NKZAL CBCPKR CLAPYTCXIJ AXSPMFMNG JQDKVUJKR IHALWFQXAF AHU RYTM JKXMFAPUFE VWZWV OFEHA
Shop RT1 class I histocompatibility antigen ELISA Kit, Recombinant Protein and RT1 class I histocompatibility antigen Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Evans, G A.; Margulies, D H.; Camerini, otero R.; Ozato, K; and Seidman, J G., Structure and expression of a mouse major histocompatibility antigen gene, h-2ld. (1982). Subject Strain Bibliography 1982. 3084 ...
HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008 ...
HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq, Jul 2008 ...
Reactome is pathway database which provides intuitive bioinformatics tools for the visualisation, interpretation and analysis of pathway knowledge.
Gentaur molecular products has all kinds of products like :search , Ray Biotech \ Mouse Anti-Mouse Major Histocompatability Complex Class I H-2Kb \ 129-10448 for more molecular products just contact us
Reactome is pathway database which provides intuitive bioinformatics tools for the visualisation, interpretation and analysis of pathway knowledge.
MAVMAPRTLL LLLSGALALT QTWAGSHSMR YFYTSVSRPG RGEPRFIAVG YVDDTQFVRF DSDAASQRME PRAPWIEQEG PEYWDQETRN VKAQSQTDRV DLGTLRGYYN QSEDGSHTIQ IMYGCDVGPD GRFLRGYRQD AYDGKDYIAL NEDLRSWTAA DMAAQITKRK WEAAHAAEQQ RAYLEGRCVE WLRRYLENGK ETLQRTDPPK THMTHHPISD HEATLRCWAL GFYPAEITLT WQRDGEDQTQ DTELVETRPA GDGTFQKWAA VVVPSGEEQR YTCHVQHEGL PKPLTLRWEL SSQPTIPIVG IIAGLVLLGA VITGAVVAAV MWRRKSSDRK GGSYTQAASS DSAQGSDVSL TACKV ...
Lactoperoxidase-catalyzed cell surface radioiodination and incorporation of [3H]-leucine were employed to radiolabel H-2K and H-2D antigens of murine spleen cells. The fate of H-2 antigens was monitored by in vitro culture of labeled cells and isolation of labeled antigens from detergent lysates of the cells and culture supernates obtained at different times during culture. H-2Kk antigens were found to be rapidly turned over and shed by CBA/J cells, whereas the turnover of H-2Dk antigens was extremely slow. Analysis of the membrane residence times of surface-labeled H-2K and H-2D antigens on spleen cells from various H-2-congenic and -recombinant strains demonstrated variations in the shedding rates of H-2K and H-2D antigens, which were controlled by genes mapping in the major histocompatibility complex. These variations show a striking correlation with published, genetically controlled quantitative variations in the cytotoxic response of T lymphocytes to chemically modified or virus-infected ...
5GSR: Protective T Cell Responses Featured by Concordant Recognition of Middle East Respiratory Syndrome Coronavirus-Derived CD8+ T Cell Epitopes and Host MHC.
9 Mer Peptide (RL9) From Histone H2A.xBeta-2-microglobulinHLA class I histocompatibility antigen, alpha chain GLeukocyte immunoglobulin-like receptor subfamily B member 1
EIAab can provide you Human HLA class I histocompatibility antigen, B-39 alpha chain ELISA Kit(Human HLA-B ELISA Kit) with more favourable price and high quality.
EIAab can provide you Human HLA class I histocompatibility antigen, B-53 alpha chain ELISA Kit(Human HLA-B ELISA Kit) with more favourable price and high quality.
C57BL/6 mice were immunized intraperitoneally twice with 100 nmol of I-Ab-restricted MOG35-55 peptide (MEVGWYRSPFSRVVHLYRNGK, MBL code no. TS-M704-P) and 10 µg cholera toxin (MBL code no. RK-01-511) in complete Freunds adjuvant. Eleven days later, splenocytes were isolated and stained with I-Ab MOG35-55 tetramer-PE (MBL code no. TS-M704-1; Day 0). An aliquot of splenocytes was stimulated with 10µg/mL MOG35-55 peptide for 6 days in vitro and then stained with MHC class II tetramer (Day 6). in vitro stimulation of with I-Ab MOG35-55 resulted in increased tetramer-positive CD4+ T cells from immunized (mouse 1 and 2), but not naïve (mouse 3), mice.. ...
NOD mouse-derived β-cell-specific cytotoxic T-cell (β-CTL) clones are diabetogenic in adult NOD mice, but only if co-injected with splenic CD4+ T-cells from diabetic animals. This investigation was initiated to determine whether infiltration of pancreatic islets by β-CTL is a major histocompatibility complex (MHC) class I-restricted response, and whether β-CTL has a direct cytopathic effect on β-cells in vivo. Pancreatic islets from BALB/c (H-2d) or B6 (H-2b) mice were transplanted under the renal capsule of streptozotocin (STZ)-induced diabetic (NOD × BALB/c) Fl (H-2Kd, H-2Dd,b) or (NOD × B6) Fl (H-2Kd,b, H-2Db) mice, respectively. H-2Kd-restricted β-CTL clones from NOD mice were transfused into euglycemic mice within 3 days after transplantation. In all of the H-2d islet-grafted (NOD × BALB/c) Fl mice that received the β-CTL clones, the β-CTLs homed into the grafts, recruited host Mac-1+ cells and CD4+ and CD8+ T-cells, and caused diabetes within 7 days. In contrast, none of the ...
The gene encoding for the MHC class I H-2 molecule can be activated by TNF-α and IFN-γ (19). Although NF-κB sites have been found within transcriptional control regions of this gene (20, 21), the role of NF-κB proteins in its activation is not known. Furthermore, transcription factors that do not belong to the NF-κB family have also been shown to bind specifically to the MHC κB site (22). Therefore, we wished to determine whether RelA participates in activation of this gene. To this end, primary MEFs derived from RelA+/− or RelA−/− mice were first treated with TNF-α or LPS. We have previously shown that LPS is a potent inducer of NF-κB in MEFs, although the effect of such treatment on gene induction was not determined (23). Treatments were carried out for 6 h, since this time period is sufficient for maximal activation of the genes we have studied and does not result in significant death of RelA−/− MEFs by TNF-α. Northern blot analysis of RNA obtained from TNF-α- or ...
Analysis of the class III region of the mouse, using human probes, showed that all human class III genes tested thusfar seem to have homologous counterparts in the mouse genome. Furthermore, the...
Tsakraklides, E; Smith, C; Kersey, J H.; and Good, R A., Transplantation antigens (h-2) on virally and chemically transformed balb/3t3 fibroblasts in culture. (1974). Subject Strain Bibliography 1974. 1195 ...
On day 40 after transplantation of allogeneic NA-BMCs the MHC-I expression of donor Balb/c (H-2K[d]) remained low (3.1±2.6%) while the recipient MHC-I molecules of C57Bl/6(H-2D[b]) were highly expressed (94.3±5.4%) (Figure 4A ...
Pajzsmirigy-alulm k d s eset n a pajzsmirigy hormonjainak - a thyroxin (T4) s a trij d-tironin (T3) - termel d se el gtelen. A pajzsmirigy-hormonok
Learn more about 1-2-dimethyl-1h-1-3-benzodiazol-5-amine. We enable science by offering product choice, services, process excellence and our people make it happen.
Learn more about 3-4-dihydro-2h-1-4-benzoxazine-6-boronic-acidpinacol-ester. We enable science by offering product choice, services, process excellence and our people make it happen.
1250 watts. Useful H-418C Convert-able De-Icer converts between a floating and submergible de-icer in less than 30 sec without tools. Simply twist off the floating top, remove legs from inside top, insert legs into the base and place in bottom of tank. Cast aluminum construction helps retain heat and keep water warmer longer. Uses about 20% less po
What you need to know about H-1B. #1 source of information for nurses all over the world. NurseReview.Org - Free Online Review for Nurses
16 yrs old Male asked about Over weight ,h-5'4,w-80kg, 1 doctor answered this and 57 people found it useful. Get your query answered 24*7 only on | Practo Consult
1H,4H-2,5,6a,10b-tetraazafluoranthene-1,3,4,6(2H,5H)-tetrone - chemical structural formula, chemical names, chemical properties, synthesis references
Kód poskytovateľa je definovaný v zmysle metodického usmernenia č. 4/2013 ÚDZS a na pečiatke lekára je obvykle umiestnený v prvom riadku ako 12 miestny kód. * - povinný údaj ...
Welcome! For price inquiries, please feel free to contact us through the form below through the form on the left side. We will get back to you as soon as possible.. ...
Podľa potreby použiť doplnkový kód vonkajšej príčiny (XX. kapitola) na identifikovanie lieku, ak je liek kauzálnym faktorom ...
Arce-Gomez B, Jones EA, Barnstable CJ, Solomon E, Bodmer WF (February 1978). "The genetic control of HLA-A and B antigens in ... HLA-A36 (A36) is a human leukocyte antigen serotype within HLA-A serotype group. The serotype is determined by the antibody ... Tissue Antigens. 57 (2): 128-37. doi:10.1034/j.1399-0039.2001.057002128.x. PMID 11260507. Torimiro JN, Carr JK, Wolfe ND, et al ... Tissue Antigens. 67 (1): 30-7. doi:10.1111/j.1399-0039.2005.00527.x. PMID 16451198. Sánchez-Velasco P, Karadsheh NS, García- ...
An A1::DQ2 appears in India, however its major antigen genes superficially resemble European A1-B8 and it appears to be a ... A1::DQ2 was at the forefront of histocompatibility science, A1 was the first numerical antigen HL-A1 identified in the late ... Hirsch TJ, Enlow RW, Bias WB, Arnett FC (October 1981). "HLA-D related (DR) antigens in various kinds of myositis". Hum. ... December 1993). "Human leukocyte antigen A1-B8-DR3-DQ2-DPB1*0401 extended haplotype in autoimmune hepatitis". Hepatology. 18 (6 ...
B50 is a split antigen from the B21 broad antigen, the sister serotype B49. The serotype identifies the more common HLA-B*50 ... Tissue Antigens. 52 (2): 183-6. doi:10.1111/j.1399-0039.1998.tb02283.x. PMID 9756408. Middleton D, Menchaca L, Rood H, ... Tissue Antigens. 75 (4): 291-455. doi:10.1111/j.1399-0039.2010.01466.x. PMC 2848993. PMID 20356336. derived from IMGT/HLA Balas ... Dominant epitopes of the alpha 2 helix". J. Immunol. 149 (11): 3563-8. PMID 1385528. Marsh, S. G.; Albert, E. D.; Bodmer, W. F ...
A43 is a split antigen of the broad antigen serotype A10. A43 is a sister serotype of A25, A26, A34, and A66. A43 is more ... Arce-Gomez B, Jones EA, Barnstable CJ, Solomon E, Bodmer WF (February 1978). "The genetic control of HLA-A and B antigens in ... HLA-A43 (A43) is a human leukocyte antigen serotype within HLA-A serotype group. The serotype is determined by the antibody ... 1993). "Structural diversity in the HLA-A10 family of alleles: correlations with serology". Tissue Antigens. 41 (2): 72-80. doi ...
Marsh SG, Bodmer JG (1993). "HLA class II nucleotide sequences, 1992". Tissue Antigens. 40 (5): 229-43. doi:10.1111/j.1399- ... 1991). "Interaction of CD4 with HLA class II antigens and HIV gp120". Immunogenetics. 34 (2): 121-8. doi:10.1007/BF00211424. ... Class II molecules are expressed in antigen-presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha ... Major histocompatibility complex Human leukocyte antigen HLA-DQ ENSG00000206305, ENSG00000225890, ENSG00000232062, ...
Suastegui R, De La Rosa G, Carranza J, Gonzalez-Astiazaran A, Gorodezky C (2001). "Contribution of the MHC class II antigens to ... DR17 is part of the broader antigen group HLA-DR3 and is very similar to the group HLA-DR18. DR17 recognizes the DRB1*0301, * ... Tissue Antigens. 50 (6): 639-41. doi:10.1111/j.1399-0039.1997.tb02922.x. PMID 9458117. Czaja A, Strettell M, Thomson L, ... Tissue Antigens. 70 (4): 301-6. doi:10.1111/j.1399-0039.2007.00904.x. PMID 17767551. Jean S, Quelvennec E, Alizadeh M, ...
Tissue Antigens. 61 (5): 335-43. doi:10.1034/j.1399-0039.2003.00070.x. PMID 12753652. Steinle A, Li P, Morris DL, Groh V, ... 171 (2): 902-8. doi:10.4049/jimmunol.171.2.902. PMID 12847260. Eleme K, Taner SB, Onfelt B, Collinson LM, McCann FE, Chalupny ... 14 (2): 123-33. doi:10.1016/S1074-7613(01)00095-4. PMID 11239445. Radosavljevic M, Cuillerier B, Wilson MJ, Clément O, Wicker S ... 168 (2): 671-9. doi:10.4049/jimmunol.168.2.671. PMID 11777960. Dunn C, Chalupny NJ, Sutherland CL, Dosch S, Sivakumar PV, ...
Tissue antigens. 70(2):105-109, 2007 Cruz AAV. Orbital inflammation and infection versus neoplasia. In: Karcioglu ZA, ed. ... However, one study by Mottow-Lippe, Jakobiec, and Smith suggests that the release of circulating antigens caused by local ...
Among immune-related refractoriness, antibodies against HLA antigens are the primary cause. Non-immune causes include ... platelet refractoriness Pathogen-reduced platelet component Alloantibodies to platelet antigens Human leucocyte antigen (HLA) ... Tissue Antigens. 79 (4): 237-245. doi:10.1111/j.1399-0039.2012.01852.x. ISSN 1399-0039. PMID 22385314. Rebulla, P. (1993). " ... antibodies Human platelet antigen (HPA) antibodies Immune complexes Other antibodies Drug-related antibodies Platelet ...
Tissue Antigens. 62 (5): 401-407. doi:10.1034/j.1399-0039.2003.00119.x. ISSN 0001-2815. Jahn Montauban, Leopoldo. "La Colonia ...
DR16 is part of the older HLA-DR2 serotype group which also contains the similar HLA-DR15 antigens. DR16 is associated with ... Tissue Antigens. 67 (1): 79-83. doi:10.1111/j.1399-0039.2005.00498.x. PMID 16451208. Park M, Park Y, Song E, Park H, Kim T, ... Tissue Antigens. 53 (1): 74-80. doi:10.1034/j.1399-0039.1999.530108.x. PMID 10082433. Dharakul T, Vejbaesya S, Chaowagul W, ... 3.0.CO;2-Y. PMID 10088769. Tan F, Stivers D, Arnett F, Chakraborty R, Howard R, Reveille J (1999). "HLA haplotypes and ...
1999). "Molecular characterization of a novel human natural killer cell receptor homologous to mouse 2B4". Tissue Antigens. 54 ... 105 (2): 180-4. doi:10.1016/j.imlet.2006.02.006. PMID 16621032. Siu G, Strauss EC, Lai E, Hood LE (1986). "Analysis of a human ... 3.0.CO;2-9. PMID 10556801. Parolini S, Bottino C, Falco M, et al. (2000). "X-Linked Lymphoproliferative Disease: 2b4 Molecules ... 2001). "Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells". EMBO J. ...
Kaibe M, Takakuwa K, Murakawa H, Ishii K, Tamura M, Tanaka K (2006). "Studies on the human leukocyte antigens in patients with ... Matsuyama M, Hashimoto K, Yamasaki Y, Shirakura R, Higuchi R, Miyajima T, Amemiya H (1981). "HLA-DR antigens in pemphigus among ... Tissue Antigens. 41 (2): 57-64. doi:10.1111/j.1399-0039.1993.tb01980.x. PMID 8475491. Undlien D, Friede T, Rammensee H, Joner G ... Tissue Antigens. 69 (4): 318-325. doi:10.1111/j.1399-0039.2007.00826.x. PMID 17389015. Lee E, Lendas K, Chow S, Pirani Y, ...
Tissue Antigens. 25 (2): 87-95. doi:10.1111/j.1399-0039.1985.tb00420.x. PMID 3857723. Hunter-Zinck, H; Musharoff, S; Salit, J; ... Tissue Antigens. 25 (2): 87-95. doi:10.1111/j.1399-0039.1985.tb00420.x. PMID 3857723. "Genetic disorders in arabs" (PDF). IE = ... 9 (2): e1003316. doi:10.1371/journal.pgen.1003316. PMC 3585000. PMID 23468648. Brenna M. Henn; Laura R. Botigué; Simon Gravel; ... 75 (2): 338-45. doi:10.1086/423147. PMC 1216069. PMID 15202071. Semino et al. (2004). Archived 2011-07-09 at the Wayback ...
A31 is a split antigen of the broad antigen serotype A19. A31 is a sister serotype of A29, A30, A32, A33, and A74. A31 is more ... "The genetic control of HLA-A and B antigens in somatic cell hybrids: requirement for beta2 microglobulin". Tissue Antigens. 11 ... HLA-A31 (A31) is a human leukocyte antigen serotype within HLA-A serotype group. The serotype is determined by the antibody ... Tissue Antigens. 61 (5): 403-407. doi:10.1034/j.1399-0039.2003.00062.x. PMID 12753660. B*3512. ...
Fan QR, Wiley DC (1999). "Structure of human histocompatibility leukocyte antigen (HLA)-Cw4, a ligand for the KIR2D natural ... Tissue Antigens. 57 (1): 22-31. doi:10.1034/j.1399-0039.2001.057001022.x. PMID 11169255. Fan QR, Long EO, Wiley DC (2001). " ... "N-linked carbohydrate on human leukocyte antigen-C and recognition by natural killer cell inhibitory receptors". Hum. Immunol. ... "N-linked carbohydrate on human leukocyte antigen-C and recognition by natural killer cell inhibitory receptors". Hum. Immunol. ...
A34 is a split antigen of the broad antigen serotype A10. A34 is a sister serotype of A25, A26, A43, and A66. A34 is most ... Arce-Gomez B, Jones EA, Barnstable CJ, Solomon E, Bodmer WF (February 1978). "The genetic control of HLA-A and B antigens in ... HLA-A34 (A34) is a human leukocyte antigen serotype within HLA-A serotype group. The serotype is determined by the antibody ... Tissue Antigens. 61 (5): 403-407. doi:10.1034/j.1399-0039.2003.00062.x. PMID 12753660. Probst, C.M. (2000). "HLA Polymorphism ...
"HLA-DR antigens in rheumatoid arthritis. A Swiss collaborative study; final report. Swiss Federal Commission for the Rheumatic ... In lyme disease arthritis, *0101 appears to play a role in presentation of triggering microbial antigens. DRB1*0102 is ... "HLA antigens and seronegative rheumatoid arthritis". Ann Rheum Dis. 44 (1): 50-53. doi:10.1136/ard.44.1.50. PMC 1001567. PMID ... "Human leukocyte antigen and season of birth in Japanese patients with schizophrenia". Am J Psychiatry. 157 (7): 1173-1175. doi: ...
Arce-Gomez B, Jones EA, Barnstable CJ, Solomon E, Bodmer WF (February 1978). "The genetic control of HLA-A and B antigens in ... HLA-Cw4 (Cw4) is a human leukocyte antigen serotype within HLA-C serotype group. (For more general information on HLA serotypes ... please see the article: History and naming of human leukocyte antigens.) Cw4 is determined by the antibody recognition of α4 ... Tissue Antigens. 61 (5): 403-407. doi:10.1034/j.1399-0039.2003.00062.x. PMID 12753660. v t e. ...
DR15 is part of the older HLA-DR2 serotype group which also contains the similar HLA-DR16 antigens. Serotypes are unknown for ... 2007). "Analysis of HLA antigens in Turkish sarcoidosis patients". South. Med. J. 100 (4): 356-9. doi:10.1097/SMJ. ... 2007). "HLA alleles as predisposal factors for postmenopausal osteoporosis in a Greek population". Tissue Antigens. 69 (6): 592 ... Tissue Antigens. 61 (2): 166-71. doi:10.1046/j.0001-2815.2002.00008.x. PMID 12694585. Takeuchi F, Nakano K, Nabeta H, Hong G, ...
A23 is a split antigen of the broad antigen HLA-A9 and it is a sister serotype of HLA-A24. A23 is common in Africa and regions ... "The genetic control of HLA-A and B antigens in somatic cell hybrids: requirement for beta2 microglobulin". Tissue Antigens. 11 ... HLA-A23 (A23) is a human leukocyte antigen serotype within HLA-A serotype group. The serotype is determined by the antibody ... Tissue Antigens. 61 (5): 403-407. doi:10.1034/j.1399-0039.2003.00062.x. PMID 12753660. Tang J, Tang S, Lobashevsky E, Myracle A ...
HLA class II histocompatibility antigen, DP(W2) beta chain is a protein that in humans is encoded by the HLA-DPB1 gene. HLA-DPB ... 1991). "Modulation of the HLA class II antigen at a molecular level by maternal serum among cord blood cells and unrelated ... Eiermann TH, Uhl S, Fakler J, Goldmann SF (1992). "A novel HLA-DPB1 sequence, DPB1*2301". Tissue Antigens. 40 (2): 108-10. doi: ... Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain ...
... is a broad antigen HLA-A serotype. The ancestral A10 type is believed to be A*2601, which via gene conversion with ... 2002). "The association of specific HLA class I and II alleles with type 1 diabetes among Filipinos". Tissue Antigens. 59 (6): ... 1993). "Structural diversity in the HLA-A10 family of alleles: correlations with serology". Tissue Antigens. 41 (2): 72-80. doi ... Tissue Antigens. 53 (4 Pt 1): 311-9. doi:10.1034/j.1399-0039.1999.530401.x. PMID 10323335. Maitland K, Bunce M, Harding RM, et ...
Tissue Antigens. 61 (5): 403-7. doi:10.1034/j.1399-0039.2003.00062.x. PMID 12753660. External link in ,title= (help). ... Tissue Antigens. 75 (4): 291-455. doi:10.1111/j.1399-0039.2010.01466.x. PMC 2848993. PMID 20356336. Ellexson ME, Zhang G, ... "NM5" antigens". Hum. Immunol. 44 (2): 103-10. doi:10.1016/0198-8859(95)00082-F. PMID 8847228. derived from IMGT/HLA Middleton ...
Tissue Antigens. 69 (1): 10-18. doi:10.1111/j.1399-0039.2006.00717.x. PMID 17212703. Douglas, Peter. "The South Sea Voyage of ... Retrieved 2 November 2016. Stolpe, Hjalmar (1899). "Über die Tätowirung der Oster-Insulaner." Abhandlungen und Berichte des ...
The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and ... CMRF35-like molecule 6 (CLM-6) also known as CD300 antigen-like family member C (CD300c) is a protein that in humans is encoded ... Tissue Antigens. 55 (2): 101-9. doi:10.1034/j.1399-0039.2000.550201.x. PMID 10746781. "Entrez Gene: CD300C CD300c molecule". ... Tissue Antigens. 57 (5): 415-23. doi:10.1034/j.1399-0039.2001.057005415.x. PMID 11556966. v t e. ...
de la Fuente MA, Pizcueta P, Nadal M, Bosch J, Engel P (Sep 1997). "CD84 leukocyte antigen is a new member of the Ig ... Krause SW, Rehli M, Heinz S, Ebner R, Andreesen R (Mar 2000). "Characterization of MAX.3 antigen, a glycoprotein expressed on ... Tissue Antigens. 64 (2): 132-44. doi:10.1111/j.1399-0039.2004.00247.x. PMID 15245368. Nanda N, Andre P, Bao M, Clauser K, ... Tissue Antigens. 55 (2): 118-27. doi:10.1034/j.1399-0039.2000.550203.x. PMID 10746783. Lucas AD, Chadwick N, Warren BF, Jewell ...
... (DR5) is a broad-antigen serotype that is further split into HLA-DR11 and HLA-DR12 antigen serotypes. With the ... Association with the human leucocyte antigen phenotype". Ann N Y Acad Sci. 621: 78-89. doi:10.1111/j.1749-6632.1991.tb16970.x. ... Førre O, Dobloug J, Høyeraal H, Thorsby E (1983). "HLA antigens in juvenile arthritis. Genetic basis for the different subtypes ... Orecchia G, Belvedere M, Martinetti M, Capelli E, Rabbiosi G (1987). "Human leukocyte antigen region involvement in the genetic ...
2007). "No association of KIR genes with Behcet's disease". Tissue Antigens. 70 (5): 435-438. doi:10.1111/j.1399-0039.2007. ... 2007). "KIR genes polymorphism in Argentinean Caucasoid and Amerindian populations". Tissue Antigens. 69 (6): 568-576. doi: ... Tissue Antigens. 67 (4): 277-283. doi:10.1111/j.1399-0039.2006.00567.x. PMID 16634863. Zhu FM, Jiang K, Lü QF, et al. (2005 ... Tissue Antigens. 65 (3): 252-259. doi:10.1111/j.1399-0039.2005.00359.x. PMID 15730517. Norman PJ, Carrington CV, Byng M, et al ...
... +Antigen at the US National Library of Medicine Medical Subject Headings (MeSH) Human CD1A genome location and CD1A gene ... The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. ... Yu CY, Milstein C (1990). "A physical map linking the five CD1 human thymocyte differentiation antigen genes". EMBO J. 8 (12): ... "Entrez Gene: CD1E CD1e molecule". Brigl M, Brenner MB (2004). "CD1: antigen presentation and T cell function". Annu. Rev. ...
Instead, one could cleave in a section between the bead and the antigen to elute. Since the pIII is intact it does not matter ... The technique is also used to determine tumour antigens (for use in diagnosis and therapeutic targeting) and in searching for ... novel expression vectors that display cloned antigens on the virion surface". Science. 228 (4705): 1315-7. Bibcode:1985Sci... ... whether the antigen remains bound to the phage. The issue of using Ff phages for phage display is that they require the protein ...
The ABH-antigen produced is thought to act as a receptor for human norovirus: A non-functional fucosyltransferase FUT2 provides ... Tan M, Hegde RS, Jiang X (2004). "The P Domain of Norovirus Capsid Protein Forms Dimer and Binds to Histo-Blood Group Antigen ... Reports have shown a link between the expression of human histo-blood group antigens (HBGAs) and the susceptibility to ... GII.4 includes global epidemic strains and binds to more histo-blood group antigens than other genogroups. FUT2 fucosyl- ...
Genetic studies on Philippine Negritos, based on polymorphic blood enzymes and antigens, showed that they were similar to their ... ISBN 978-90-8964-093-2. See, for example: Encyclopædia Britannica Eleventh Edition, 1910-1911: "Second are the large Negrito ... Human relations area files, 1-2. New Haven, Conn: Human Relations Area Files. Armando Marques Guedes (1996). Egalitarian ... 21 January 2003), "Genetic Affinities of the Andaman Islanders, a Vanishing Human Population" (PDF), Current Biology, 13 (2): ...
... with improvements to antigen design and manufacturing capabilities. GeoVax technology approach uses recombinant DNA or ... HVTN 205 Study-In early 2009, the HVTN began enrolling patients in a preventive Phase 2 clinical trial sponsored by GeoVax Labs ... GeoVax is currently conducting multiple site Phase 2 Human clinical trials for HIV/AIDS preventive vaccine products following ... caused by the SARS-CoV-2 coronavirus. They have completed the design and construction of multiple vaccine candidates and have ...
It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor ... 147 (2): 221-34. doi:10.1083/jcb.147.2.221. PMC 2174231. PMID 10525530. Li H, Leo C, Zhu J, Wu X, O'Neil J, Park EJ, Chen JD ( ... 16 (2): 97-104. doi:10.1016/j.tcb.2005.12.002. PMID 16406523. Yang X, Khosravi-Far R, Chang HY, Baltimore D (1997). "Daxx, a ... 200 (1-2): 149-56. doi:10.1016/S0378-1119(97)00411-3. PMID 9373149. Ishov AM, Sotnikov AG, Negorev D, Vladimirova OV, Neff N, ...
Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILR-A3) also known as CD85 antigen-like family member E (CD85e), ... and can bind human leukocyte antigen (HLA) class I. Therefore, if secreted, the LILRA3 might impair interactions of membrane- ... and dendritic cells involved in antigen processing". The Journal of Experimental Medicine. 185 (10): 1743-51. doi:10.1084/jem. ... 3.0.co;2-y. PMID 11169408. Arm JP, Nwankwo C, Austen KF (September 1997). "Molecular identification of a novel family of human ...
... epithelial membrane antigen) → - GFAP (glial fibrillary acidic protein) → + Synaptophysin → - Chromogranin → - NSE (neuron- ... Virginia Stark-Vance, M. L. D. (2011). 100 Questions and Answers About Brain Tumors (2 ed.): Jones and Bartlett Publishers. ... 2010). Oncology of CNS Tumors (2 ed.): Springer-Verlag Berlin Heidelberg. Kevin Buffenoir, P. R., Michel Wager, Sarah Ferrand, ...
15 kDa plays other roles in immunological processes, such as in antigen-presenting cell maturation and in immune cell migration ... GNLY gene is located on human chromosome 2 and has 5 exons, which code for a 15 kDa protein. The path to transcription has not ... 37 (2): 102-7. doi:10.1007/BF00216832. PMID 8423048. S2CID 24229734. Peña SV, Hanson DA, Carr BA, Goralski TJ, Krensky AM ( ... 325 (2): 355-65. CiteSeerX 10.1.1.327.5540. doi:10.1016/S0022-2836(02)01234-2. PMID 12488100. Gansert JL, Kiessler V, Engele M ...
Noncognate (not antigen specific) B cells play a significant role in the transport of antigens to FDCs. They capture immune ... Follicular DCs receptors CR1, CR2 and FcγRIIb trap antigen opsonized by complement or antibodies. These antigens are then taken ... To become selected as a future memory cell, GC B cells must bind the antigen presented on FDCs, otherwise they enter apoptosis ... This results in the formation of GC, where antigen-activated B cells are trapped to undergo somatic mutation, positive and ...
... incomplete clonal deletion allows for a balance between the host's ability to recognize foreign antigens and self antigens. ... Thus, the host develops a tolerance for this antigen, or a self tolerance. B and T lymphocytes are tested for their affinity ... B and T cells are presented with self antigen after developing receptors while they are still in the primary lymphoid organs. ... This is where the lymphocyte would receive apoptotic signals from antigen-presenting cell (APCs). It is important to note that ...
Both rOmpA and rOmpB are members of a family of surface cell antigens (Sca) which are autotransporter proteins; they act as ... Noriea, Nicholas; Clark, Tina; Hackstadt, Ted (2015). "Targeted Knockout of the Rickettsia rickettsii OmpA Surface Antigen Does ... 65 (2): 1-44. doi:10.15585/mmwr.rr6502a1. ISSN 1057-5987. PMID 27172113. Saraiva DG, Soares HS, Soares JF, Labruna MB (2014). " ... 6 (2): e00323-15. doi:10.1128/mBio.00323-15. PMC 4453529. PMID 25827414. Woods CR (April 2013). "Rocky Mountain spotted fever ...
The protein encoded by this gene is a nucleolar antigen expressed in proliferating cells. It is not detectable in non- ... "Cell cycle regulated expression of nucleolar antigen P120 in normal and transformed human fibroblasts". J. Cell. Physiol. 154 ( ... "Identification and characterization of a human proliferation-associated nucleolar antigen with a molecular weight of 120,000 ... "Identification and characterization of a human proliferation-associated nucleolar antigen with a molecular weight of 120,000 ...
Also, more than 7.3 million RT-PCR tests and about 484,000 rapid antigen tests have been processed. An anti-COVID-19 ... On 2 March, the first two cases were confirmed in Portugal, both in the city of Porto. One was a doctor who had returned from ... On 2 March, Western Russia confirmed its first case in Moscow Oblast. Previously on 31 January Russia confirmed first two cases ... 2 March 2020. Archived from the original on 2 March 2020. Retrieved 2 March 2020. "Mensagem do Presidente da República ao País ...
Antigens,+CD34 at the US National Library of Medicine Medical Subject Headings (MeSH) Mouse CD Antigen Chart Human CD Antigen ... CD34 derives its name from the cluster of differentiation protocol that identifies cell surface antigens. CD34 was first ... A hematopoietic progenitor cell surface antigen defined by a monoclonal antibody raised against KG-1a cells". Journal of ... Loken M. Shah V. Civin CI.. (1987). "Characterization of myeloid antigens on human bone marrow using multicolour ...
Genetic Structure and Distribution of HL-A Antigens in a Basque village, in "Histocompatibility Testing", Copenhague, J. Ruffie ... ISBN 2-86781-396-4. Manuscript from the 14th century in the Departmental Archives of Pyrénées-Atlantiques (in French) Chapter ... population the high frequency of blood group O and Rh negative and the particularities of distribution of Gm antigens and HL-A ... ISBN 2 7003 0038 6, page 53. (in French) Guy Ascarat Archived November 9, 2013, at the Wayback Machine List of Mayors of France ...
... indicating a stronger and longer-lasting immune response to the disease antigen. The strong immune reaction in response to ... indicating a stronger and longer-lasting immune response to the disease antigen. The strong immune reaction in response to ... 126 (2): 99-102. doi:10.1016/j.actatropica.2013.01.011. PMID 23369878. E. L. Telleria, A. P. O. de Araújo, N. F. Secundino, C. ... This species has an overall sex ratio of 2:1 for males to females, so males outnumber females. Males of the species complex are ...
Pra1 (pH regulated antigen 1) is a candida albicans protein that scavenges host zinc. Diagnosis is typically made based on ... 361 (1-2): 279-290. doi:10.1007/s11104-012-1217-4. S2CID 16068957. Fang Y, Wang L, Xin Z, Zhao L, An X, Hu Q (March 2008). " ... 20 (2): 103-10. doi:10.1111/j.1365-277X.2007.00756.x. PMID 17374022. Nin T, Umemoto M, Miuchi S, Negoro A, Sakagami M (May 2006 ... 59 Suppl 2: S31-6. doi:10.1038/sj.ejcn.1602295. PMID 16254578. McDaid O, Stewart-Knox B, Parr H, Simpson E (April 2007). " ...
... were tested positive for COVID-19 from a rapid antigen test after being exposed to people who were not wearing a mask while ... On 2 April 2020, President Trump invoked the Defense Production Act of 1950 to halt exports of masks produced by 3M to Canada ... On 2 December the circuit breaker lockdown ended and the three-tier system was re-implemented in England under the The Health ... On 2 April, the Democratic National Convention, which was originally scheduled to be held from 13 to 16 July, was delayed to ...
In some areas, such as Kansas City, skin testing with the histoplasmin antigen preparation shows that 80-90% of the resident ... Erythematous skin conditions arising from antigen reactions may complicate the disease, as may myalgias, arthralgias, and ... 40 (2): 68-71. PMID 18113223. Leznoff, A; Frank, H; Taussig, A; Brandt, JL (1969). "The focal distribution of histoplasmosis in ... The budding yeast cells formed in infected tissues are small (about 2-4 µm) and are characteristically seen forming in clusters ...
... is a chimeric monoclonal antibody targeted against CD20 which is a surface antigen present on B cells. Therefore, it ... lymphocyte function-associated antigen). It elicits shedding of CD23. It downregulates the B cell receptor. It induces ... 3 (2): 86-90. doi:10.1186/bcr276. PMC 138676. PMID 11250751. Maverakis E, Kim K, Shimoda M, Gershwin M, Patel F, Wilken R, ... Retrieved 2 February 2020. Edwards J, Szczepanski L, Szechinski J, Filipowicz-Sosnowska A, Emery P, Close D, Stevens R, Shaw T ...
The human leukocyte antigen typing study and mitochondrial DNA analysis performed in recent years show that more than 88% of ... Tissue Antigens, 57 (3): 192-199, doi:10.1034/j.1399-0039.2001.057003192.x, PMID 11285126. Makeham, John (2005), "Introduction ... "Index" 第六次人口普查-附录2-1: 按地区分的境外人员(PRC Census 2010). PRC Nat'l Bureau of Statistics. Archived from the original on 2017-11-20. ... 37 (2): 215. doi:10.2307/3637072. JSTOR 3637072. Damm, Jens (2012). "Multiculturalism in Taiwan and the Influence of Europe". ...
Impairment of the cell-mediated response to vaccine antigen and modulation of cytokine expression". Toxicology and Applied ... 231 (2): 142-9. doi:10.1016/j.taap.2008.04.004. PMID 18501398. Wacoo Alex P.; Wendiro Deborah; Vuzi Peter C.; Hawumba Joseph F ... 30 (2): 460-470. doi:10.1128/BR.30.2.460-470.1966. PMC 441006. PMID 5327461. Agag B.I. (2004). "Mycotoxins in foods and feeds 1 ... 37 (2): 101-11. doi:10.1002/tera.1420370203. PMID 3127910. Meissonnier GM, Pinton P, Laffitte J, Cossalter AM, Gong YY, Wild CP ...
Russo L, Woolmough E, Heatley MK (2000). "Structural and cell surface antigen expression in the rete ovarii and epoophoron ...
1999). "Antigens recognized by autologous antibody in patients with renal-cell carcinoma". Int. J. Cancer. 83 (4): 456-64. doi: ... 3.0.CO;2-5. PMID 10508479. Strausberg RL, Feingold EA, Grouse LH, et al. (2003). "Generation and initial analysis of more than ... 18 (2): 676-84. doi:10.1128/mcb.18.2.676. PMC 108778. PMID 9447963. "Entrez Gene: SFRS2IP splicing factor, arginine/serine-rich ... 1999). "Identification of caspases that cleave presenilin-1 and presenilin-2. Five presenilin-1 (PS1) mutations do not alter ...
... uteroglobin-like antigen (UGL), blastokinin, club-cell secretory protein (CCSP), Clara-cell 16 kD protein (17 in rat/mice), ... 2 (1): 112-20. doi:10.1002/1615-9861(200201)2:1. 3.0.CO;2-N. PMID 11788998. Narita I, Saito N, Goto S, et al. (2002). "Role of ... 27 (2): 170-8. doi:10.1165/ajrcmb.27.2.200200270c. PMID 12151308. Bioinformatic_Harvester Bernard A, Roels H, Lauwerys R, et al ... doi:10.1016/S0006-291X(02)00767-2. PMID 12127976. Coppo R, Chiesa M, Cirina P, et al. (2002). "In human IgA nephropathy ...
Finally, NADA can prevent the degranulation and release of TNF from RBL- 2H3 mast cells treated with an IgE-antigen complex. ... 32 (2): 298-308. doi:10.1038/sj.npp.1301118. ISSN 0893-133X. PMID 16760924. Sagar, Devi R.; Smith, Paul A.; Millns, Paul J.; ... doi:10.1016/s0960-894x(00)00689-2. ISSN 0960-894X. PMID 11229744. Little, P. J.; Compton, D. R.; Johnson, M. R.; Melvin, L. S ... 109 (2): 452-464. doi:10.1111/j.1471-4159.2009.05966.x. ISSN 1471-4159. PMID 19200337. S2CID 205620351. Navarrete, Carmen M.; ...
... tend to generate many mutated proteins that could serve as tumor antigens; pembrolizumab appears to facilitate clearance of any ... On 2 October 2015, the US FDA approved pembrolizumab for the treatment of metastatic non-small cell lung cancer (NSCLC) in ... 2 February 2011. Retrieved 3 December 2020. Pardoll DM (March 2012). "The blockade of immune checkpoints in cancer ... 369 (2): 134-44. doi:10.1056/nejmoa1305133. PMC 4126516. PMID 23724846. Clinical trial number NCT01295827 for "Study of ...
Boyse EA, Old LJ, Stockert E. An approach to the mapping of antigens on the cell surface. Proc Natl Acad Sci USA 1968;60:886. ... J Exp Med 145: 1-9. Rao A, Ko WW, Faas SJ, Cantor H. Binding of antigen in the absence of histocompatibility proteins by ... Glimcher L, Shen F-W, Cantor H. Identification of a cell-surface antigen selectively expressed on the natural killer cell. J. ... I. The generation of functionally distinct T-cell subclasses is a differentiative process independent of antigen. J. Exp. Med. ...
... in persons with blood group O and in non-secretors of blood group antigens in saliva. Increased rates of Candida carriage are ... 5 (2): 125-57. doi:10.1177/10454411940050020101. PMID 7858080. Li, X; Lei, L; Tan, D; Jiang, L; Zeng, X; Dan, H; Liao, G; Chen ... 91 (2): 32-3. PMID 22662470. Archived from the original (PDF) on 2013-11-02. Retrieved 2013-09-06. Soames JV, Southam JC, JV ( ... 78 (2): 189-93. doi:10.1016/0030-4220(94)90146-5. PMID 7936588. Scully, C; el-Kabir, M; Samaranayake, LP (1994). "Candida and ...
Immediate Early Antigen Monoclonal Antibody, Unconjugated, Clone 3G9.2 from CHEMICON,Reacts with an early protein. Can detect ... Anti-sm (Smith Antigen) (SLE / Nuclear Marker) Ab-1 Monoclonal Antibody, Unconjugated from Lab Vision. 10. Rat Anti-Mouse F4 / ... 80 Antigen Monoclonal Antibody, Biotin Conjugated from AbD Serotec. 11. Mouse Anti-Human B-Cells (FMC7 Antigen) Monoclonal ... Mouse Anti-HLA, Class II Antigen-DR+DP Monoclonal Antibody, Unconjugated, Clone 236-14240 from Meridian Life Science, Inc.. 4. ...
A revised section on evaluating the results of antigen tests - this section introduces a new antigen testing algorithm and ... On December 5, 2020, CDC updated the Interim Guidance for Antigen Testing for SARS-CoV-2 Web page. Refer to this guidance for ... A new section on the processing of antigen tests - this section reflects on lessons learned and provides guidance on how to ... 12/07/2020: Lab Update: CDC Updates SARS-CoV-2 Antigen Testing Guidance. ...
The aim of the project is to construct recombinant BCG strains that express viral protein(s) of the SARS-CoV-2 virus in fusion ... Production of recombinant antigens from two SARS-CoV-2 proteins and generation of nano-antibodies against these proteins for ... Production of recombinant antigens from two SARS-CoV-2 proteins and generation of nano-antibodies against these proteins for ... SARS-CoV-2 fusion, replication and host responses. *Sequence the complete genome of Covid-19 directly and at low cost from ...
This guidance can help healthcare providers make the most effective use of antigen tests in different situations. ... Proper interpretation of antigen test results is important for accurate clinical management of patients with suspected COVID-19 ... it may be useful to implement serial antigen testing for persons who receive a negative antigen test result. Serial antigen ... Serial antigen testing should be performed every 3-7 days for 14 days. For guidance on the use of antigen tests in ending ...
... enables home use of a SARS-CoV-2 Rapid Antigen Test using a simple... ... enables home use of a SARS-CoV-2 Rapid Antigen Test using a simple... ... About antigen testing. An antigen test detects proteins which are structural or functional components of a pathogen and are ... a Rapid Antigen Test in September and a lab-based Antigen Test in December. Roche is working closely with governments and ...
How is bullous pemphigoid antigens 1 and 2 abbreviated? BPAG 2 stands for bullous pemphigoid antigens 1 and 2. BPAG 2 is ... defined as bullous pemphigoid antigens 1 and 2 very rarely. ... Bullous Pemphigoid Antigen 1. *Board of Patent Appeals and ... www.acronymfinder.com/bullous-pemphigoid-antigens-1-and-2-(BPAG%202).html,BPAG 2,/a,. ... www.acronymfinder.com/bullous-pemphigoid-antigens-1-and-2-(BPAG%202).html ...
Antigen test reliably and quickly triages people suspected of SARS-CoV-2, with results ready in 15 minutes, allowing informed ... Antigen test reliably and quickly triages people suspected of SARS-CoV-2, with results ready in 15 minutes, allowing informed ... About antigen testing. An antigen test detects proteins which are structural or functional components of a pathogen and are ... If the target antigen is present in sufficient concentrations in the sample, it will bind to specific antibodies and generate a ...
The first rapid test to detect the HIV-1 antigen, as well as blood antibodies for the HIV-1 and HIV-2 strains, has been ... 8 (HealthDay News) -- The first rapid test to detect the HIV-1 antigen, as well as blood antibodies for the HIV-1 and HIV-2 ... Detection of the HIV-1 antigen may allow doctors to diagnose the viral infection earlier than detection of the antibodies alone ... Diabetes (Type 1 and Type 2). Teen Health Bullying. Dermatology Jock Itch. ...
Specific nongluten proteins of wheat are novel target antigens in celiac disease humoral response. J. Proteome Res. 14, 503-511 ... Reovirus infection triggers inflammatory responses to dietary antigens and development of celiac disease. Science 356, 44-50 ( ... Duodenal bacterial proteolytic activity determines sensitivity to dietary antigen through protease-activated receptor-2. * ... 2. LasB induces intraepithelial lymphocytes (IELs) and microbiota shifts. a Visual expression of lasB in the small intestine ( ...
What is H-2 antigens? Meaning of H-2 antigens medical term. What does H-2 antigens mean? ... Looking for online definition of H-2 antigens in the Medical Dictionary? H-2 antigens explanation free. ... antigens that are coded by the H-2 complex of genes in mice and are involved in self/nonself recognition. H-2 antigen system is ... H-2 antigens , definition of H-2 antigens by Medical dictionary https://medical-dictionary.thefreedictionary.com/H-2+antigens ...
... cancer-testis antigens. They are the major protein ingredients of human semen and share 78% of similarity between them on the ... SEMG1/2 gene products regulate the motility and fertility of sperm, as well as provide sperm the antibacterial defense. Besides ... "Сancer-testis antigens (CTAs) comprise proteins which are aberrantly expressed in various malignancies, yet under normal ... Semenogelins 1 and 2 (SEMG1 and 2, respectively) belong to the family of non-X-linked (autosomal) ...
... announced today the initiation of clinical testing needed for the submission of its new SARS-CoV-2 Antigen assay for EUA ( ... Tags: Antigen, Assay, Clinical Testing, Diagnostic, Diagnostics, Enzyme, Immunoassay, Immunoassays, Laboratory, Pandemic, SARS- ... is joining the fight to combat the COVID-19 pandemic with the goal of providing the first fully automated antigen test. ... As the first company to develop a fully automated SARS-CoV-2 antigen test, we expect this innovation to have a positive impact ...
Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I ... antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent Source: MGI ,p> ... antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent Source: MGI ,p ... antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent Source: MGI ,p>Inferred from ...
B.2 PRE-EXISTING MEDICAL CONDITIONS Chronic lung disease Chronic renal disease Malignancy Diabetes Heart disease Hypertension ... Cat 2: Symptomatic contact of lab confirmed case Cat 3: Symptomatic Healthcare worker / Frontline workers Cat 4: Hospitalized ...
Tags: Antigen, Diagnostics, Laboratory, Manufacturing, Nursing, Protein, Research, SARS-CoV-2, Throat, Vaccine, Virus ... The rapid antigen test collects saliva in a cartridge placed in an existing hand-held device, first developed by West ... Professor Jin said that currently available antigen tests are not sensitive enough to screen people when they are showing no ... Highly sensitive saliva test for SARS-CoV-2 virus antigens can deliver result in under 15 minutes. *Download PDF Copy ...
Stromal Antigen 2), Authors: Suning Chen, Stefan Nagel, Hans G Drexler, Roderick AF MacLeod. Published in: Atlas Genet ... STAG2 (Stromal Antigen 2). Written. 2013-09. Suning Chen, Stefan Nagel, Hans G Drexler, Roderick AF MacLeod. ... 2/64) of CML, and 1.3% (1/77) of MPN: the STAG2 alterations were mostly exclusive with alterations involving other components ...
Different proteins associated with SARS-CoV-2, the virus that causes COVID-19, generate unique immune responses when given to ... The RBD-immune sera showed better functional activity than the other vaccine antigens as a result of higher affinity antibodies ... the team wanted to gain a better understanding of the humoral immune response generated by different vaccine antigens, ... Reverse genetics allows researchers to map SARS-CoV-2 in the body. A new study has revealed that SARS-CoV-2 infects the nasal ...
Shop a large selection of Proteins A-Z products and learn more about Novus Biologicals Claudin-2 Recombinant Protein Antigen ... A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Claudin-2. Source: E.coli Amino Acid ... The Claudin-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition. ... RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV The Claudin-2 Recombinant Protein Antigen is derived from E. coli. ...
These antigens are mainly melanoma/ melanocyte differentiation antigens, although mutated intracellular proteins can also serve ... Expression cloning techniques have identified a series of tumor antigens that are recognized by TIL grown from resected ... Tumor-infiltrating lymphocytes (TIL) from melanoma patients were used to clone the genes encoding the tumor antigens ... Identification of the tumor antigens mediating clinical response is opening new therapeutic possibilities for cancer treatment. ...
Basement membrane (BM) antigens and matrix metalloproteinases (MMP) are involved in tumor invasion and metastasis. Basal (BCC) ... We studied the immunohistochemical expression of several BM antigens and of MMP2 and MMP9, in 13 BCC, 13 SCC, and 8 in situ ... Our findings further upheld the role of BM antigens and MMPs in the process of tumor aggressiveness. The reduced expression of ... The expression of most BM antigens was reduced in the tumors in comparison with normal skin. Hemidesmosome- and lamina lucida- ...
Blood Groups, Platelet Antigens, and Granulocyte Antigens. Harriet S. Meyer. in AMA Manual of Style: A Guide for Authors and ... 15.1 Blood Groups, Platelet Antigens, and Granulocyte Antigens (1) * 15.1.2 Platelet-Specific Antigens. (1) ... As with blood groups, there are platelet antigen systems and specific antigens within those systems. The HPA nomenclature ... The current system of human platelet antigen (HPA) nomenclature, adopted in 1990, is overseen by the Platelet Nomenclature ...
Early prostate cancer antigen-2 (EPCA-2) is a protein of which blood levels are elevated in prostate cancer. It appears to ... "Detection of prostate cancer with a blood-based assay for early prostate cancer antigen". Cancer Res. 65 (10): 4097-100. doi: ... "EPCA-2" is not the name of a gene. EPCA-2 gets its name because it is the second prostate cancer marker identified by the ... April 2007). "EPCA-2: a highly specific serum marker for prostate cancer". Urology. 69 (4): 714-20. doi:10.1016/j.urology. ...
Change From Baseline in the Serum Prostate Specific Antigen (PSA) Level [ Time Frame: Baseline and 3 months after initial ... Inhibitor Reduces Serum Prostatic Specific Antigen (PSA) Levels. Official Title ICMJE COX-2 Inhibitor Reduces Serum PSA Levels ... Inhibitor Reduces Serum Prostatic Specific Antigen (PSA) Levels. This study has been completed. ... 2007 Aug;70(2):272-6.. *Di Silverio F, Gentile V, De Matteis A, Mariotti G, Giuseppe V, Luigi PA, Sciarra A. Distribution of ...
The aim of this study was to evaluate the diagnostic accuracy of a new cyto-salivary antigen test aimed at detecting the ... The new cyto-salivary antigen had a sensitivity of 100% and a specificity of 94.2%. The sensitivity and the specificity of the ... Conclusions: The new cyto-salivary antigen test detected more positive cases than the RT-PCR in a sample of asymptomatic ... presence of antigens for SARS-CoV-2, as compared by the gold standard RT-PCR and a lateral flow test. Methods: A total of 433 ...
The Epstein-Barr virus nuclear antigen 2 (EBNA-2) is one of the six EBV viral nuclear proteins expressed in latently infected B ... Palermo RD, Webb HM, Gunnell A, West MJ (August 2008). "Regulation of transcription by the Epstein-Barr virus nuclear antigen ... EBNA2 transactivates the promoters of the latent membrane antigens LMP, TP1 and TP2. Additionally, EBNA2 interacts with an ... December 1997). "Both Epstein-Barr viral nuclear antigen 2 (EBNA2) and activated Notch1 transactivate genes by interacting with ...
... and the integral membrane transplantation antigen, H-2Ld. The addition of 15 amino acids to the three residue long cytoplasmic ... We report that all the signals responsible for PI anchoring of Qa-2 Ag are confined to the 36 C-terminal residues of the ... Molecular signals for phosphatidylinositol modification of the Qa-2 antigen.. N Ulker, L E Hood and I Stroynowski ... Molecular signals for phosphatidylinositol modification of the Qa-2 antigen. Message Subject (Your Name) has forwarded a page ...
Agglutination Shop Blood Group ABH Antigen Mouse anti-Human, ... Blood Group ABH Antigen Antibody (Z5H-2/Z2A), MA1-7667, from ... The A, B and H antigens are reported to undergo modulation during maligt cellular transformation. Blood group related antigens ... Blood-group antigens are generally defined as molecules formed by sequential addition of saccharides to the carbohydrate side ... Blood Group ABH Antigen Mouse anti-Human, Clone: Z5H-2/Z2A, Invitrogen™ ...
We delivered tumor antigens i.m. as polymer-based formulations of a plasmid DNA encoding the antigens, followed by ... T cells against these antigens, raising the possibility that immune response against some differentiation antigens may not be ... Antigen-encoding DNA can apparently be admixed in the same formulation with PVP and inoculated i.m. without the need to ... Zeh H. J., III, Perry-Lalley D., Dudley M. E., Rosenberg S. A., Yang J. C. High avidity CTLs for two self-antigens demonstrate ...
The purpose of this study was to determine whether phosphorylation has an effect on the characteristics of the 60 kD Ro antigen ... Cell extracts of synchronized HEp-2 cells were phosphorylated in vitro with exogenous ATP, exam ... Previous Document: Detection of antibodies to HIV-1 gp41- and HLA class II antigen-derived peptides in SLE patients.. Next ... The purpose of this study was to determine whether phosphorylation has an effect on the characteristics of the 60 kD Ro antigen ...
  • They both are secreted to semen inside seminal vesicles and then are rapidly degraded by the prostate specific antigen (PSA, a.k.a. kallikrein peptidase) to small peptides. (nature.com)
  • ABSTRACT: Despite the impact of prostate-specific antigen (PSA) testing on the detection and management of prostate cancer, controversy about its usefulness as a marker of disease activity continues. (cancernetwork.com)
  • In part 1 of this article , which was published in the August issue, we focused on the physiology of prostate-specific antigen (PSA), its measurement and use in clinical practice, and its predictive value following radical prostatectomy and radiation therapy. (cancernetwork.com)
  • Prostate-specific antigen (PSA) and human glandular kallikrein 2 (hK2) are glandular kallikreins secreted by the prostate gland. (lu.se)
  • Prostate cancer targeted peptide prodrugs that are activated by the serine protease activity of prostate-specific antigen (PSA) are under development in our laboratory. (aacrjournals.org)
  • If the target antigen (nucleocapsid protein) is present in sufficient concentrations in the sample, it will bind to specific antibodies and generate a visually detectable signal on the test strip, typically with results ready in 15 minutes. (globenewswire.com)
  • 1 This test is another important addition to the testing options for SARS-CoV-2 at the point of care, following the launch of the SARS-CoV-2 Rapid Antibody Test, in July 2020, that is helping healthcare professionals identify patients that have developed antibodies against SARS-CoV-2, indicating prior infection. (globenewswire.com)
  • THURSDAY, Aug. 8 (HealthDay News) -- The first rapid test to detect the HIV-1 antigen, as well as blood antibodies for the HIV-1 and HIV-2 strains, has been approved by the U.S. Food and Drug Administration. (medicinenet.com)
  • Detection of the HIV-1 antigen may allow doctors to diagnose the viral infection earlier than detection of the antibodies alone, the FDA said. (medicinenet.com)
  • The spike glycoprotein of SARS-CoV-2 has been identified as a key target for protective antibodies that could be part of a vaccine. (scienceboard.net)
  • The RBD-immune sera showed better functional activity than the other vaccine antigens as a result of higher affinity antibodies after the second vaccination. (scienceboard.net)
  • The recombinant RBD induced high-titer antibodies focused primarily to the receptor binding motif and predominantly binding long epitope sequences (likely conformational epitopes), unlike the other antigens. (scienceboard.net)
  • Detection of antibodies to HIV-1 gp41- and HLA class II antigen-derived peptides in SLE patients. (biomedsearch.com)
  • In the current study, the antibodies reacting with a subset of antigens in the 10-21-kD range were eluted from nitrocellulose and used to probe an F. hepatica cDNA library. (ajtmh.org)
  • While serology tests measure the host's immune response to a virus, protein antigen tests are conceptually similar to molecular tests, with the former using antibodies to detect the presence of viral proteins in patient samples and the later using PCR to detect viral nucleic acid. (modernhealthcare.com)
  • Molecular tests have the advantage of amplification provided by PCR, while protein antigen tests are limited by the sensitivity of the antibodies used. (modernhealthcare.com)
  • And while some rapid antigen viral tests have had a reputation for poor performance, the field has made significant strides in recent years, said Nathan Ledeboer, medical director of the microbiology laboratory at the Medical College of Wisconsin and Froedtert Hospital, noting that in particular, use of better antibodies and a move from manual test reading to instrument-based reading have led to substantial improvements in test sensitivity. (modernhealthcare.com)
  • 1980. Monoclonal antibodies to mouse MHC antigens. (springer.com)
  • Antibodies to the H-2Ld antigen, the products of a third polymorphic locus of the mouse major histocompatibility complex. (springer.com)
  • This Db antigen is not recognized by Db-allospecific and Db-restricted cytotoxic T lymphocytes or by most monoclonal antibodies to the native Db. (pnas.org)
  • Longitudinal analysis revealed that anti-SARS-CoV-2 IgA and IgM antibodies rapidly decayed, while IgG antibodies remained relatively stable up to 105 days PSO in both biofluids. (unboundmedicine.com)
  • This study confirms that serum and saliva IgG antibodies to SARS-CoV-2 are maintained in the majority of COVID-19 patients for at least 3 months PSO. (unboundmedicine.com)
  • The COVID-19 Ag Test was developed with antibodies supplied by Public University Corporation Yokohama City University (Kanagawa, Japan, Yokohama City University), which are capable of detecting SARS-CoV-2 antigens. (fujifilm.com)
  • From antigens and antibodies to detection kits, LifeSensors has tools to assist researchers in studying SARS-CoV-2, and we are happy to discuss customizable services and assays as well! (nacalai.co.jp)
  • The COVID-19 IgG ELISA Research Assay is a detection assay for SARS-CoV-2 IgG antibodies. (nacalai.co.jp)
  • A mixture of detection antibodies towards human IgG, IgM and IgA of SARS-CoV-2 creates a colorimetric signal. (nacalai.co.jp)
  • Hepatitis C core antigen can be detected soon after infection, before the development of antibodies to the virus, and remains detectable throughout chronic infection. (hivandhepatitis.com)
  • A rapid point-of-care test for HCV antigen that could be used by health care workers in the same way as point-of-care tests for HIV or HCV antibodies was viewed as the highest priority for improving HCV diagnosis, and a feasible target for product development by a recent stakeholder consultation convened by the Forum for Collaborative HIV Research and the Foundation for Innovative Diagnostics (FIND). (hivandhepatitis.com)
  • However, viral RNAs are much less stable during transport and storage than proteins such as antigens and antibodies. (flutrackers.com)
  • In this study, we designed and developed a novel rapid detection method for SARS-CoV-2 spike 1 (S1) protein using the SARS-CoV-2 receptor ACE2, which can form matched pairs with commercially available antibodies. (flutrackers.com)
  • The development will use antibodies that can detect SARS-CoV-2 antigens, to be supplied by the Public University Corporation Yokohama City University (Kanagawa, Japan). (fujifilm.eu)
  • The aim of the project is to construct recombinant BCG strains that express viral protein(s) of the SARS-CoV-2 virus in fusion with the 6 kD early secreted antigenic target (ESAT-6), secreted by the type VII secretion systems. (pasteur.fr)
  • The SARS-CoV-2 Rapid Antigen Test for self testing is a rapid chromatographic immunoassay for the qualitative detection of the nucleocapsid protein of SARS-CoV-2 present in human nasal specimens. (globenewswire.com)
  • Thus, correction of bacterial proteolytic imbalance in the small intestine may constitute a new therapeutic target to prevent or ameliorate food sensitivities triggered by specific protein antigens. (nature.com)
  • In an Australian first, scientists at the University of Technology Sydney (UTS) have used novel optical technology to design a highly sensitive saliva test for the SARS-CoV-2 virus antigens, or viral protein fragments. (news-medical.net)
  • The technology is sensitive enough to detect the presence of as little as a trillionth of a gram of SARS-CoV-2 viral protein. (news-medical.net)
  • Professor Jin said his team's goal is detection of the presence of SARS-CoV-2 viral protein when a person has yet to show symptoms but is highly infectious. (news-medical.net)
  • Consequently, multiple versions of the SARS-CoV-2 spike protein are currently under evaluation as vaccine candidates using a variety of modalities and delivery systems. (scienceboard.net)
  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Claudin-2. (fishersci.com)
  • RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV The Claudin-2 Recombinant Protein Antigen is derived from E. coli. (fishersci.com)
  • The Claudin-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition. (fishersci.com)
  • Early prostate cancer antigen-2 (EPCA-2) is a protein of which blood levels are elevated in prostate cancer. (wikipedia.org)
  • Leman, Getzenberg and colleagues describe, in the April 2007 issue of Urology, the performance characteristic of EPCA-2, a novel nuclear protein marker for prostate cancer cells. (wikipedia.org)
  • A study was initiated which suggested that the EPCA-2 protein serum assay exhibits favorable performance characteristics which are potentially superior to serum PSA. (wikipedia.org)
  • The Epstein-Barr virus nuclear antigen 2 (EBNA-2) is one of the six EBV viral nuclear proteins expressed in latently infected B lymphocytes is a transactivator protein. (wikipedia.org)
  • Protein-based antigen testing has received relatively less attention, but their rapid turnaround time, ease of use, and amenability to large scale production, could prove valuable for addressing the outbreak . (modernhealthcare.com)
  • Surprisingly, J kappa does not bind to the J kappa 1 heptamer recombination signal sequence (CACTGTG), and its prior identification as a heptamer binding protein was most likely due to the addition of a BamHI restriction site to the native heptamer creating a near EBNA-2 response element consensus (CACTGTGGGAT). (pnas.org)
  • Here, we profiled by enzyme-linked immunosorbent assays (ELISAs) IgG, IgA and IgM responses to the SARS-CoV-2 spike protein (full length trimer) and its receptor-binding domain (RBD) in serum and saliva of acute and convalescent patients with laboratory-diagnosed COVID-19 ranging from 3-115 days post-symptom onset (PSO), compared to negative controls. (unboundmedicine.com)
  • The variant 2 differs from variant 1 in the 5' UTR, but encodes the same protein. (atlasgeneticsoncology.org)
  • Detection of histidine rich protein 2 and panmalarial ICT Malaria Pf/Pv test antigens after chloroquine treatment of uncomplicated falciparum malaria does not reliably predict treatment outcome in eastern Indonesia. (ajtmh.org)
  • Antigen Express scientists, and others, have shown clearly that suppression of expression of the Ii protein in cancer cells allows for potent stimulation of T-helper cells and prevents the further growth of cancer cells. (bio-medicine.org)
  • Cellex is currently in the midst of clinical trials for its rapid antigen test that detects the nucleocapsid protein found on the SARS-CoV-2 virus from nasal swab samples. (aacc.org)
  • It encodes several virulence-associated components including a type III protein secretion and translocation system (TTS), * the surface exposed adhesin YadA, anti-host effector proteins, which are probably injected by a needle-like mechanism into the cytosol of target cells ( 2 ), and proteins which are released into the environment ( 1 , 3 ). (rupress.org)
  • The virulence- (V-) antigen is a released multifunctional protein ( 4 , 5 ). (rupress.org)
  • The S Protein RBD represents a valuable tool for drug discovery programs targeting SARS-CoV-2 infection. (nacalai.co.jp)
  • The SARS Nucleocapsid Protein Antibody recognizes and binds to both SARS-CoV and SARS-CoV-2 nucleocapsid proteins. (nacalai.co.jp)
  • This high-throughput method is based on the use of a capture antibody for trapping SARS-CoV-2 nucleocapsid protein on the plate followed by the use of a detection antibody to generate a colorimetric signal. (nacalai.co.jp)
  • This high-throughput method is based on the use of SARS-CoV-2 nucleocapsid protein. (nacalai.co.jp)
  • Epstein-Barr virus nuclear antigen 2 transactivates latent membrane protein LMP1. (asm.org)
  • Several lines of evidence are compatible with the hypothesis that Epstein-Barr virus (EBV) nuclear antigen 2 (EBNA-2) or leader protein (EBNA-LP) affects expression of the EBV latent infection membrane protein LMP1. (asm.org)
  • Earlier studies demonstrated that acute administration of cocaine up-regulates the immediate-early gene fos-related antigen 2 (fra-2) followed by a later up-regulation of σ 1 receptor gene and protein levels in brain regions involved in addiction and reward. (aspetjournals.org)
  • Using a cocaine-induced behavioral sensitization model coupled with gene and protein expression studies in mice, the results show that cocaine induces the expression of fra-2, which leads to a progressive increase in σ 1 receptor gene and protein expression over a period of days. (aspetjournals.org)
  • The cocaine-induced changes in fra-2 and σ 1 receptor gene and protein expression occur in brain regions that subserve drug abuse, such as the cortex, striatum, and hippocampus, but not the cerebellum. (aspetjournals.org)
  • It is now becoming clear, however, that the regulation of transcription elongation in addition to initiation by EBNA 2, at least in part through CDK9 (cyclin-dependent kinase 9)-dependent phosphorylation of the RNA polymerase C-terminal domain, is likely to play a crucial role in the mechanism of action of this key viral protein. (biochemsoctrans.org)
  • In addition, western blot analysis demonstrated that the protein level of bone marrow stromal antigen‑2 (BST‑2) was downregulated by TGN. (spandidos-publications.com)
  • Bone marrow stromal antigen 2 (BST-2), also referred to as CD317, tetherin and HM1.24 is a multifunctional protein. (spandidos-publications.com)
  • Another study indicated that a non-canonical autophagy pathway reminiscent of microtubule-associated protein light chain 3 (LC3)-associated phagocytosis contributes to viral protein U counteraction of BST-2 restriction ( 15 ). (spandidos-publications.com)
  • We carried out studies to investigate the specific cell types synthesizing CTLA-2α protein in mouse embryo and examine its cellular localization. (ajol.info)
  • 1977. Histocompatibility antigen-activatedcytotoxic T-lymphocytes. (springer.com)
  • 1985. Polymorphism of murine major histocompatibility class I antigens: Assignment of putative allodeterminants to distinct positions of the amino acid sequence within the first external domain of the antigen. (springer.com)
  • beta 2-Microglobulin (beta 2m) has been thought essential for transport of all major histocompatibility complex class I antigens to the cell surface. (pnas.org)
  • A Phase 1 Randomized, Observer-Blinded, Dose-Ranging Study to Evaluate the Immunogenicity and Safety of Monovalent A/Indonesia/05/05 (H5N1) Virus-Like Particle (VLP) Avian Influenza Antigen (Recombinant) in Healthy Young Adults With and Without Adjuvant 2. (clinicaltrials.gov)
  • IFN Regulatory Factor-2 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 133 amino acids (1-113) with a His Tag of 20 aa, and having a molecular mass of 15 kDa. (prospecbio.com)
  • Purified or recombinant in vitro-translated J kappa binds to the MNYYGTGGGAA EBNA-2 response element sequence and interacts with EBNA-2. (pnas.org)
  • Here we report that recombinant LcrV signals in a CD14- and toll-like receptor 2 (TLR2)-dependent fashion leading to immunosuppression by interleukin 10 induction. (rupress.org)
  • iv) No other EBV genes were required for EBNA-2 transactivation of LMP1 since cotransfection of recombinant EBNA-2 expression vectors and genomic LMP1 DNA fragments enhanced LMP1 expression in the EBV-negative B-lymphoma cell lines BJAB, Louckes, and BL30. (asm.org)
  • In assays using recombinant antigen, purified virus, virus in tissue culture fluid or diluted in a "simple" buffer (PBS/BSA), the analytical sensitivity is ~150 pg/ml. (acris-antibodies.com)
  • Expressed recombinant CTLA-2α is shown to exhibit selective inhibition to cathepsin L and is localized in the uterus during pregnancy where it is implicated in embryo plantation and development. (ajol.info)
  • The test is a reliable rapid test for the qualitative detection of a specific SARS-CoV-2 antigen in nasal swab samples.This rapid antigen test collects the sample from the front area of the nose instead of the nasopharynx, resulting in a simplified and more comfortable sampling procedure. (globenewswire.com)
  • Roche's SARS-CoV-2 Rapid Antigen Test is a rapid chromatographic immunoassay intended for the qualitative detection of a specific antigen of SARS-CoV-2 present in human nasopharynx. (globenewswire.com)
  • The assay is available in Japan as a stand-alone detection tool for the presence of SARS-CoV-2 virus. (news-medical.net)
  • This article addresses recent information concerning the emergence of hepatitis B surface antigen (HBsAg) mutants, their impact on viral antigen presentation, latest prevalence data, and discussion of the issues associated with detection of mutants in healthcare settings. (cdc.gov)
  • This product has been authorized only for the detection of proteins from SARS-CoV-2, not for any other viruses or pathogens. (biospace.com)
  • To reliably predict treatment outcome with rapid antigen tests, further development appears necessary to improve sensitivity for viable asexual parasites while avoiding detection of both gametocytes and persistent antigen in convalescence. (ajtmh.org)
  • Screening for the virus with either nucleic acid amplification tests (NAATs) or antigen tests is an effective administrative control for early detection of individuals with COVID-19 and allows employers to take steps to prevent workplace spread. (cdc.gov)
  • Worldwide, nearly 100 companies are developing or manufacturing tests for antigen detection [6-7]. (cdc.gov)
  • Today we can provide further support for the early detection of COVID-19, through a rapid antigen test that can provide a highly sensitive result for early detection. (fujifilm.com)
  • When the complex is captured by an antibody which is coated beforehand along a detection line, the line manifests color, indicating a positive result (containing antigens). (fujifilm.com)
  • Point-of-care antigen and molecular tests to detect current SARS-CoV-2 infection have the potential to allow earlier detection and isolation of confirmed cases compared to laboratory-based diagnostic methods, with the aim of reducing household and community transmission. (nih.gov)
  • The COVID-19 Nucleocapsid ELISA Assay is a detection tool for SARS-CoV-2. (nacalai.co.jp)
  • The control line (C) determines whether the test is valid and a colored test line (T) indicates the detection of antigens specific to SARS-CoV-2. (knowyourbodybest.com)
  • In a letter to health care providers that is current as of 11/3/2020, the U.S. Food and Drug Administration (FDA) is alerting clinical laboratory staff and health care providers that false-positive results can occur with antigen tests, including when users do not follow the instructions for use of antigen tests for the rapid detection of SARS-CoV-2. (worldhealth.net)
  • Generally, antigen tests are indicated for the qualitative detection of SARS-CoV-2 antigens in authorized specimen types collected from individuals who are suspected of COVID-19 by their healthcare provider within a certain number of days of symptom onset. (worldhealth.net)
  • The Hunan Jynda ELISA had the lowest sensitivity (59.5%), and the authors concluded that ELISA assays are probably a less reliable technology for HCV antigen detection than assays which use signal amplification that allows enhancement of antigen detection. (hivandhepatitis.com)
  • The COVID-19 Coronavirus Real Time PCR Kit is a real-time fluorescent RT-PCR based assay intended for the qualitative detection of SARS-CoV-2 nucleic acid in nasopharyngeal swabs, oropharyngeal (throat) swabs, anterior nasal swabs, mid-turbinate nasal swabs, nasal aspirates, nasal washes, bronchoalveolar lavage (BAL) fluid and sputum from individuals who are suspected of COVID-19 by their healthcare provider. (linscottsdirectory.com)
  • van Ewijk W., Jenkinson E.J., van Soest P.L., Owen J.J.T. (1982) Detection of MHC, Thy-1, Lyt-1 And Lyt-2 Antigens in the Developing Mouse Thymus. (springer.com)
  • Although antigen immunoassays are stable diagnostics for detection of past infection, infection progress, and transmission dynamics, no matched antibody pair for immunoassay of SARS-CoV-2 antigens has yet been reported. (flutrackers.com)
  • Virusys has developed a highly sensitive and specific enzyme immunoassay for the detection of Influenza A nucleoprotein antigen in complex sample matrices derived from both human and veterinary sources. (acris-antibodies.com)
  • The Virusys Influenza B Nucleoprotein Antigen Detection ELISA also incorporates proprietary diluents that are designed to prevent the development of nonspecific signal derived from complex sample matrix effects or the nonspecific adsorption of reactive test components resulting in both high sensitivity and specificity. (acris-antibodies.com)
  • This test is part of a partnership with SD Biosensor Inc., with whom Roche has also launched a SARS-CoV-2 Rapid Antibody Test in July and two SARS-CoV-2 Rapid Antigen Tests for professional use in September 2020 and February 2021. (globenewswire.com)
  • To evaluate vaccine-induced antibody responses in an animal model, researchers from the Center for Biologics Evaluation and Research at the U.S. Food and Drug Administration (FDA) immunized rabbits with several SARS-CoV-2 spike proteins. (scienceboard.net)
  • Specifically, the team wanted to gain a better understanding of the humoral immune response generated by different vaccine antigens, including antibody epitope repertoire, antibody binding affinity, and functional activity. (scienceboard.net)
  • The researchers suggested that it is important to assess antibody affinity maturation during SARS-CoV-2 vaccine trials, as it will provide a more complete picture of the immune response than antibody binding titers and virus neutralization alone. (scienceboard.net)
  • Measurement of HAI antibody seroconversion rates and GMT achieved by a constant H5N1 VLP antigen dose alone and in combination with Adjuvant 2. (clinicaltrials.gov)
  • While the antibody response to SARS-CoV-2 has been extensively studied in blood, relatively little is known about the antibody response in saliva and its relationship to systemic antibody levels. (unboundmedicine.com)
  • Anti-SARS-CoV-2 antibody responses were readily detected in serum and saliva, with peak IgG levels attained by 16-30 days PSO. (unboundmedicine.com)
  • The QIAreach™ SARS-CoV-2 Antigen Test, developed in partnership with the Australian digital diagnostics company Ellume, sets new standards in scalability, validation and flexibility by processing more than 30 swab samples per hour, providing digital test results that do not require subjective interpretation, and allowing antibody tests to run simultaneously with antigen tests. (biospace.com)
  • There are no publications for Listeria monocytogenes antigen 2 Antibody (NBP2-54651). (novusbio.com)
  • Be the first to review our Listeria monocytogenes antigen 2 Antibody (2:4 E10) and receive a gift card or discount. (novusbio.com)
  • The launch is a partnership with SD Biosensor Inc., with whom Roche has also launched a SARS-CoV-2 Rapid Antibody Test in July and a SARS-CoV-2 Rapid Antigen Test in September 2020. (roche.com)
  • Tests for core antigen do not require molecular testing equipment and currently available tests can be carried out in any laboratory that can do antibody testing. (hivandhepatitis.com)
  • This is the first study to detect SARS-CoV-2 S1 antigen using an LFIA with matched pair consisting of ACE2 and antibody. (flutrackers.com)
  • OTCQX: RHHBY) today announced it has been granted special approval by the German Federal Institute for Drugs and Medical Devices (BfArM) to offer the SARS-CoV-2 Rapid Antigen Test using a simple nasal swab for patient self-testing in Germany. (globenewswire.com)
  • In a self-testing clinical study, the SARS-CoV-2 Rapid Antigen Test showed a sensitivity of 82.5% and a specificity of 100.0% when compared to RT-PCR testing. (globenewswire.com)
  • OTCQX: RHHBY) announced today that it will launch a SARS-CoV-2 Rapid Antigen Test, in late September, for markets accepting the CE Mark. (globenewswire.com)
  • The SARS-CoV-2 Rapid Antigen Test is for use in point of care settings for both symptomatic and asymptomatic people. (globenewswire.com)
  • The SARS-CoV-2 Rapid Antigen Test is performed by healthcare professionals in a number of different settings close to the patient. (globenewswire.com)
  • OTCQX: RHHBY) today announced it has obtained the CE mark for its new SARS-CoV-2 Rapid Antigen Test Nasal. (roche.com)
  • In comparison to the existing Roche SARS-CoV-2 Rapid Antigen Test, the SARS-CoV-2 Rapid Antigen Test Nasal collects the sample from the front area of the nose instead of the nasopharynx, resulting in a simplified and faster testing procedure 1 . (roche.com)
  • The SARS-CoV-2 Rapid Antigen Test Nasal provides patients with a more comfortable testing experience. (roche.com)
  • Why Choose Sars-COV-2 Rapid Antigen Test Kit? (knowyourbodybest.com)
  • Antigen tests are currently authorized to be performed on nasopharyngeal or nasal swab specimens placed directly into the assay's extraction buffer or reagent. (cdc.gov)
  • The Fujifilm rapid antigen test uses nasopharyngeal swab samples and can be performed within the community as well as clinical settings, which enables a faster result than the current laboratory tests. (fujifilm.com)
  • 2 Immunochromatography is a testing method in which a specimen (e.g. nasopharyngeal swab) is processed in a reagent. (fujifilm.eu)
  • Business Manager Laboratorium Kimia Farma Jl Kartini Medan, PM (45), diduga berperan sebagai penanggung jawab laboratorium dan yang menyuruh melakukan penggunaan cotton buds swab antigen bekas. (detik.com)
  • Dari hasil pemeriksaan saksi-saksi, kegiatan penggunaan cotton buds swab antigen bekas tersebut mulai dilakukan oleh karyawan dari Laboratorium Kimia Farma yang berlokasi di Jalan RA Kartini, Kelurahan Madras Hulu, Kecamatan Medan Polonia, Medan, sejak 17 Desember 2020. (detik.com)
  • Yang menyuruh melakukan pendaurulangan atau penggunaan cotton buds swab antigen adalah PM selaku BM kepada karyawan yang bekerja di Laboratorium Kimia Farma Bandara Kualanamu dan kepada SR selaku kurir serta DP (CS di laboratorium)," sebut Panca kepada wartawan, Kamis (29/4/2021). (detik.com)
  • An antigen test detects proteins which are structural or functional components of a pathogen and are very specific to that pathogen 2 . (globenewswire.com)
  • Сancer-testis antigens (CTAs) comprise proteins which are aberrantly expressed in various malignancies, yet under normal situation are restricted to only germ cells. (nature.com)
  • However, the biological role of both SEMG1 and 2 proteins in tumorigenesis has not been fully understood. (nature.com)
  • Semenogelins 1 and 2 are referred to Cancer-Testis Antigens (CTAs) and represent a group of proteins which are frequently expressed in various neoplasms but normally are restricted to germ cells 1 . (nature.com)
  • Semenogelins 1 and 2 (SEMG1 and 2, respectively) are the most abundant proteins of human sperm. (nature.com)
  • June 9, 2020 -- Different proteins associated with SARS-CoV-2, the virus that causes COVID-19, generate unique immune responses when given to rabbits as immunizations, according to a June 8 Science Translational Medicine article. (scienceboard.net)
  • These antigens are mainly melanoma/ melanocyte differentiation antigens, although mutated intracellular proteins can also serve as antigens. (nih.gov)
  • We report that all the signals responsible for PI anchoring of Qa-2 Ag are confined to the 36 C-terminal residues of the precursor proteins. (jimmunol.org)
  • Blood-group antigens are generally defined as molecules formed by sequential addition of saccharides to the carbohydrate side chains of lipids and proteins detected on erythrocytes and certain epithelial cells. (fishersci.com)
  • The SARS-CoV-2 genome encodes several non-structural proteins including the Spike glycoprotein (S glycoprotein), which plays a crucial role in the infection of the host. (nacalai.co.jp)
  • Using fluorescence-based dihydroethidium (DHE) assay we showed that both SEMGs augmented the production of reactive oxygen species (ROS) up to 2 times. (nature.com)
  • Fujirebio Diagnostics, Inc., a consolidated subsidiary of H.U. Group Holdings, Inc, announced today the initiation of clinical testing needed for the submission of its new SARS-CoV-2 Antigen assay for EUA (Emergency Use Authorization) from the U.S. Food and Drug Administration. (news-medical.net)
  • The Lumipulse SARS-CoV-2 Antigen assay will be available for use on the LUMIPULSE G1200 instrument. (news-medical.net)
  • On June 19, Fujirebio Inc. (Tokyo) received Japanese regulatory approval of the SARS-CoV-2 Antigen assay for use with nasopharyngeal and saliva samples. (news-medical.net)
  • The researchers found that sera generated by S1+S2 ectodomain, S1 domain, and RBD showed virus neutralization of 50%-60% in a SARS-CoV-2-FBLuc single-cycle pseudovirus neutralization assay in Vero E6 cells after a single vaccination, and 93%-98% after two vaccinations. (scienceboard.net)
  • For each lot of IPOL vaccine, D-antigen content is determined in vitro using the D-antigen ELISA assay. (nih.gov)
  • The study found that 2 assays -- the Abbott ARCHITECT HCV Ag assay and the Ortho HCV Ag ELISA -- almost matched nucleic acid testing in sensitivity and specificity when HCV viral load was above 3000 IU/mL. (hivandhepatitis.com)
  • Search, find, compare suppliers for SARS CoV 2 Antigen PCR Assay products. (linscottsdirectory.com)
  • This study was designed to define the clinical potential of the DNA hypomethylating agent 5-aza-2′-deoxycytidine (5-AZA-CdR) in human RCC, through its control of the expression of "therapeutic targets" of the cancer testis antigen (CTA) family, and of the tumor-associated antigen RAGE-1, in RCC cells. (aacrjournals.org)
  • As the first company to develop a fully automated SARS-CoV-2 antigen test, we expect this innovation to have a positive impact on result turnaround times and laboratory throughput of COVID-19 testing. (news-medical.net)
  • The first product candidate utilizing the Company's novel Ii-Key Hybrid technology platform is a HER-2/neu Peptide Vaccine (AE37). (bio-medicine.org)
  • AE37 is derived from a peptide fragment of the human epidermal growth factor receptor 2 (HER2) oncoprotein, which is expressed in a variety of tumors including 75-80% of breast cancers as well as a high percentage of prostate, ovarian and other cancers. (bio-medicine.org)
  • AE37 represents the only HER2-based peptide vaccine currently being studied in a randomized trial and its use is not restricted to patients with a particular type of human leukocyte antigen (HLA) peptide. (bio-medicine.org)
  • A Antigen-peptide-transporter 2 Deficiency anonymous support group with information on diagnosis, treatment, symptoms, along with personal stories and experiences with Antigen-peptide-transporter 2 Deficiency. (experienceproject.com)
  • I Have Antigen-peptide-transporter 2 Deficiency does not have any stories yet. (experienceproject.com)
  • We analyzed the T-cell response in peripheral blood mononuclear cells of 22 HLA-A2-positive patients with CRC and 8 HLA-A2-positive healthy subjects against 3 HLA A2-restricted peptide epitopes of the TAAs Ep-CAM (GLKAGVIAV), her-2/ neu (IISAVVGIL), and CEA (YLSGANLNL). (aacrjournals.org)
  • To enhance delivery and solubility of these prodrugs, macromolecular carriers consisting of N -(2-hydroxypropyl) methacrylamide (HPMA)-based copolymers were covalently coupled to a PSA-activated peptide prodrug. (aacrjournals.org)
  • On 13 March 2020 we received FDA Emergency Use Authorization for a high-volume molecular test to detect SARS-CoV-2, the virus that causes COVID-19, which is also available in countries accepting the CE Mark. (globenewswire.com)
  • Molecular signals for phosphatidylinositol modification of the Qa-2 antigen. (jimmunol.org)
  • The specificity of a Fasciola -specific anti-arc 2 antiserum, evaluated by Western blot analysis, reveals a mosaic of antigens with molecular weights in the range of 10-43 kD. (ajtmh.org)
  • The studies show that molecular cloning technology can be used to identify potential genes, each of which encode distinct antigens that may be used for the specific immunodiagnosis of fascioliasis. (ajtmh.org)
  • 1986. Evaluation of the structure function relationships of MHC class I antigens by molecular genetic techniques. (springer.com)
  • To assess the diagnostic accuracy of point-of-care antigen and molecular-based tests to determine if a person presenting in the community or in primary or secondary care has current SARS-CoV-2 infection. (nih.gov)
  • We included test accuracy studies of any design that evaluated antigen or molecular tests suitable for a point-of-care setting (minimal equipment, sample preparation, and biosafety requirements, with results available within two hours of sample collection). (nih.gov)
  • We pooled data using the bivariate hierarchical model separately for antigen and molecular-based tests, with simplifications when few studies were available. (nih.gov)
  • We identified data for eight commercial tests (four antigen and four molecular) and one in-house antigen test. (nih.gov)
  • Moreover, the prototypic σ 1 receptor antagonist 1-[2-(3,4-dichloropheny)ethyl]-4-methylpiperazine (BD1063) significantly attenuates both the molecular adaptations and behavioral sensitization induced by cocaine. (aspetjournals.org)
  • Antigen tests are immunoassays that detect the presence of a specific viral antigen, which implies current viral infection. (cdc.gov)
  • Accumulation of data on the performance of antigen tests in different situations has helped guide the use of these tests as screening tests in asymptomatic people to detect or exclude SARS-CoV-2 infection. (cdc.gov)
  • A rapid antigen test can reliably detect individuals with a high viral load allowing healthcare professionals to quickly identify those patients at the greatest risk of spreading the infection. (globenewswire.com)
  • The Alere Determine HIV-1/2 Ag/Ab Combo test can detect these markers for the AIDS-causing virus in human serum, plasma and blood specimens, the agency said in a news release. (medicinenet.com)
  • In addition, a recent landmark RADx-funded study demonstrated that the serial use of diagnostic tests (at least twice per week), including rapid antigen tests, increased the ability to detect infection 3 . (biospace.com)
  • Frankfurt Prime Standard: QIA) has started commercialization of a portable digital test in the United States that can be used by laboratories to detect SARS-CoV-2 antigens in people with active infections in 2-15 minutes. (biospace.com)
  • This test is intended to detect antigen from SARS‑CoV‑2 in individuals suspected of COVID‑19 or with known or suspected exposure to SARS‑CoV‑2. (roche.com)
  • Our findings will be helpful to detect the S1 antigen of SARS-CoV-2 from COVID-19 patients. (flutrackers.com)
  • ELISARange: 0.5-100 ng/ml.Sensitivity: 0.3 ng/ml.Sample volume: 100 ul.Suitable for use with Zebrafish plasma samples.3-h protocol.Store at 2-8 C. Categ. (bio-medicine.org)
  • 1 In addition, it serves as a valuable initial screening test for individuals that have been exposed to SARS-CoV-2 infected patients or a high risk environment.The test has a sensitivity of 96.52% and a specificity of 99.68%, based on 426 samples from two independent study centers. (globenewswire.com)
  • Main outcome measures Sensitivity, specificity, and positive and negative predictive values of Veritor System (Beckton Dickinson) and Biosensor (Roche Diagnostics) rapid antigen tests, with reverse-transcriptase polymerase chain reaction (RT-PCR) testing as reference standard. (bmj.com)
  • When a viral load cut-off was applied for infectiouness (≥5.2 log10 SARS-CoV-2 E gene copies/mL), the overall sensitivity was 90.1% (84.2% to 94.4%) for Veritor and 86.8% (78.1% to 93.0%) for Biosensor, and 88.1% (80.5% to 93.5%) for Veritor and 85.1% (74.3% to 92.6%) for Biosensor, among those who remained asymptomatic throughout. (bmj.com)
  • The system has been adopted by numerous medical institutions in Japan as a high-sensitivity antigen test capable of detecting viruses even when viral load is low at the onset of a disease. (fujifilm.com)
  • The review, published in Annals of Internal Medicine on 20 June , compared the sensitivity and specificity of 5 commercially available tests for hepatitis C core antigen compared to nucleic acid testing for HCV RNA. (hivandhepatitis.com)
  • Less evidence was available regarding 2 other assays, the Eiken Lumispot and the Fujirebio Lumipulse, which use the same processes as Abbott ARCHITECT, and these studies reported on sensitivity only. (hivandhepatitis.com)
  • The disease is further characterized by autoantibodies to transglutaminase 2 that have extraordinary high disease specificity and sensitivity. (nih.gov)
  • Despite these advantages, antigen tests have lower sensitivity than PCR tests. (fujifilm.eu)
  • The system has been adopted by numerous medical institutions in Japan as a high-sensitivity antigen test capable of detecting viruses and bacteria even when viral or bacterial load is low at the onset of a disease, and producing fast results within 15 minutes. (fujifilm.eu)
  • In this case, the test would provide a qualitative "yes/no" answer on the presence of the antigen in the patient sample and can be offered as a rapid strip test that is performed at the point of care. (globenewswire.com)
  • A prospective cohort study reassortant influenza A(H5N8) viruses in domestic ducks, comparing a rapid antigen test with quantitative reverse eastern China. (cdc.gov)
  • At launch, there will be 40 million SARS-CoV-2 Rapid Tests available, per month. (globenewswire.com)
  • The rapid antigen test collects saliva in a cartridge placed in an existing hand-held device, first developed by West Australian company Alcolizer for illicit drug testing. (news-medical.net)
  • Objective To assess the diagnostic test accuracy of two rapid antigen tests in asymptomatic and presymptomatic close contacts of people with SARS-CoV-2 infection on day 5 after exposure. (bmj.com)
  • 95%, for both rapid antigen tests in all analyses. (bmj.com)
  • Conclusions The sensitivities of both rapid antigen tests in asymptomatic and presymptomatic close contacts tested on day 5 onwards after close contact with an index case were more than 60%, increasing to more than 85% after a viral load cut-off was applied as a proxy for infectiousness. (bmj.com)
  • FRANKLIN LAKES, N.J. , April 1, 2021 /PRNewswire/ -- BD (Becton, Dickinson and Company) (NYSE: BDX), a leading global medical technology company, today announced the U.S. Food and Drug Administration (FDA) has granted Emergency Use Authorization (EUA) for its rapid antigen test to be used for SARS-CoV-2 screening through serial testing of asymptomatic individuals. (biospace.com)
  • Articles and studies in multiple peer-reviewed publications including the New England Journal of Medicine 1 and the British Medical Journal 2 have touted the benefits of serial, rapid antigen testing. (biospace.com)
  • While viral testing using the more sensitive NAATs usually requires laboratory testing, rapid antigen tests that require fewer resources can play an important role in efforts to stop the spread of SARS-CoV-2 in the workplace. (cdc.gov)
  • These rapid antigen tests are being used widely in schools, at various mass gatherings, and by sports organizations [2-5]. (cdc.gov)
  • To improve at-home SARS-CoV-2 testing, Gauss, a healthcare computer applications company, and Cellex, a biotechnology company specializing in point-of-care testing, have teamed to develop the first-ever rapid, at-home and point-of-care SARS-CoV-2 antigen test. (aacc.org)
  • The integration of Cellex's accurate, at-home rapid antigen test with Gauss's mobile app offers a scalable solution to significantly reduce transmission of COVID-19 and help society mitigate the impacts of the pandemic until a vaccine is widely available," said Siddarth Satish, Gauss founder and CEO. (aacc.org)
  • Amidst the global COVID-19 pandemic, rapid antigen test kits can be used not only for diagnostic purposes at medical institutions but also in periodic testing on workers at medical and aged-care facilities as well as for surveillance purposes at testing labs set up at airports and various event venues. (fujifilm.com)
  • Sars Covid-19 antigen rapid test kits are now available at bodybest.com. (knowyourbodybest.com)
  • Rapid onset of asymmetric acute flaccid paralysis occurs in 0.1% to 2% of infections, and residual paralytic disease involving motor neurons (paralytic poliomyelitis) occurs in approximately 1 per 1,000 infections. (nih.gov)
  • If you are looking at purchasing this product in bulk, please contact our customer services team on 01952 288 999 to take advantage of the pricing below for PH/200 - Roche SARS-CoV-2 (Covid-19) Rapid Antigen Test x 25. (spservices.co.uk)
  • The SARS-CoV-2 (Covid-19) Rapid Antigen Test enables fast decision making in regard to whether patients need to be put into quarantine, reducing the risk of further spreading. (spservices.co.uk)
  • Antigen tests are one tool in this arsenal and are available as point-of-care diagnostics, with a rapid turnaround time. (naccho.org)
  • Antigen tests can be useful in the swift implementation of infection prevention and control strategies and federal officials have distributed these rapid, point of care tests to thousands of nursing homes across the country. (naccho.org)
  • The Fujifilm Group has contributed to making SARS-CoV-2 testing faster by supplying PCR test reagents and the reagents for use with the fully-automated immunoassay system "μTASWako g1," *5 capable of performing simple and rapid PCR testing in full automation. (fujifilm.eu)
  • Semenogelins 1 and 2 (SEMG1 and 2, respectively) belong to the family of non-X-linked (autosomal) cancer-testis antigens. (nature.com)
  • Updated footnotes for the Antigen Test Algorithm for Congregate Living Settings. (cdc.gov)
  • This interim guidance is intended for healthcare providers who order antigen tests, receive antigen test results, or perform point-of-care testing, as well as for laboratory professionals who perform antigen testing in a laboratory setting or at the point-of-care and report those results. (cdc.gov)
  • Proper interpretation of both antigen test results and NAATs (when indicated) is important for accurate clinical management of patients or people with suspected COVID-19, or for identification of infected people when used for screening. (cdc.gov)
  • As a leading provider of immunoassays to the diagnostic industry, Fujirebio, as a global team, is joining the fight to combat the COVID-19 pandemic with the goal of providing the first fully automated antigen test. (news-medical.net)
  • In September 2008 the industry sponsor of EPCA-2, Onconome sued Dr Robert Getzenberg, JHU, and the University of Pittsburgh, his previous institution, claiming that Getzenberg misrepresented and falsified data related to EPCA-2 after Onconome sponsored 13 million dollars of research over five years in Getzenberg's labs at University of Pittsburgh and Johns Hopkins for a blood test for prostate cancer. (wikipedia.org)
  • For instance, Bethlehem, Pennsylvania-based diagnostics firm OraSure Technologies, which is developing a SARS-CoV-2 antigen test, sells at-home antigen tests for HIV over-the-counter purchase in national pharmacies like Walgreens and CVS. (modernhealthcare.com)
  • The company plans to develop a SARS-CoV-2 that, like its HIV test, will be suitable for home use and can provide results in under an hour, Tang said. (modernhealthcare.com)
  • Nanomix CEO David Ludvigson said his company anticipated submitting its antigen test to FDA for emergency use authortization in around six weeks. (modernhealthcare.com)
  • The movement of large in vitro diagnostic players like Roche, BD, and Quidel into the space could also provide significant antigen test capacity. (modernhealthcare.com)
  • To test our previous hypothesis that the segment between amino acid position 63 to 73 of the H-2D d antigen forms a major allo-antigenic site, mutations were introduced into the H-2L d gene in a sequential fashion, which replaced the codons for amino acid position 63, 65, 66, 70 and 73 of the H-2L d antigen with those of the H-2D d antigen. (springer.com)
  • QIAGEN has begun marketing and distributing QIAreach™ SARS-CoV-2 Antigen Test in the United States after applying for FDA emergency use authorization (EUA) for symptomatic patients. (biospace.com)
  • QIAreach SARS-CoV Antigen is a fast, digital and easy to use test that makes use of sensitive nanoparticle technology from Ellume. (biospace.com)
  • Negative HRP2 and panmalarial antigen results in convalescence were even less predictive of an adequate clinical response, and false-negative HRP2 and panmalarial antigen test results were found in one-sixth (6 of 37) of recrudescent infections diagnosed by microscopy among patients with late treatment failure. (ajtmh.org)
  • The framework proposed by NIOSH researchers and based on scientific literature recommends that employers consider using an antigen test screening program. (cdc.gov)
  • The partners plan to combine Cellex's antigen test with Gauss' new artificial intelligence mobile application to allow patients to scan and receive test results themselves by using their smartphones. (aacc.org)
  • FUJIFILM Europe GmbH received the CE certificate and thus able to apply the CE mark to and launch an antigen test kit for diagnosis of SARS-CoV-2 * infection. (fujifilm.com)
  • Fujifilm can now confirm that even with SARS-CoV-2 antigen, a highly sensitive antigen test is feasible with the application of silver amplification immunochromatography. (fujifilm.com)
  • The company developed an antigen test kit that can rapidly and sensitively examine the presence of SARS-CoV-2 antigens in specimens, detecting the virus at an early stage and in view of a relatively low viral load. (fujifilm.com)
  • The Fujifilm Group also has contributed to improving SARS-CoV-2 testing by supplying PCR test reagents and the reagents for use with the fully-automated immunoassay system " μTASWako g1 ," *** capable of performing simple and quick PCR testing in full automation (μTASWako g1 and these SARS-CoV-2 reagents are currently available in Japan only. (fujifilm.com)
  • TOKYO, Mar. 30, 2021 ― FUJIFILM Corporation (President: Kenji Sukeno) is pleased to announce that the "FUJIFILM COVID-19 Ag Test" (COVID-19 Ag Test), an antigen test kit for detecting SARS-CoV-2, will be released in Europe early April of 2021. (fujifilm.com)
  • Antigen testing is a quick and easy test method that is expected to be used in an even greater variety of situations. (fujifilm.com)
  • The test is the latest addition to Roche's comprehensive COVID-19 portfolio to support healthcare systems in diagnosing SARS-CoV-2 infection. (roche.com)
  • This test is an aid in detecting antigens from the SARS-CoV-2 virus in individuals suspected of COVID-19. (knowyourbodybest.com)
  • Be aware that the Conditions of Authorization in the antigen Emergency Use Authorizations specify that authorized laboratories are to follow the manufacturer's instructions for use, typically found in the package insert, when performing the test and reading test results. (worldhealth.net)
  • In contrast, currently available HCV antigen tests cost between $10 and $50 per test. (hivandhepatitis.com)
  • FUJIFILM Corporation (President: Kenji Sukeno) has commenced the development of an antigen test kit for diagnosis of SARS-CoV-2 *1 infection. (fujifilm.eu)
  • The company will work to develop a fast and highly-sensitive SARS-CoV-2 antigen test kit and will work to achieve early commercialization. (fujifilm.eu)
  • The company will work on developing an antigen test kit that can rapidly and sensitively examine the presence of SARS-CoV-2 antigens in specimens. (fujifilm.eu)
  • SEMG1/2 gene products regulate the motility and fertility of sperm, as well as provide sperm the antibacterial defense. (nature.com)
  • Mutation and deletion of the STAG2 gene was identified in 5.8% (13/224) of MDS, 10.2% (9/88) of CMML, 6.4% (10/157) of AML, 3.1% (2/64) of CML, and 1.3% (1/77) of MPN: the STAG2 alterations were mostly exclusive with alterations involving other components of cohesin complex (SMC1, SMC3, and RAD21) and were significantly associated with mutations in TET2 , ASXL1 , and EZH2 (Kon et al. (atlasgeneticsoncology.org)
  • Postvaccination sera were analyzed by genome fragment phage display libraries covering the entire spike gene (SARS-CoV-2 GFPDL). (scienceboard.net)
  • EPCA-2" is not the name of a gene. (wikipedia.org)
  • The polymer PVP 3 -based formulations were previously shown to allow a level of gene expression in muscle tissues higher than that of unformulated DNA (10) and thus might increase the immunogenicity by amplifying the antigen load. (aacrjournals.org)
  • The DAM gene family encodes a new group of tumor-specific antigens recognized by human leukocyte antigen A2-restricted cytotoxic T lymphocytes. (wikigenes.org)
  • While this gene overlap may constrain some viral variability, mutant or variant forms have been identified for all 4 genes ( 2 ). (cdc.gov)
  • 1984. H-40, an antigen controlled by an Igh-linked gene and recognized by cytotoxic T-lymphocytes. (springer.com)
  • We show further that a deletion construct of the Db gene, which consists of exon 1 linked to exons 4-8, expresses a truncated Db antigen lacking domains 1 and 2 [Db-(1 + 2)] at the cell surface after transfection into the R1E line. (pnas.org)
  • unexpectedly, Db-(1 + 2) does not associate with beta 2m when the mouse beta 2mb gene is transfected into the R1E transfectant expressing the truncated Db. (pnas.org)
  • v) An EBNA-2-responsive element was found within the -512 to +40 LMP1 DNA since this DNA linked to a chloramphenicol acetyltransferase reporter gene was transactivated by cotransfection with an EBNA-2 expression vector. (asm.org)
  • vii) Two deletions within the EBNA-2 gene which rendered EBV transformation incompetent did not transactivate LMP1, whereas a transformation-competent EBNA-2 deletion mutant did transactivate LMP1. (asm.org)
  • LMP1 is a potent effector of B-lymphocyte activation and can act synergistically with EBNA-2 to induce cellular CD23 gene expression. (asm.org)
  • A gene on chromosome 18p11.2 that encodes cutaneous T-cell lymphoma-associated antigen 1, which is expressed in about 35% of CTCL tumours, including cutaneous T-cell lymphoma, mycosis fungoides and Sezary syndrome. (thefreedictionary.com)
  • The aim of this study is to determine the distribution of gene encoding cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), a T-cell negative regulator, in T2DM patients and health subjects. (medsci.org)
  • Expression cloning techniques have identified a series of tumor antigens that are recognized by TIL grown from resected melanomas. (nih.gov)
  • Expression of basement membrane antigens and matrix metalloproteinases 2 and 9 in cutaneous basal and squamous cell carcinomas. (nih.gov)
  • We studied the immunohistochemical expression of several BM antigens and of MMP2 and MMP9, in 13 BCC, 13 SCC, and 8 in situ skin carcinomas. (nih.gov)
  • The expression of most BM antigens was reduced in the tumors in comparison with normal skin. (nih.gov)
  • Construction and Formulation of Tumor Antigen Expression Plasmids. (aacrjournals.org)
  • the plague agent Yersinia pestis and the enteropathogenic Yersinia pseudotuberculosis and Yersinia enterocolitica ) is the expression of the virulence (V)-antigen (LcrV). (rupress.org)
  • i) Acute transfection and expression of EBNA-2 under control of simian virus 40 or Moloney murine leukemia virus promoters resulted in increased LMP1 expression in P3HR-1-infected Burkitt's lymphoma cells and the P3HR-1 or Daudi cell line. (asm.org)
  • ii) Transfection and expression of EBNA-LP alone had no effect on LMP1 expression and did not act synergistically with EBNA-2 to affect LMP1 expression. (asm.org)
  • iii) LMP1 expression in Daudi and P3HR-1-infected cells was controlled at the mRNA level, and EBNA-2 expression in Daudi cells increased LMP1 mRNA. (asm.org)
  • Exposure to 5-AZA-CdR invariably induced the expression of the CTA MAGE-1, -2, -3, and -4, GAGE 1-6, and NY-ESO-1 in all of the RCC cells investigated. (aacrjournals.org)
  • These cells can be identified by virtue of the expression of Lyt antigens. (springer.com)
  • On resting lymphocytes, the ICAM-2 expression is several-fold higher than that seen with ICAM-1, while monocytes express equivalent levels of ICAM-1 and ICAM-2. (biovendor.com)
  • ICAM-2 expression is unaffected by a variety of inflammatory cytokines, while ICAM-1 is upregulated upon stimulation. (biovendor.com)
  • This points toward the importance of ICAM-2 in the unstimulated resting state, before ICAM-1 expression is increased. (biovendor.com)
  • The increased expression of BST-2 mediates tumour growth, invasion and metastasis ( 12 , 13 ). (spandidos-publications.com)
  • A second thought, however, should make everyone realize that the omnipresent expression might actually be the hallmark of organogenesis-directing antigens. (springer.com)
  • The expression of H-Y antigen by male extragonadal somatic cell types is clearly as superfluous as the maintenance of the Y by the same cell types. (springer.com)
  • To determine the durability of complete responses in patients with metastatic melanoma or renal cancer treated with high-dose bolus interleukin-2 (IL-2) as well as the factors associated with the development of a complete response and the antigens mediating clinical responses. (nih.gov)
  • A consecutive series of 409 patients with either metastatic melanoma or renal cancer who were treated with high-dose bolus IL-2 in the Surgery Branch, National Cancer Institute, between September 1985 and November 1996 have been analyzed with a median potential follow-up of 7.1 years. (nih.gov)
  • Tumor-infiltrating lymphocytes (TIL) from melanoma patients were used to clone the genes encoding the tumor antigens responsible for clinical responsiveness. (nih.gov)
  • Treatment with high-dose bolus IL-2 mediates complete cancer regression in approximately 8% of patients with metastatic renal cancer and melanoma. (nih.gov)
  • Thus, immunotherapy with high-dose bolus IL-2 should be considered as initial therapy for appropriately selected patients with metastatic melanoma and renal cell cancer. (nih.gov)
  • To improve the immunogenicity of melanoma self-antigens, we used a novel strategy of nonviral genetic vaccination coupled with muscle electroporation. (aacrjournals.org)
  • Electroporation-enhanced immunization with plasmids encoding either human gp100 or mouse TRP-2 antigens induced only partial rejection of B16 melanoma challenge. (aacrjournals.org)
  • Several immunization strategies have been tested in mice and humans to break tolerance to melanoma differentiation antigens. (aacrjournals.org)
  • Using the method described above, mice immunized simultaneously with two melanosome antigens, hgp100 and mTRP-2, could be completely protected from a lethal challenge with B16 melanoma. (aacrjournals.org)
  • Identification of the tumor antigens mediating clinical response is opening new therapeutic possibilities for cancer treatment. (nih.gov)
  • Basement membrane (BM) antigens and matrix metalloproteinases (MMP) are involved in tumor invasion and metastasis. (nih.gov)
  • Our findings further upheld the role of BM antigens and MMPs in the process of tumor aggressiveness. (nih.gov)
  • However, immunization with a combination of these two antigens caused tumor rejection in 100% of the immunized mice. (aacrjournals.org)
  • These results validated the usefulness of electroporation-enhanced, nonviral genetic immunization for the active immunotherapy of cancer and indicated that using a combination of different tumor antigens may be a decisive strategy for a successful therapeutic vaccination. (aacrjournals.org)
  • We delivered tumor antigens i.m. as polymer-based formulations of a plasmid DNA encoding the antigens, followed by electroporation of the injected muscle. (aacrjournals.org)
  • Incorporating the Ii-Key modification along with tumor-associated antigens can greatly enhance the immune system's ability to recognize and destroy cancer cells bearing any of the targeted antigens as well as increasing immunological memory. (bio-medicine.org)
  • We performed this study to evaluate whether a natural specific T-cell response against these tumor-associated antigens (TAAs) already exists in patients with colorectal carcinoma (CRC). (aacrjournals.org)
  • While no antigen tests for SARS-CoV-2 have come to market in the U.S. yet, a number of companies have assays in development. (modernhealthcare.com)
  • The technology for developing photographic films has been used to amplify the size of the label on the antigens by approximately 100 times compared to the label of assays without this technology. (fujifilm.com)
  • The systematic review was not able to assess the performance of HCV antigen assays across different HCV genotypes or in HIV/HCV coinfected people due to lack of data. (hivandhepatitis.com)
  • The review did not cover the use of HCV antigen assays in the monitoring of treatment response, and the authors say that more research is needed to define whether HCV antigen testing can replace HCV RNA testing. (hivandhepatitis.com)
  • Roche continues to expand its comprehensive COVID-19 portfolio to support healthcare systems in diagnosing SARS-CoV-2 infection. (globenewswire.com)
  • Testing for hepatitis C virus (HCV) core antigen could eventually replace the current 2-step procedure for diagnosing chronic hepatitis C infection in lower- and middle-income countries, speeding up access to treatment and improving retention in care, a systematic review designed to inform World Health Organization hepatitis C testing guidelines has found. (hivandhepatitis.com)
  • Hepatitis C Core Antigen Testing for Diagnosis of Hepatitis C Virus Infection: A Systematic Review and Meta-analysis. (hivandhepatitis.com)
  • Posttranslational modification (PTM) of antigen is a way to break T-cell tolerance to self-antigens and promote autoimmunity. (nih.gov)
  • Development of an immune response against these antigens may seem arduous because many of them are nonmutated, differentiation antigens. (aacrjournals.org)
  • The U.S. Food and Drug Administration (FDA) has granted emergency use authorization (EUA) for antigen tests that can identify SARS-CoV-2. (cdc.gov)
  • Antigen tests with emergency use authorization from the U.S. Food and Drug Administration are listed here . (cdc.gov)
  • Splenocytes from combination-immunized animals killed syngeneic targets loaded with peptides derived from both gp100 and TRP-2. (aacrjournals.org)
  • Celiac disease is a T-cell mediated enteropathy with a strong HLA association where the immune response is directed mainly against deamidated cereal gluten peptides that have been modified by the enzyme transglutaminase 2. (nih.gov)
  • Tsunekuni R. Intracontinental and intercontinental velope (E) and nucleocapsid (N) genes of SARS-CoV-2. (cdc.gov)
  • antigens that are coded by the H-2 complex of genes in mice and are involved in self/nonself recognition. (thefreedictionary.com)
  • The finding of multiple genes supports the observation that F. hepatica arc 2 is a mosaic of antigens. (ajtmh.org)
  • Mutations that occur within the immunodominant epitopes of hepatitis B surface antigen (HBsAg) allow mutant virus to propagate in the presence of a neutralizing immune response, while wild-type virus is reduced to undetectable levels. (cdc.gov)
  • Gain and loss of serological and CTL epitopes specific for the H-2D d and H-2L d antigens were examined. (springer.com)
  • Further, some H-2L d specific alto CTL clones lost reactivity to the mutant molecules, demonstrating the presence of CTL epitopes in this region of the H-2L d antigen. (springer.com)
  • Results show that PCV2 VLPs can be used as an efficient antigen carrier for delivery of foreign epitopes, and a potential novel vaccine. (mdpi.com)
  • We are investigating how different transferases involved in O-antigen modifications function in the bacterial membrane and determine serotype specificity in S. flexneri . (edu.au)
  • Binding occurs during infection, to generate a 120kb transcript that encodes all nuclear antigens required for immortalization by EBV.2 Mutation of EBNA2 amino acid 323 and 324, which are located within a highly conserved amino acid motif, abolished the interaction with CBF1.3 This same mutation also abolished the ability of EBNA-2 to activate the Cp. (wikipedia.org)
  • EBNA 2 activates transcription from the viral Cp (C promoter) during infection to generate the 120 kb transcript that encodes all nuclear antigens required for immortalization by EBV. (biochemsoctrans.org)
  • Epstein-Barr virus nuclear antigen 2 (EBNA-2) plays an essential role in primary B-lymphocyte growth transformation. (pnas.org)
  • The EBNA 2 (Epstein-Barr nuclear antigen 2) transcription factor is essential for B-cell transformation by the cancer-associated EBV (Epstein-Barr virus) and for the continuous proliferation of infected cells. (biochemsoctrans.org)
  • These results demonstrate that proteases expressed by opportunistic pathogens impact host immune responses that are relevant to the development of food sensitivities, independently of the trigger antigen. (nature.com)
  • Through secretion of type I IFN, IPC direct both the innate and adaptive immune re-sponse by promoting NK cell and CD8 T cell cytotoxicity, en-hancing DC maturation, presenting Ag to T cells and inducing their Th1 polarization, and inducing B cell differentiation into Ab-secreting plasma cells (1, 2). (psu.edu)
  • Involved in the presentation of foreign antigens to the immune system. (rcsb.org)
  • The Company's Ii-Key Hybrid technology platform entails the modification of fragments of antigens to increase their potency in stimulating critical members of the immune response, known as CD4+ T helper cells. (bio-medicine.org)
  • The generated signal allows for assessing the immune response to SARS-CoV-2 in samples from human origin. (nacalai.co.jp)
  • Intercellular Adhesion Molecule-2 (ICAM-2) is a 60 kDa surface glycoprotein that promotes adhesion between immune cells and the vascular endothelium. (biovendor.com)
  • Heterodimer of an alpha chain and a beta chain (beta-2-microglobulin). (rcsb.org)
  • The purpose of this interim technical guidance is to support effective clinical and public health use of antigen tests for different testing situations. (cdc.gov)
  • This guidance applies to all clinical and culturally responsive, accessible, and available consumer uses of antigen tests and is not specific to any particular age group. (cdc.gov)
  • 1 The results are intended to aid in the early diagnosis of SARS-CoV-2 infection in patients showing clinical symptoms of SARS-CoV-2 and assist in the initial screening of patients. (globenewswire.com)
  • The presentation will focus on technology pioneered by Antigen Express scientists to develop compounds that provide specific T helper (Th) cell activation in cancer immunotherapy as well as clinical trials of those compounds. (bio-medicine.org)
  • We included all reference standards to define the presence or absence of SARS-CoV-2 (including reverse transcription polymerase chain reaction (RT-PCR) tests and established clinical diagnostic criteria). (nih.gov)
  • Some clinical trials and meta-analyses of combination therapies have demonstrated a survival benefit over single-agent therapy, with increased survival times ranging from 7 to 20 months,[2] but a meta-analysis of 27 trials revealed approximately a 3% survival benefit at 5-year follow-up for combination hormonal therapy using nonsteroidal antiandrogens. (cancernetwork.com)
  • To further improve the antitumor activity, we set up a protocol of polyimmunization by combining two cancer antigens in the same vaccine formulation. (aacrjournals.org)
  • The purpose of this study is to evaluate the immunogenicity and safety profile of the Avian flu vaccine with and without adjuvant 2 in healthy, young adults. (clinicaltrials.gov)
  • Antigen Express is a platform technology and product-based company developing proprietary vaccine formulations for large, unmet medical needs. (bio-medicine.org)
  • IPOL ® , Poliovirus Vaccine Inactivated, produced by Sanofi Pasteur SA, is a sterile suspension of three types of poliovirus: Type 1 (Mahoney), Type 2 (MEF-1), and Type 3 (Saukett). (nih.gov)
  • This culture technique and improvements in purification, concentration, and standardization of poliovirus antigen produce a more potent and consistent immunogenic vaccine than the inactivated poliovirus vaccine (IPV) available in the US prior to 1988. (nih.gov)
  • Each dose (0.5 mL) of trivalent vaccine is formulated to contain 40 D antigen units of Type 1, 8 D antigen units of Type 2, and 32 D antigen units of Type 3 poliovirus. (nih.gov)
  • This can help healthcare professionals identify a SARS-CoV-2 infection in people suspected to carry the virus with results typically ready in 15 minutes. (globenewswire.com)
  • This study demonstrates that mice tolerized to schistosome eggs have elevated type 1 cytokine responses with diminished type 2 responses and reduced anti-egg Ab during schistosome infection, and these effects are detrimental to the host. (jimmunol.org)
  • Thus, mice that develop modified granulomatous responses during S. mansoni infection (nude, T cell depleted, SCID) suffer exacerbated liver damage ( 2 , 3 , 4 , 5 ). (jimmunol.org)
  • During schistosome infection of mice there are dynamic changes in the prevailing type 1 (IL-2- and IFN-γ-secreting cells) or type 2 (IL-4-, IL-5-, IL-10-, and IL-13-secreting cells) cytokine response. (jimmunol.org)
  • Coincident with patency of the parasite and the commencement of egg-laying (4-5 wk of infection), type 2 cytokine responses supersede the early type 1 responses ( 7 ). (jimmunol.org)
  • The predominance of type 2 responses by 7-8 wk of infection is associated with a down-regulation of type 1 cytokine responses ( 7 ) that is reflected in a loss of Th1 and Tc1 cells ( 8 , 9 ). (jimmunol.org)
  • It is known that the egg is the major cause of the development of a type 2 cytokine response during infection. (jimmunol.org)
  • Antigen testing (as well as all viral tests) can identify people with COVID-19 who are not showing signs or symptoms and who have no known contact with people who have infection with SARS-CoV-2, the virus that causes COVID-19. (cdc.gov)
  • We included studies of people with suspected current SARS-CoV-2 infection, known to have, or not to have SARS-CoV-2 infection, or where tests were used to screen for infection. (nih.gov)
  • We included 22 publications reporting on a total of 18 study cohorts with 3198 unique samples, of which 1775 had confirmed SARS-CoV-2 infection. (nih.gov)
  • To investigate further the features that signal cleavage and PI addition, we have studied mutants of two closely related murine class I MHC molecules: the PI-linked Ag, Q9b, from the Qa-2 Ag family, and the integral membrane transplantation antigen, H-2Ld. (jimmunol.org)
  • EBNA2 transactivates the promoters of the latent membrane antigens LMP, TP1 and TP2. (wikipedia.org)
  • Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and the resulting COVID-19 pandemic present important diagnostic challenges. (nih.gov)
  • Pancreatic beta-cells are therefore one of six known epithelial cell types on which H-2 antigens can not be detected by immunoferritin labeling. (rupress.org)
  • The antigens epithelial cell adhesion molecule (Ep-CAM), her-2/ neu , and carcinoembryonic antigen (CEA) are potential T-cell targets in antigen-specific vaccination-based cancer therapy. (aacrjournals.org)
  • Date:2/21/2020). (bio-medicine.org)
  • On December 5, 2020, CDC updated the Interim Guidance for Antigen Testing for SARS-CoV-2 Web page. (cdc.gov)
  • On October 30, 2020, NACCHO hosted a webinar to review the CDC's Considerations for Use of SARS-CoV-2 Antigen Testing in Nursing Homes and FAQ . (naccho.org)
  • See FDA's recommendations for healthcare providers using SARS-CoV-2 diagnostic tests for screening asymptomatic individuals for COVID-19 external icon . (cdc.gov)
  • The EUA for the BD Veritor™ Plus System includes SARS-CoV-2 screening through serial testing of asymptomatic individuals when tested twice over two or three days with at least 24 hours and no more than 48 hours between tests. (biospace.com)
  • Overall the studies contained 468 symptomatic and asymptomatic individuals 2 . (roche.com)
  • IgG responses in saliva may serve as a surrogate measure of systemic immunity to SARS-CoV-2 based on their correlation with serum IgG responses. (unboundmedicine.com)
  • The cells that constitute the granuloma comprise both type 1 and type 2 cytokine-secreting cells ( 12 ), with the cytokine responses within the granuloma controlled by regulatory cytokines, including IL-10 and TGF-β ( 13 ). (jimmunol.org)
  • Induction of granzyme B and T cell cytotoxic capacity by IL-2 or IL-15 without antigens: multiclonal responses that are extremely lytic if triggered and short-lived after cytokine withdrawal. (harvard.edu)
  • These data suggest that repeated exposure to cocaine elicits alterations in fra-2 and σ 1 receptor-mediated mechanisms, which ultimately manifest as altered behavioral responses to cocaine. (aspetjournals.org)
  • Antigen tests for SARS-CoV-2 are generally less sensitive than real-time reverse transcription polymerase chain reaction (RT-PCR) and other nucleic acid amplification tests ( NAATs ) for detecting the presence of viral nucleic acid. (cdc.gov)
  • It has been subsequently confirmed that this method has higher virus-detecting capability compared to regular immunochromatography without silver amplification *2 . (fujifilm.com)
  • Fujifilm will use its proprietary silver amplification immunochromatography method *2 , which is based on silver amplification technology used in the photo-developing process. (fujifilm.eu)
  • An alto CTL epitope of the H-2D d antigen was also localized to this stretch of amino acid sequence, as one of several H-2D d specific CTL clones reacted with the mutant molecule in which amino acids were replaced at position 63 to 70. (springer.com)
  • Antigen tests are relatively inexpensive, and most can be used at the point-of-care. (cdc.gov)
  • Antigen tests are relatively inexpensive, can be easily administered in the workplace or at home by a healthcare provider or the worker, and provide results within minutes. (cdc.gov)
  • Addition of a glucosyl, O-acetyl or phosphoethanolamine residue to the basic O-antigen results in serotype conversion (O-antigen modification). (edu.au)
  • The FDA is aware of reports of false-positive results associated with antigen tests used in nursing homes and other settings and continues to monitor and evaluate these reports and other available information about device safety and performance. (worldhealth.net)
  • Antigen tests can be carried out quickly and produce results on the spot. (fujifilm.eu)
  • Results Thirty-three of 409 (8.1%) patients treated with high-dose bolus IL-2 achieved a complete response and 37 (9%) achieved a partial response. (ovid.com)