Enzymes that catalyze the transfer of glycosyl groups to an acceptor. Most often another carbohydrate molecule acts as an acceptor, but inorganic phosphate can also act as an acceptor, such as in the case of PHOSPHORYLASES. Some of the enzymes in this group also catalyze hydrolysis, which can be regarded as transfer of a glycosyl group from the donor to water. Subclasses include the HEXOSYLTRANSFERASES; PENTOSYLTRANSFERASES; SIALYLTRANSFERASES; and those transferring other glycosyl groups. EC 2.4.
Enzymes that catalyze the transfer of galactose from a nucleoside diphosphate galactose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
Enzymes that catalyze the transfer of N-acetylglucosamine from a nucleoside diphosphate N-acetylglucosamine to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
A group of enzymes with the general formula CMP-N-acetylneuraminate:acceptor N-acetylneuraminyl transferase. They catalyze the transfer of N-acetylneuraminic acid from CMP-N-acetylneuraminic acid to an acceptor, which is usually the terminal sugar residue of an oligosaccharide, a glycoprotein, or a glycolipid. EC 2.4.99.-.
Enzymes that catalyze the transfer of N-acetylgalactosamine from a nucleoside diphosphate N-acetylgalactosamine to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
The chemical or biochemical addition of carbohydrate or glycosyl groups to other chemicals, especially peptides or proteins. Glycosyl transferases are used in this biochemical reaction.
Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.
Enzymes catalyzing the transfer of fucose from a nucleoside diphosphate fucose to an acceptor molecule which is frequently another carbohydrate, a glycoprotein, or a glycolipid molecule. Elevated activity of some fucosyltransferases in human serum may serve as an indicator of malignancy. The class includes EC 2.4.1.65; EC 2.4.1.68; EC 2.4.1.69; EC 2.4.1.89.
A key intermediate in carbohydrate metabolism. Serves as a precursor of glycogen, can be metabolized into UDPgalactose and UDPglucuronic acid which can then be incorporated into polysaccharides as galactose and glucuronic acid. Also serves as a precursor of sucrose lipopolysaccharides, and glycosphingolipids.
Enzymes that catalyze the transfer of mannose from a nucleoside diphosphate mannose to an acceptor molecule which is frequently another carbohydrate. The group includes EC 2.4.1.32, EC 2.4.1.48, EC 2.4.1.54, and EC 2.4.1.57.
A nucleoside diphosphate sugar which can be epimerized into UDPglucose for entry into the mainstream of carbohydrate metabolism. Serves as a source of galactose in the synthesis of lipopolysaccharides, cerebrosides, and lactose.
Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.
A uracil nucleotide containing a pyrophosphate group esterified to C5 of the sugar moiety.
The A protein of the lactose synthase complex. In the presence of the B protein (LACTALBUMIN) specificity is changed from N-acetylglucosamine to glucose. EC 2.4.1.90.
Enzymes that catalyze the transfer of hexose groups. EC 2.4.1.-.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A stack of flattened vesicles that functions in posttranslational processing and sorting of proteins, receiving them from the rough ENDOPLASMIC RETICULUM and directing them to secretory vesicles, LYSOSOMES, or the CELL MEMBRANE. The movement of proteins takes place by transfer vesicles that bud off from the rough endoplasmic reticulum or Golgi apparatus and fuse with the Golgi, lysosomes or cell membrane. (From Glick, Glossary of Biochemistry and Molecular Biology, 1990)
A nucleoside diphosphate sugar which serves as a source of N-acetylgalactosamine for glycoproteins, sulfatides and cerebrosides.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Eicosamethyl octacontanonadecasen-1-o1. Polyprenol found in animal tissues that contains about 20 isoprene residues, the one carrying the alcohol group being saturated.
The characteristic 3-dimensional shape of a carbohydrate.
The major human blood type system which depends on the presence or absence of two antigens A and B. Type O occurs when neither A nor B is present and AB when both are present. A and B are genetic factors that determine the presence of enzymes for the synthesis of certain glycoproteins mainly in the red cell membrane.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
A nucleoside diphosphate sugar which serves as a source of glucuronic acid for polysaccharide biosynthesis. It may also be epimerized to UDP iduronic acid, which donates iduronic acid to polysaccharides. In animals, UDP glucuronic acid is used for formation of many glucosiduronides with various aglycones.
Any compound containing one or more monosaccharide residues bound by a glycosidic linkage to a hydrophobic moiety such as an acylglycerol (see GLYCERIDES), a sphingoid, a ceramide (CERAMIDES) (N-acylsphingoid) or a prenyl phosphate. (From IUPAC's webpage)
Carbohydrates covalently linked to a nonsugar moiety (lipids or proteins). The major glycoconjugates are glycoproteins, glycopeptides, peptidoglycans, glycolipids, and lipopolysaccharides. (From Biochemical Nomenclature and Related Documents, 2d ed; From Principles of Biochemistry, 2d ed)
Glycosphingolipids containing N-acetylglucosamine (paragloboside) or N-acetylgalactosamine (globoside). Globoside is the P antigen on erythrocytes and paragloboside is an intermediate in the biosynthesis of erythrocyte blood group ABH and P 1 glycosphingolipid antigens. The accumulation of globoside in tissue, due to a defect in hexosaminidases A and B, is the cause of Sandhoff disease.
The decarboxylation product of UDPglucuronic acid, which is used for formation of the xylosides of seryl hydroxyl groups in mucoprotein synthesis. Also forms plant xylans.
Serves as the biological precursor of insect chitin, of muramic acid in bacterial cell walls, and of sialic acids in mammalian glycoproteins.
Lipids containing at least one monosaccharide residue and either a sphingoid or a ceramide (CERAMIDES). They are subdivided into NEUTRAL GLYCOSPHINGOLIPIDS comprising monoglycosyl- and oligoglycosylsphingoids and monoglycosyl- and oligoglycosylceramides; and ACIDIC GLYCOSPHINGOLIPIDS which comprises sialosylglycosylsphingolipids (GANGLIOSIDES); SULFOGLYCOSPHINGOLIPIDS (formerly known as sulfatides), glycuronoglycosphingolipids, and phospho- and phosphonoglycosphingolipids. (From IUPAC's webpage)
A hexosyltransferase involved in the transfer of disaccharide molecules to the peptidoglycan structure of the CELL WALL SKELETON. It plays an important role in the genesis of the bacterial CELL WALL.
A plant genus of the family MORACEAE. Members contain maclurin, antifungal chalcones, and other compounds.
An aldohexose that occurs naturally in the D-form in lactose, cerebrosides, gangliosides, and mucoproteins. Deficiency of galactosyl-1-phosphate uridyltransferase (GALACTOSE-1-PHOSPHATE URIDYL-TRANSFERASE DEFICIENCY DISEASE) causes an error in galactose metabolism called GALACTOSEMIA, resulting in elevations of galactose in the blood.
Antibiotic complex obtained from Streptomyces bambergiensis containing mainly Moenomycins A and C. They are used as feed additives and growth promoters for poultry, swine, and cattle.
Any compound that contains a constituent sugar, in which the hydroxyl group attached to the first carbon is substituted by an alcoholic, phenolic, or other group. They are named specifically for the sugar contained, such as glucoside (glucose), pentoside (pentose), fructoside (fructose), etc. Upon hydrolysis, a sugar and nonsugar component (aglycone) are formed. (From Dorland, 28th ed; From Miall's Dictionary of Chemistry, 5th ed)
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Hereditary disorder transmitted by an autosomal dominant gene and characterized by multiple exostoses (multiple osteochondromas) near the ends of long bones. The genetic abnormality results in a defect in the osteoclastic activity at the metaphyseal ends of the bone during the remodeling process in childhood or early adolescence. The metaphyses develop benign, bony outgrowths often capped by cartilage. A small number undergo neoplastic transformation.
An enzyme that catalyzes the transfer of galactose from UDP-galactose to a specific glycoprotein receptor, 2-acetamido-2-deoxy-D-glucosyl-glycopeptide, during glycopeptide synthesis. EC 2.4.1.38.
Transferases are enzymes transferring a group, for example, the methyl group or a glycosyl group, from one compound (generally regarded as donor) to another compound (generally regarded as acceptor). The classification is based on the scheme "donor:acceptor group transferase". (Enzyme Nomenclature, 1992) EC 2.
Proteins which contain carbohydrate groups attached covalently to the polypeptide chain. The protein moiety is the predominant group with the carbohydrate making up only a small percentage of the total weight.
A nucleoside diphosphate sugar which can be converted to the deoxy sugar GDPfucose, which provides fucose for lipopolysaccharides of bacterial cell walls. Also acts as mannose donor for glycolipid synthesis.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria normally found in the flora of the mouth and respiratory tract of animals and birds. It causes shipping fever (see PASTEURELLOSIS, PNEUMONIC); HEMORRHAGIC BACTEREMIA; and intestinal disease in animals. In humans, disease usually arises from a wound infection following a bite or scratch from domesticated animals.
Enzymes of the transferase class that catalyze the transfer of a pentose group from one compound to another.
A glycolipid, cross-species antigen that induces production of antisheep hemolysin. It is present on the tissue cells of many species but absent in humans. It is found in many infectious agents.
Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.
A lipophilic glycosyl carrier of the monosaccharide mannose in the biosynthesis of oligosaccharide phospholipids and glycoproteins.
A plant genus of the APOCYNACEAE or dogbane family. Alkaloids from plants in this genus have been used as tranquilizers and antihypertensive agents. RESERPINE is derived from R. serpentina.
Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.
A subclass of ACIDIC GLYCOSPHINGOLIPIDS. They contain one or more sialic acid (N-ACETYLNEURAMINIC ACID) residues. Using the Svennerholm system of abbrevations, gangliosides are designated G for ganglioside, plus subscript M, D, or T for mono-, di-, or trisialo, respectively, the subscript letter being followed by a subscript arabic numeral to indicated sequence of migration in thin-layer chromatograms. (From Oxford Dictionary of Biochemistry and Molecular Biology, 1997)
Simple sugars, carbohydrates which cannot be decomposed by hydrolysis. They are colorless crystalline substances with a sweet taste and have the same general formula CnH2nOn. (From Dorland, 28th ed)
A macrolide antibiotic produced by Streptomyces ambofaciens. The drug is effective against gram-positive aerobic pathogens, N. gonorrhoeae, and staphylococci. It is used to treat infections caused by bacteria and Toxoplasma gondii.
A nucleoside monophosphate sugar which donates N-acetylneuraminic acid to the terminal sugar of a ganglioside or glycoprotein.
Dystrophin-associated proteins that play role in the formation of a transmembrane link between laminin-2 and DYSTROPHIN. Both the alpha and the beta subtypes of dystroglycan originate via POST-TRANSLATIONAL PROTEIN PROCESSING of a single precursor protein.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
A nucleoside diphosphate sugar formed from GDPmannose, which provides fucose for lipopolysaccharides of bacterial cell walls, and for blood group substances and other glycoproteins.
Catalyzes the final step in the galactocerebroside biosynthesis pathway.
The outermost layer of a cell in most PLANTS; BACTERIA; FUNGI; and ALGAE. The cell wall is usually a rigid structure that lies external to the CELL MEMBRANE, and provides a protective barrier against physical or chemical agents.
A trisaccharide antigen expressed on glycolipids and many cell-surface glycoproteins. In the blood the antigen is found on the surface of NEUTROPHILS; EOSINOPHILS; and MONOCYTES. In addition, CD15 antigen is a stage-specific embryonic antigen.
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
A plant genus of the family Plantaginaceae. Members contain scrosides (CINNAMATES) and phenylethanoid glycoside. P. kurrooa is the source of picroliv (a purified iridoid glycoside fraction from the roots having hepatoprotective, anti-inflammatory and antioxidant properties).
A set of genes descended by duplication and variation from some ancestral gene. Such genes may be clustered together on the same chromosome or dispersed on different chromosomes. Examples of multigene families include those that encode the hemoglobins, immunoglobulins, histocompatibility antigens, actins, tubulins, keratins, collagens, heat shock proteins, salivary glue proteins, chorion proteins, cuticle proteins, yolk proteins, and phaseolins, as well as histones, ribosomal RNA, and transfer RNA genes. The latter three are examples of reiterated genes, where hundreds of identical genes are present in a tandem array. (King & Stanfield, A Dictionary of Genetics, 4th ed)
SUGARS containing an amino group. GLYCOSYLATION of other compounds with these amino sugars results in AMINOGLYCOSIDES.
Glycosphingolipids which contain as their polar head group a lactose moiety bound in glycosidic linkage to the hydroxyl group of ceramide. Their accumulation in tissue, due to a defect in lactosylceramide beta-galactosidase, is the cause of lactosylceramidosis.
Polysaccharides composed of repeating galactose units. They can consist of branched or unbranched chains in any linkages.
A mucopolysaccharide constituent of chondrin. (Grant & Hackh's Chemical Dictionary, 5th ed)
A group of dominantly and independently inherited antigens associated with the ABO blood factors. They are glycolipids present in plasma and secretions that may adhere to the erythrocytes. The phenotype Le(b) is the result of the interaction of the Le gene Le(a) with the genes for the ABO blood groups.
The location of the atoms, groups or ions relative to one another in a molecule, as well as the number, type and location of covalent bonds.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
The N-acetyl derivative of glucosamine.
A family of enzymes accepting a wide range of substrates, including phenols, alcohols, amines, and fatty acids. They function as drug-metabolizing enzymes that catalyze the conjugation of UDPglucuronic acid to a variety of endogenous and exogenous compounds. EC 2.4.1.17.
Proteins that share the common characteristic of binding to carbohydrates. Some ANTIBODIES and carbohydrate-metabolizing proteins (ENZYMES) also bind to carbohydrates, however they are not considered lectins. PLANT LECTINS are carbohydrate-binding proteins that have been primarily identified by their hemagglutinating activity (HEMAGGLUTININS). However, a variety of lectins occur in animal species where they serve diverse array of functions through specific carbohydrate recognition.
The holly plant family of the order Celastrales, subclass Rosidae, class Magnoliopsida.
A sequence of amino acids in a polypeptide or of nucleotides in DNA or RNA that is similar across multiple species. A known set of conserved sequences is represented by a CONSENSUS SEQUENCE. AMINO ACID MOTIFS are often composed of conserved sequences.
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
A genus of bacteria that form a nonfragmented aerial mycelium. Many species have been identified with some being pathogenic. This genus is responsible for producing a majority of the ANTI-BACTERIAL AGENTS of practical value.
An enzyme complex that catalyzes the transfer of GALACTOSE from UDP GALACTOSE to GLUCOSE, forming LACTOSE. The enzyme complex is composed of a B subunit, ALPHA-LACTALBUMIN, which changes the substrate specificity of the A subunit, N-ACETYLLACTOSAMINE SYNTHASE, from N-ACETYLGLUCOSAMINE to glucose making lactose synthesis the preferred reaction.
CELL LINE derived from the ovary of the Chinese hamster, Cricetulus griseus (CRICETULUS). The species is a favorite for cytogenetic studies because of its small chromosome number. The cell line has provided model systems for the study of genetic alterations in cultured mammalian cells.
A methylpentose whose L- isomer is found naturally in many plant glycosides and some gram-negative bacterial lipopolysaccharides.
A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
High molecular weight mucoproteins that protect the surface of EPITHELIAL CELLS by providing a barrier to particulate matter and microorganisms. Membrane-anchored mucins may have additional roles concerned with protein interactions at the cell surface.
Proteins prepared by recombinant DNA technology.
Sets of cell surface antigens located on BLOOD CELLS. They are usually membrane GLYCOPROTEINS or GLYCOLIPIDS that are antigenically distinguished by their carbohydrate moieties.
The relationships of groups of organisms as reflected by their genetic makeup.
The rate dynamics in chemical or physical systems.
Proteins found in any species of bacterium.
The lipopolysaccharide-protein somatic antigens, usually from gram-negative bacteria, important in the serological classification of enteric bacilli. The O-specific chains determine the specificity of the O antigens of a given serotype. O antigens are the immunodominant part of the lipopolysaccharide molecule in the intact bacterial cell. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
A system of cisternae in the CYTOPLASM of many cells. In places the endoplasmic reticulum is continuous with the plasma membrane (CELL MEMBRANE) or outer membrane of the nuclear envelope. If the outer surfaces of the endoplasmic reticulum membranes are coated with ribosomes, the endoplasmic reticulum is said to be rough-surfaced (ENDOPLASMIC RETICULUM, ROUGH); otherwise it is said to be smooth-surfaced (ENDOPLASMIC RETICULUM, SMOOTH). (King & Stansfield, A Dictionary of Genetics, 4th ed)
Methods used to measure the relative activity of a specific enzyme or its concentration in solution. Typically an enzyme substrate is added to a buffer solution containing enzyme and the rate of conversion of substrate to product is measured under controlled conditions. Many classical enzymatic assay methods involve the use of synthetic colorimetric substrates and measuring the reaction rates using a spectrophotometer.
A test used to determine whether or not complementation (compensation in the form of dominance) will occur in a cell with a given mutant phenotype when another mutant genome, encoding the same mutant phenotype, is introduced into that cell.
Enzymes which transfer sulfate groups to various acceptor molecules. They are involved in posttranslational sulfation of proteins and sulfate conjugation of exogenous chemicals and bile acids. EC 2.8.2.
A fungal metabolite which is a macrocyclic lactone exhibiting a wide range of antibiotic activity.
The largest class of organic compounds, including STARCH; GLYCOGEN; CELLULOSE; POLYSACCHARIDES; and simple MONOSACCHARIDES. Carbohydrates are composed of carbon, hydrogen, and oxygen in a ratio of Cn(H2O)n.
Procedures by which protein structure and function are changed or created in vitro by altering existing or synthesizing new structural genes that direct the synthesis of proteins with sought-after properties. Such procedures may include the design of MOLECULAR MODELS of proteins using COMPUTER GRAPHICS or other molecular modeling techniques; site-specific mutagenesis (MUTAGENESIS, SITE-SPECIFIC) of existing genes; and DIRECTED MOLECULAR EVOLUTION techniques to create new genes.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
The systematic study of the structure and function of the complete set of glycans (the glycome) produced in a single organism and identification of all the genes that encode glycoproteins.
Polysaccharides consisting of xylose units.
Phosphoric acid esters of dolichol.
Transmembrane proteins consisting of a lectin-like domain, an epidermal growth factor-like domain, and a variable number of domains that are homologous to complement regulatory proteins. They are important cell adhesion molecules which help LEUKOCYTES attach to VASCULAR ENDOTHELIUM.
Carbohydrate antigens expressed by malignant tissue. They are useful as tumor markers and are measured in the serum by means of a radioimmunoassay employing monoclonal antibodies.
Polysaccharides found in bacteria and in capsules thereof.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Chromatography on thin layers of adsorbents rather than in columns. The adsorbent can be alumina, silica gel, silicates, charcoals, or cellulose. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.
The process of cumulative change at the level of DNA; RNA; and PROTEINS, over successive generations.
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
A heterogeneous group of inherited MYOPATHIES, characterized by wasting and weakness of the SKELETAL MUSCLE. They are categorized by the sites of MUSCLE WEAKNESS; AGE OF ONSET; and INHERITANCE PATTERNS.
Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.
The N-acetyl derivative of galactosamine.
A plant genus of the family BRASSICACEAE that contains ARABIDOPSIS PROTEINS and MADS DOMAIN PROTEINS. The species A. thaliana is used for experiments in classical plant genetics as well as molecular genetic studies in plant physiology, biochemistry, and development.
These compounds function as activated glycosyl carriers in the biosynthesis of glycoproteins and glycophospholipids. Include the pyrophosphates.
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
A hexose or fermentable monosaccharide and isomer of glucose from manna, the ash Fraxinus ornus and related plants. (From Grant & Hackh's Chemical Dictionary, 5th ed & Random House Unabridged Dictionary, 2d ed)
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in enzyme synthesis.
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
Commonly observed structural components of proteins formed by simple combinations of adjacent secondary structures. A commonly observed structure may be composed of a CONSERVED SEQUENCE which can be represented by a CONSENSUS SEQUENCE.
Sets of enzymatic reactions occurring in organisms and that form biochemicals by making new covalent bonds.
Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.
A sucrose polymer of high molecular weight.
An N-acyl derivative of neuraminic acid. N-acetylneuraminic acid occurs in many polysaccharides, glycoproteins, and glycolipids in animals and bacteria. (From Dorland, 28th ed, p1518)
A non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue. It is biosynthesized from ASPARTIC ACID and AMMONIA by asparagine synthetase. (From Concise Encyclopedia Biochemistry and Molecular Biology, 3rd ed)
The parts of a macromolecule that directly participate in its specific combination with another molecule.
A mass spectrometric technique that is used for the analysis of large biomolecules. Analyte molecules are embedded in an excess matrix of small organic molecules that show a high resonant absorption at the laser wavelength used. The matrix absorbs the laser energy, thus inducing a soft disintegration of the sample-matrix mixture into free (gas phase) matrix and analyte molecules and molecular ions. In general, only molecular ions of the analyte molecules are produced, and almost no fragmentation occurs. This makes the method well suited for molecular weight determinations and mixture analysis.
A genus of the family Muridae consisting of eleven species. C. migratorius, the grey or Armenian hamster, and C. griseus, the Chinese hamster, are the two species used in biomedical research.
TRANSPORT VESICLES formed when cell-membrane coated pits (COATED PITS, CELL-MEMBRANE) invaginate and pinch off. The outer surface of these vesicles is covered with a lattice-like network of COP (coat protein complex) proteins, either COPI or COPII. COPI coated vesicles transport backwards from the cisternae of the GOLGI APPARATUS to the rough endoplasmic reticulum (ENDOPLASMIC RETICULUM, ROUGH), while COPII coated vesicles transport forward from the rough endoplasmic reticulum to the Golgi apparatus.
Single-stranded complementary DNA synthesized from an RNA template by the action of RNA-dependent DNA polymerase. cDNA (i.e., complementary DNA, not circular DNA, not C-DNA) is used in a variety of molecular cloning experiments as well as serving as a specific hybridization probe.
Phosphoric or pyrophosphoric acid esters of polyisoprenoids.
Compounds based on ANTHRACENES which contain two KETONES in any position. Substitutions can be in any position except on the ketone groups.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
A type of glycoside widely distributed in plants. Each consists of a sapogenin as the aglycone moiety, and a sugar. The sapogenin may be a steroid or a triterpene and the sugar may be glucose, galactose, a pentose, or a methylpentose.
The functional hereditary units of BACTERIA.
Heteropolysaccharides which contain an N-acetylated hexosamine in a characteristic repeating disaccharide unit. The repeating structure of each disaccharide involves alternate 1,4- and 1,3-linkages consisting of either N-acetylglucosamine or N-acetylgalactosamine.
Enzymes which are immobilized on or in a variety of water-soluble or water-insoluble matrices with little or no loss of their catalytic activity. Since they can be reused continuously, immobilized enzymes have found wide application in the industrial, medical and research fields.
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
Short sequences (generally about 10 base pairs) of DNA that are complementary to sequences of messenger RNA and allow reverse transcriptases to start copying the adjacent sequences of mRNA. Primers are used extensively in genetic and molecular biology techniques.

Demonstration of molecular interactions between the murein polymerase PBP1B, the lytic transglycosylase MltA, and the scaffolding protein MipA of Escherichia coli. (1/1334)

Enlargement of the stress-bearing murein sacculus of bacteria depends on the coordinated interaction of murein synthases and hydrolases. To understand the mechanism of interaction of these two classes of proteins affinity chromatography and surface plasmon resonance (SPR) studies were performed. The membrane-bound lytic transglycosylase MltA when covalently linked to CNBr-activated Sepharose specifically retained the penicillin-binding proteins (PBPs) 1B, 1C, 2, and 3 from a crude Triton X-100 membrane extract of Escherichia coli. In the presence of periplasmic proteins also PBP1A was specifically bound. At least five different non-PBPs showed specificity for MltA-Sepharose. The amino-terminal amino acid sequence of one of these proteins could be obtained, and the corresponding gene was mapped at 40 min on the E. coli genome. This MltA-interacting protein, named MipA, in addition binds to PBP1B, a bifunctional murein transglycosylase/transpeptidase. SPR studies with PBP1B immobilized to ampicillin-coated sensor chips showed an oligomerization of PBP1B that may indicate a dimerization. Simultaneous application of MipA and MltA onto a PBP1B sensor chip surface resulted in the formation of a trimeric complex. The dissociation constant was determined to be about 10(-6) M. The formation of a complex between a murein polymerase (PBP1B) and a murein hydrolase (MltA) in the presence of MipA represents a first step in a reconstitution of the hypothetical murein-synthesizing holoenzyme, postulated to be responsible for controlled growth of the stress-bearing sacculus of E. coli.  (+info)

Dynamic expression of lunatic fringe suggests a link between notch signaling and an autonomous cellular oscillator driving somite segmentation. (2/1334)

The metameric organization of the vertebrate trunk is a characteristic feature of all members of this phylum. The origin of this metamerism can be traced to the division of paraxial mesoderm into individual units, termed somites, during embryonic development. Despite the identification of somites as the first overt sign of segmentation in vertebrates well over 100 years ago, the mechanism(s) underlying somite formation remain poorly understood. Recently, however, several genes have been identified which play prominent roles in orchestrating segmentation, including the novel secreted factor lunatic fringe. To gain further insight into the mechanism by which lunatic fringe controls somite development, we have conducted a thorough analysis of lunatic fringe expression in the unsegmented paraxial mesoderm of chick embryos. Here we report that lunatic fringe is expressed predominantly in somite -II, where somite I corresponds to the most recently formed somite and somite -I corresponds to the group of cells which will form the next somite. In addition, we show that lunatic fringe is expressed in a highly dynamic manner in the chick segmental plate prior to somite formation and that lunatic fringe expression cycles autonomously with a periodicity of somite formation. Moreover, the murine ortholog of lunatic fringe undergoes a similar cycling expression pattern in the presomitic mesoderm of somite stage mouse embryos. The demonstration of a dynamic periodic expression pattern suggests that lunatic fringe may function to integrate notch signaling to a cellular oscillator controlling somite segmentation.  (+info)

Hyaluronan synthase expression in bovine eyes. (3/1334)

PURPOSE: Hyaluronan (HA), a high-molecular-weight linear glycosaminoglycan, is a component of the extracellular matrix (ECM). It is expressed in eyes and plays important roles in many biologic processes, including cell migration, proliferation, and differentiation. Hyaluronan is produced by HA synthase (HAS), which has three isoforms: HAS1, HAS2, and HAS3. In this study, the HAS expression in the anterior segment of bovine eyes was investigated to determine the significance of HA in eyes. METHODS: To obtain bovine HAS probes, degenerate oligonucleotide primers, based on well-conserved amino acid sequences including the catalytic region of each HAS isoform, were used for reverse transcription-polymerase chain reaction to amplify mRNA from bovine corneal endothelial cells (BCECs). Hyaluronan synthase-1 expression in the anterior segment of bovine eyes at the protein level was investigated by immunohistochemistry. RESULTS: All three HAS isoforms were expressed in BCECs at the mRNA level. Amplified cDNA fragments of HAS1, HAS2, and HAS3 from BCECs can be aligned to human counterparts, showing similarities of 100%, 97.3%, and 100%, respectively, at the amino acid level. Hyaluronan synthase 1 was expressed at the protein level in corneal epithelium, keratocyte, corneal endothelium, conjunctival epithelium, ciliary epithelium, capillary endothelium, and trabecular meshwork. CONCLUSIONS: Hyaluronan synthase isoforms were expressed in the ocular anterior segment and are speculated to be involved in HA production in situ.  (+info)

O-glycosylation potential of lepidopteran insect cell lines. (4/1334)

The enzyme activities involved in O-glycosylation have been studied in three insect cell lines, Spodoptera frugiperda (Sf-9), Mamestra brassicae (Mb) and Trichoplusia ni (Tn) cultured in two different serum-free media. The structural features of O-glycoproteins in these insect cells were investigated using a panel of lectins and the glycosyltransferase activities involved in O-glycan biosynthesis of insect cells were measured (i.e., UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, UDP-Gal:core-1 beta1, 3-galactosyltransferase, CMP-NeuAc:Galbeta1-3GalNAc alpha2, 3-sialyltransferase, and UDP-Gal:Galbeta1-3GalNAc alpha1, 4-galactosyltransferase activities). First, we show that O-glycosylation potential depends on cell type. All three lepidopteran cell lines express GalNAcalpha-O-Ser/Thr antigen, which is recognized by soy bean agglutinin and reflects high UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase activity. Capillary electrophoresis and mass spectrometry studies revealed the presence of at least two different UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferases in these insect cells. Only some O-linked GalNAc residues are further processed by the addition of beta1,3-linked Gal residues to form T-antigen, as shown by the binding of peanut agglutinin. This reflects relative low levels of UDP-Gal:core-1 beta1,3-galactosyltransferase in insect cells, as compared to those observed in mammalian control cells. In addition, we detected strong binding of Bandeiraea simplicifolia lectin-I isolectin B4 to Mamestra brassicae endogenous glycoproteins, which suggests a high activity of a UDP-Gal:Galbeta1-3GalNAc alpha1, 4-galactosyltransferase. This explains the absence of PNA binding to Mamestra brassicae glycoproteins. Furthermore, our results substantiated that there is no sialyltransferase activity and, therefore, no terminal sialic acid production by these cell lines. Finally, we found that the culture medium influences the O-glycosylation potential of each cell line.  (+info)

Genetic localization and molecular characterization of two key genes (mitAB) required for biosynthesis of the antitumor antibiotic mitomycin C. (5/1334)

Mitomycin C (MC) is an antitumor antibiotic derived biosynthetically from 3-amino-5-hydroxybenzoic acid (AHBA), D-glucosamine, and carbamoyl phosphate. A gene (mitA) involved in synthesis of AHBA has been identified and found to be linked to the MC resistance locus, mrd, in Streptomyces lavendulae. Nucleotide sequence analysis showed that mitA encodes a 388-amino-acid protein that has 71% identity (80% similarity) with the rifamycin AHBA synthase from Amycolatopsis mediterranei, as well as with two additional AHBA synthases from related ansamycin antibiotic-producing microorganisms. Gene disruption and site-directed mutagenesis of the S. lavendulae chromosomal copy of mitA completely blocked the production of MC. The function of mitA was confirmed by complementation of an S. lavendulae strain containing a K191A mutation in MitA with AHBA. A second gene (mitB) encoding a 272-amino-acid protein (related to a group of glycosyltransferases) was identified immediately downstream of mitA that upon disruption resulted in abrogation of MC synthesis. This work has localized a cluster of key genes that mediate assembly of the unique mitosane class of natural products.  (+info)

Preferential expression of biotransformation enzymes in the olfactory organs of Drosophila melanogaster, the antennae. (6/1334)

Biotransformation enzymes have been found in the olfactory epithelium of vertebrates. We now show that in Drosophila melanogaster, a UDP-glycosyltransferase (UGT), as well as a short chain dehydrogenase/reductase and a cytochrome P450 are expressed specifically or preferentially in the olfactory organs, the antennae. The evolutionarily conserved expression of biotransformation enzymes in olfactory organs suggests that they play an important role in olfaction. In addition, we describe five Drosophila UGTs belonging to two families. All five UGTs contain a putative transmembrane domain at their C terminus as is the case for vertebrate UGTs where it is required for enzymatic activity. The primary sequence of the C terminus, including part of the transmembrane domain, differs between the two families but is highly conserved not only within each Drosophila family, but also between the members of one of the Drosophila families and vertebrate UGTs. The partial overlap of the conserved primary sequence with the transmembrane domain suggests that this part of the protein is involved in specific interactions occurring at the membrane surface. The presence of different C termini in the two Drosophila families suggests that they interact with different targets, one of which is conserved between Drosophila and vertebrates.  (+info)

Bordetella pertussis waaA encodes a monofunctional 2-keto-3-deoxy-D-manno-octulosonic acid transferase that can complement an Escherichia coli waaA mutation. (7/1334)

Bordetella pertussis lipopolysaccharide (LPS) contains a single 2-keto-3-deoxy-D-manno-octulosonic acid (Kdo) residue, whereas LPS from Escherichia coli contains at least two. Here we report that B. pertussis waaA encodes an enzyme capable of transferring only a single Kdo during the biosynthesis of LPS and that this activity is sufficient to complement an E. coli waaA mutation.  (+info)

Glycosyltransferase domain of penicillin-binding protein 2a from Streptococcus pneumoniae is membrane associated. (8/1334)

Penicillin-binding proteins (PBPs) are bacterial cytoplasmic membrane proteins that catalyze the final steps of the peptidoglycan synthesis. Resistance to beta-lactams in Streptococcus pneumoniae is caused by low-affinity PBPs. S. pneumoniae PBP 2a belongs to the class A high-molecular-mass PBPs having both glycosyltransferase (GT) and transpeptide (TP) activities. Structural and functional studies of both domains are required to unravel the mechanisms of resistance, a prerequisite for the development of novel antibiotics. The extracellular region of S. pneumoniae PBP 2a has been expressed (PBP 2a*) in Escherichia coli as a glutathione S-transferase fusion protein. The acylation kinetic parameters of PBP 2a* for beta-lactams were determined by stopped-flow fluorometry. The acylation efficiency toward benzylpenicillin was much lower than that toward cefotaxime, a result suggesting that PBP 2a participates in resistance to cefotaxime and other beta-lactams, but not in resistance to benzylpenicillin. The TP domain was purified following limited proteolysis. PBP 2a* required detergents for solubility and interacted with lipid vesicles, while the TP domain was water soluble. We propose that PBP 2a* interacts with the cytoplasmic membrane in a region distinct from its transmembrane anchor region, which is located between Lys 78 and Ser 156 of the GT domain.  (+info)

Shop Glycosyltransferase family 64 protein ELISA Kit, Recombinant Protein and Glycosyltransferase family 64 protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Shop Glycosyltransferase family protein 64 protein ELISA Kit, Recombinant Protein and Glycosyltransferase family protein 64 protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Chumpen Ramirez S et at, Biochem J., 2017. Ganglioside glycosyltransferases (GGTs) are type-II membrane proteins bearing a short N-terminal cytoplasmic tail, a transmembrane domain (TMD), and a lumenal catalytic domain. The expression and activity of these enzymes largely determine the quality of the glycolipids that decorate mammalian cells membranes. Many glycosyltransferases are themselves glycosylated and this is important for their proper localisation, but few if any other post-translational modifications of these proteins have been reported. Here we show that the GGTs, ST3Gal-V, ST8Sia-I, and β4GalNAcT-I are S-acylated at conserved cysteine residues located close the cytoplasmic border of their TMDs. ST3Gal-II, a GT that sialylates glycolipids and glycoproteins, is also S-acylated at a conserved cysteine located in the N-terminal cytoplasmic tail. Many others GTs also possess cysteine residues in their cytoplasmic regions suggesting that this modification occurs on these GTs as well. ...
El Archivo Digital UPM alberga en formato digital la documentacion academica y cientifica (tesis, pfc, articulos, etc..) generada en la Universidad Politecnica de Madrid.Los documentos del Archivo Digital UPM son recuperables desde buscadores: Google, Google Academics, Yahoo, Scirus, etc y desde recolectores OAI: E-ciencia, DRRD, Recolecta (REBIUN-FECYT), Driver, Oaister, etc.
Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity).
This family of glycoside hydrolases exclusively contains phosphorylases that cleave β-glycosidic bonds. The substrate specificities found in GH94 are: cellobiose (Glc-β1,4-Glc) phosphorylase (EC 2.4.1.20), cellodextrin ((Glc-β1,4-)n-1Glc; n ≥ 3) phosphorylase (EC 2.4.1.49), and N,N-diacetyl chitobiose (GlcNAc-β1,4-GlcNAc) phosphorylase. Moreover, a phosphorylase domain belonging to this family is found in cyclic β-1,2-glucan synthase, a modular protein that also contains a glycosyltransferase domain from Glycosyltransferase Family 84 [1]. The GH94 domain is thought to phosphorolyze protein-bound β-1,2-glucans synthesized from UDP-glucose by the GT84 domain. GH94 enzymes were initially classified in Glycosyltransferase Family 36 because none of them show hydrolytic activity. However because of the evolutionary, structural and mechanistic relatedness with clan GH-L glycoside hydrolases, the family was re-assigned to family GH94 [2]. ...
A detailed explanation of the catalytic mechanism employed by these enzymes can be found on the Glycosyltransferases lexicon page. Note: Transglycosylases are distinct from glycosyltransferases. Although both formally catalyze glycosyl transfer, i.e. transfer of a glycosyl residue from a donor substrate to an acceptor substrate,transglycosylases are mechanistically and structurally related to the glycoside hydrolases. Specifically, transglycosylases catalyze the intra- or intermolecular substitution of the anomeric position of glycosides. ...
Our site contains information on Cytochromes P450, Cytochromes b5, NADPH-Cytochrome P450 reductases, β-Glucosidases, and Glycosyltransferases (Family 1). Follow any of the links above for more information, or check our recent updates. The four structures shown above are links to the P450 (upper left), UGT (upper right), P450 reductase (lower left), and cytochrome b5 (lower right) sections of our site. Molecular images are made using UCSFs Chimera and Adobe Photoshop. Our last site update was on November 29, 2010 Areas Updated Recently: ...
Xyloglucan transglycosylases (XETs) have been implicated in many aspects of cell wall biosynthesis, but their function in vascular tissues, in general, and in the formation of secondary walls, in particular, is less well understood. Using an in situ XET activity assay in poplar stems, we have demonstrated XET activity in xylem and phloem fibers at the stage of secondary wall formation. Immunolocalization of fucosylated xylogucan with CCRC-M1 antibodies showed that levels of this species increased at the border between the primary and secondary wall layers at the time of secondary wall deposition. Furthermore, one of the most abundant XET isoforms in secondary vascular tissues (PttXET16A) was cloned and immunolocalized to fibers at the stage of secondary wall formation. Together, these data strongly suggest that XET has a previously unreported role in restructuring primary walls at the time when secondary wall layers are deposited, probably creating and reinforcing the connections between the ...
The GAUT genes are predicted to encode proteins with molecular masses between 61 and 78 KDa. Most of the GAUT proteins are likely to be type II membrane proteins with a transmembrane domain in their hypervariable N-terminal region. GAUT3,4, and 5 contain a N-terminal signal peptide rather than a transmembrane domain. By contrast, GAUT2 contains no N-terminal transmembrane domain and no signal peptide. The GATL genes encode proteins with molecular masses between 39 and 44 KDa and are predicted to contain only a signal peptide at their N termini suggesting they are processed into the secretory pathway. The 25 proteins in the GAUT1-related superfamily are members of the CAZy glycosyltransferase family 8. The Arabidopsis GAUT-1-related gene family consists of four clades (GAUT-A, GAUT-B, GAUT-C, and GATL, see above figure) that are clearly distinct from the other Arabidopsis glycosyltransferase family 8 proteins. Thus, we believe that the Arabidopsis family-8 proteins should be subdivided to reflect ...
Main conclusion A large-scale bioinformatics analysis revealed the origin and evolution of GT47 gene family, and identified two clades of intron-poor genes with putative functions in drought stress...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
CP001743.PE380 Location/Qualifiers FT CDS_pept 365530..366618 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Mrub_0385 FT /product=glycosyl transferase family 2 FT /note=PFAM: glycosyl transferase family 2; SPTR: A4CTP8 FT Putative glycosyltransferase family 2; InterPro IPR001173; FT COGs: COG1215 Glycosyltransferase probably involved in cell FT wall biogenesis; KEGG: met:M446_3158 glycosyl transferase FT family protein; PFAM: Glycosyl transferase family 2 FT /db_xref=EnsemblGenomes-Gn:Mrub_0385 FT /db_xref=EnsemblGenomes-Tr:ADD27162 FT /protein_id=ADD27162.1 FT /translation=MVSILEVLWYGVLAWLGLKLLVLLLNMLFFPVLKREKLRGPRPTV FT SLLVPARNEAHNLRETLPGLLLQGVQEILVLNDHSTDATAQVVEEFSRQDARVRLLAGL FT PKPEGWMGKTWACYQLAQAAQGEVLIFTDADVHWHKRGVRAVLARMERERAGLVSVYPR FT QMTHSLAERVILPLIDDVLLCYLPYPLLRTPFPSASAANGQVMAFTRPAYLASGGHAAV FT RGEVLEDVRLAQKTKGAGQRLALALGGGLVAVRMYRGFAEIVEGLGKNLIEFHGRSRVV FT LALSYMGHLLAYTLCWPLALFNPLWLWVGVLGLLERLLLGLKTGRAWWELVLVPLAPLL FT STPIYWRSAQRKYTWKGREYSR atggtatcta tcctcgaggt ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-) and related proteins into distinct sequence based families has been described [(PUBMED:9334165)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form clans.. Glycosyltransferase family 28 comprises enzymes with a number of known activities; 1,2-diacylglycerol 3-beta-galactosyltransferase (EC ...
In this study, we found both in vitro and in vivo that a skewed Th2 environment increased Lfng expression in CD4 T cells. Importantly, Lfng expression exacerbated lung pathology and Th2 immune response during RSV-mediated exacerbation of allergic airway disease by enhancing Dll4-induced Notch activation. These findings are in accordance with previous work demonstrating that Lfng-mediated glycosylation of Notch1 enhances its capacity to be activated by Delta-like Notch ligands (3). Interestingly, a STAT5-dependent mechanism regulated Lfng expression during Th2 differentiation, and, in a positive feedback manner, Lfng further augmented Dll4-induced Notch activation and production of Th2 cytokines.. Mechanisms that regulate the immune response and associated pathology during RSV exacerbation of pulmonary airway disease are largely unknown. RSV exacerbation exploits the allergen-driven Th2 cytokine environment to further enhance Th2 cell development and worsen the inflammatory response. In this ...
Formerly known as glycosyltransferase family GT36; Assigned to a GH family following a paper by Hidaka, Honda, Kitaoka, Nirasawa, Hayashi, Wakagi, Shoun and Fushinobu (Structure (Camb). 2004 Jun;12(6):937-947) (PMID: 15274915) that revealed the evolutionary, structural and mechanistic relationship of these phosphorylases with glycoside hydrolases of clan GH-L ...
Formerly known as glycosyltransferase family GT36; Assigned to a GH family following a paper by Hidaka, Honda, Kitaoka, Nirasawa, Hayashi, Wakagi, Shoun and Fushinobu (Structure (Camb). 2004 Jun;12(6):937-947) (PMID: 15274915) that revealed the evolutionary, structural and mechanistic relationship of these phosphorylases with glycoside hydrolases of clan GH-L ...
FUT9 belongs to the glycosyltransferase family and catalyzes the last step in the biosynthesis of Ley glycolipids in the carbohydrate antigen Lex (Nishihara et al, 2003; Gouveia et al, 2012). This reaction takes place in the Golgi compartment, and the product is transported to the cytosol and secreted out from the cell (Duarte et al, 2007). The Ley glycolipid was previously reported to inhibit the procoagulant activity and metastasis of human adenocarcinoma (Nudelman et al, 1986; Suzuki et al, 1997; Inufusa et al, 2001). The loss of FUT9 in the metabolic model prevents Ley glycolipid formation and secretion. To chart the network‐wide metabolic alterations induced by FUT9 inactivation, we performed a Minimization Of Metabolic Adjustment (MOMA) (Segrè et al, 2002) analysis to predict the metabolic state after FUT9 KD in late‐stage colorectal cancers, simulated by the Gene Inactivity Moderated by Metabolism and Expression (GIMME) algorithm (Becker & Palsson, 2008) (Materials and Methods). This ...
Complete information for UGT3A2 gene (Protein Coding), UDP Glycosyltransferase Family 3 Member A2, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
CDw75, 100 Tests. CD75 is a 43-85 kD type II transmembrane sialoprotein, known as lacosamines, or CDw75. It is a member of glycosyltransferase family.
Nucleotide sugars are the activated forms of monosaccharides. Nucleotide sugars act as glycosyl donors in glycosylation reactions. Those reactions are catalyzed by a group of enzymes called glycosyltransferases. The anabolism of oligosaccharides - and, hence, the role of nucleotide sugars - was not clear until the 1950s when Leloir and his coworkers found that the key enzymes in this process are the glycosyltransferases. These enzymes transfer a glycosyl group from a sugar nucleotide to an acceptor. To act as glycosyl donors, those monosaccharides should exist in a highly energetic form. This occurs as a result of a reaction between nucleoside triphosphate (NTP) and glycosyl monophosphate (phosphate at anomeric carbon). The recent discovery of the reversibility of many glycosyltransferase-catalyzed reactions calls into question the designation of sugar nucleotides as activated donors. There are nine sugar nucleotides in humans which act as glycosyl donors and they can be classified depending ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
The Stories Tryptophans Tell: Exploring Protein Dynamics of Heptosyltransferase I from Escherichia coli, Joy M. Cote, Carlos A. Ramirez-Mondragon, Zarek S. Siegel, Daniel J. Czyzyk, Jiali Gao, Yuk Y. Sham, Ishita Mukerji, and Erika A. Taylor. ...
Learn About Lysosomal Storage Disorders and How A Glycosyltransferase Activity Assay Can Be Used to Find Novel Therapeutics for These Diseases.
KEGG Orthology (KO) [BR:ccv00001] 09180 Brite Hierarchies 09181 Protein families: metabolism 01005 Lipopolysaccharide biosynthesis proteins [BR:ccv01005] CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6] Enzymes [BR:ccv01000] 2. Transferases 2.7 Transferring phosphorus-containing groups 2.7.8 Transferases for other substituted phosphate groups 2.7.8.6 undecaprenyl-phosphate galactose phosphotransferase CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6] Lipopolysaccharide biosynthesis proteins [BR:ccv01005] O-antigen CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6 ...
MFNG - MFNG (Myc-DDK-tagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2 available for purchase from OriGene - Your Gene Company.
The synthesis of the plant cell wall is very complex, and understanding how this process occurs will lead to many benefits for future research and industries dependent upon cell walls for their products. The recent discovery of the functions of AtMUR3 and AtGT18 in Arabidopsis thaliana as xyloglucan galactosyltransferases has led to the identification of many more putative glycosyltransferases in the Arabidopsis genome. Due to the structural differences between the xyloglucans of Arabidopsis and solanaceous plants, we decided to search for putative arabinosyltransferases in the Solanaceae. Solanaceous xyloglucan is substituted by one to two arabinosyl residues at the second xylose position, and sometimes contains an arabinose at the first xylose position. In contrast, Arabidopsis xyloglucan does not contain arabinose, and is substituted by galactose at the second and third xylose position. Furthermore, the second galactose residue in Arabidopsis xyloglucan is usually fucosylated, a modification not
The hyaluronate synthase complex was identified in plasma membranes from B6 cells. It contained two subunits of molecular masses 52 kDa and 60 kDa which bound the precursor UDP-GlcA in digitonin solution and partitioned into the aqueous phase, together with nascent hyaluronate upon Triton X-114 phase separation. The 52 kDa protein cross-reacted with poly- and monoclonal antibodies raised against the streptococcal hyaluronate synthase and the 60 kDa protein was recognized by monoclonal antibodies raised against a hyaluronate receptor. The 52 kDa protein was purified to homogeneity by affinity chromatography with monoclonal anti-hyaluronate synthase. ...
The hyaluronate synthase complex was identified in plasma membranes from B6 cells. It contained two subunits of molecular masses 52 kDa and 60 kDa which bound the precursor UDP-GlcA in digitonin solution and partitioned into the aqueous phase, together with nascent hyaluronate upon Triton X-114 phase separation. The 52 kDa protein cross-reacted with poly- and monoclonal antibodies raised against the streptococcal hyaluronate synthase and the 60 kDa protein was recognized by monoclonal antibodies raised against a hyaluronate receptor. The 52 kDa protein was purified to homogeneity by affinity chromatography with monoclonal anti-hyaluronate synthase. ...
Goubet, F and Barton, CJ and Mortimer, JC and Xu, X and Zhang, Z and Miles, GP and Richens, J and Liepmann, A and Seffen, KA and Dupree, P (2009) Cell wall glucomannan in Arabidopsis is synthesised by CSLA glycosyltransferases, and influences the speed of embryogenesis. The Plant Journal. ISSN 0960-7412. Full text not available from this repository ...
Before you think of posting here, read back here , then read ahead The Lunatic Fringe (Part 1) http://www.colorado4x4.org/gallery/files/3/1/5/2/Untitled-1.jpg
Buy Losa Online! Losa is used to treat high blood pressure (hypertension) and to help protect the kidneys from damage due to diabetes. It is also used to lower the risk of strokes in patients with high blood pressure and an enlarged heart. Lowering high blood pressure helps prevent strokes, heart attacks, and kidney problems. Losa belongs to a class of drugs called...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] The protein encoded by this gene belongs to the UDP-glycosyltransferase family. It catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central and peripheral nervous systems. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2011 ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form clans. Proteins containing this domain transfer UDP, ADP, GDP or CMP linked sugars to a variety of substrates, including glycogen, ...
Suggested Peptide Antigen for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; can be found in Genscripts Peptide Antigen Database. Anti- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; pAb has guaranteed Elisa titer of 1:64000 and 95% WB success rate
The design and synthesis of several beta-1,4-galactosyltransferase inhibitors are reported. Mimics of the pyrophosphate-Mn2+ complex were the focus of the design. Malonic, tartaric, and monosaccharide moieties were used as replacements of the pyrophosphate moiety, and galactose or azasugars with potent galactosidase inhibitory activity were used as the donor component. Compound 6, in which glucose was used as the pyrophosphate-Mn2+ complex mimic and galactose as the donor component, showed the best inhibitory activity towards the transferase with a Ki of 119.6 microM ...
Principal Investigator:NISHIHARA Shoko, Project Period (FY):1998 - 1999, Research Category:Grant-in-Aid for Scientific Research (C), Section:一般, Research Field:Structural biochemistry
Principal Investigator:NOZAWA Shiro, Project Period (FY):1994 - 1995, Research Category:Grant-in-Aid for General Scientific Research (B), Research Field:Obstetrics and gynecology
Childhood allergic asthma has been and still is a growing health problem in the western world. Many children begin to have significant complications from severe...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
In the real world, of course, chemical compounds rarely exhibit this ideal combination of characteristics. Few are fully absorbed from the gut. The percentage that does cross is distributed at various sites in the body including, but not exclusively, the intended site of action. A large proportion passes through the liver where it may be metabolized by enzymes, such as the P450 oxygenases, sugar transferases, and drug transport system. Drugs may induce the activity of these molecular bouncers whose main biological role is to show the door to non-nutritious compounds, which the rather more welcoming guardians of the gut, lung, and other epithelia have foolishly allowed entry. The door in this case, of course, is usually the kidney. Elimination, the ultimate fate of all foreign compounds, including drugs, is relatively easy to measure, but much harder to explain or predict for any particular compound. It is, of course, highly dependent on the complex series of molecular, cellular, and ...
CP000124.RFAE Location/Qualifiers FT CDS_pept 620827..621312 FT /codon_start=1 FT /transl_table=11 FT /gene=rfaE FT /locus_tag=BURPS1710b_0607 FT /product=rfaE bifunctional protein, domain II FT /EC_number=2.7.7.- FT /note=identified by match to protein family HMM PF01467; FT match to protein family HMM TIGR00125; match to protein FT family HMM TIGR02199 FT /db_xref=EnsemblGenomes-Gn:BURPS1710b_0607 FT /db_xref=EnsemblGenomes-Tr:ABA50187 FT /db_xref=GOA:Q3JWN2 FT /db_xref=InterPro:IPR004821 FT /db_xref=InterPro:IPR011914 FT /db_xref=InterPro:IPR014729 FT /db_xref=UniProtKB/TrEMBL:Q3JWN2 FT /protein_id=ABA50187.1 FT /translation=MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA FT DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS FT LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR atgcccgctt cgttcgaacg caagctgatc acccgcgacg cgctcgccgc catgcgcgcg 60 tcgctgcccg cgcccgtcgt cttcacgaac ggcgtattcg acatcctgca tcgcggccac 120 gtcagctatc tcgccgacgc gaaggcgctc ...
Digitoxosyltetracenomycin C and Glucosyltetracenomycin C, Two Novel Elloramycin Analogues Obtained by Exploring the Sugar Donor Substrate Specificity of Glycosyltransferase ElmGT
Ruprecht, C.; Bartetzko, M. P.; Senf, D.; Lakhina, A.; Smith, P. J.; Soto, M. J.; Oh, H.; Yang, J.-Y.; Chapla, D.; Varón Silva, D. et al.; Clausen, M. H.; Hahn, M. G.; Moremen, K. W.; Urbanowicz, B. R.; Pfrengle, F.: A glycan array-based assay for the identification and characterization of plant glycosyltransferases. Angewandte Chemie International Edition (2020 ...
Bacteria RfaE protein: ADP-heptose synthase, required for lipopolysaccharide biosynthesis; amino acid sequence given in first source
ami:Amir_6058 K16150 glycogen synthase [EC:2.4.1.11] , (GenBank) glycosyl transferase group 1 (A) MRVLMLSWEYPPVVVGGLGRHVHALADRLVRAGHEVVVLCRQPEGTDAVTHPTEDVVLGG VRVVRVAEDPAHLVFERDLVAWVLAMGHAMTRAGLALLLEGWRPDVVHAHDWLVTHPAVA LAEASQAPLVATVHATEAGRHSGWLSQTLNQQVHSVEWWLANRADELITCSAAMRAEVAH LFEVEPGGITVLHNGIEPKRWRVRAADVEAARGRHSPDGAPVLLFFGRLEWEKGVQDLIA ALPRVRRRHPGTRLVVAGTGTHREWLVEQARKQKVKRAVEFAGHLSDRELAAAIASAAAV VLPSRYEPFGIVALEAAAAGAPLVASTAGGLGEVVLDGETGLSFPPGDVDALARAVCAVL DDRAAAGRRAKAAKARLATDFDWGTIAEGTVEVYRAAVVRERGALGRPKIGTGNVFL ...
The cDNA encoding a xyloglucan endotransglycosylase, PttXET16A, from hybrid aspen (Populus tremula×tremuloides) has been isolated from an expressed sequence tag library and expressed in the methylotrophic yeast Pichia pastoris. Sequence analysis indicated a high degree of similarity with other proteins in the XTH (xyloglucan transglycosylase/hydrolase) gene subfamily of GH16 (glycoside hydrolase family 16). In addition to the conserved GH16 catalytic sequence motif, PttXET16A contains a conserved N-glycosylation site situated proximal to the predicted catalytic residues. MS analysis indicated that the recombinant PttXET16A expressed in P. pastoris is heterogeneous due to the presence of variable N-glycosylation and incomplete cleavage of the α-factor secretion signal peptide. Removal of the N-glycan by endoglycosidase H treatment did not influence the catalytic activity significantly. Similarly, site-directed mutagenesis of Asn93 to serine to remove the N-glycosylation site resulted in an ...
TY - JOUR. T1 - Donor substrate promiscuity of bacterial β1-3-N-acetylglucosaminyltransferases and acceptor substrate flexibility of β1-4-galactosyltransferases. AU - Li, Yanhong. AU - Xue, Mengyang. AU - Sheng, Xue. AU - Yu, Hai. AU - Zeng, Jie. AU - Thon, Vireak. AU - Chen, Yi. AU - Muthana, Musleh M.. AU - Wang, Peng G.. AU - Chen, Xi. PY - 2016/4/15. Y1 - 2016/4/15. N2 - β1-3-N-Acetylglucosaminyltransferases (β3GlcNAcTs) and β1-4-galactosyltransferases (β4GalTs) have been broadly used in enzymatic synthesis of N-acetyllactosamine (LacNAc)-containing oligosaccharides and glycoconjugates including poly-LacNAc, and lacto-N-neotetraose (LNnT) found in the milk of human and other mammals. In order to explore oligosaccharides and derivatives that can be synthesized by the combination of β3GlcNAcTs and β4GalTs, donor substrate specificity studies of two bacterial β3GlcNAcTs from Helicobacter pylori (Hpβ3GlcNAcT) and Neisseria meningitidis (NmLgtA), respectively, using a library of 39 ...
Altered sugar donor specificity and catalytic activity of pteridine glycosyltransferases by domain swapping or site-directed mutagenesis;kpubs;kpubs.org
When entering the differentiation zone, the elongating root cells that are programmed to become trichoblasts drastically add a new growth pattern to allow the highly localized emergence of root hairs. The initiation of a root hair is characterized on the level of gene expression patterns (for review, see Schiefelbein, 2000). On the level of cell physiology, specific enzymes or proteins need to restructure a defined spot of the apical outer periclinal cell wall to allow local wall loosening and bulging. At the time of root hair initiation, inside the cytoplasm actin and microtubules rearrange (Emons and Derksen, 1986; Baluška et al., 2000a, 2000b). A highly localized acidification (pH 4.5) of the cell wall is associated with the initiation process (Bibikova et al., 1998). Once the initiation is completed, the wall pH returns to the pH (approximately 6) found in the rest of the trichoblast. Besides pH changes, other factors are likely to be important to predict the future site of root hair ...
Trehalose is an unusual non-reducing disaccharide that plays a variety of biological roles, from food storage to cellular protection from environmental stresses such as desiccation, pressure, heat-shock, extreme cold, and oxygen radicals. It is also an integral component of the cell-wall glycolipids of mycobacteria. The primary enzymatic route to trehalose first involves the transfer of glucose from a UDP-glucose donor to glucose-6-phosphate to form alpha,alpha-1,1 trehalose-6-phosphate. This reaction, in which the configurations of two glycosidic bonds are set simultaneously, is catalyzed by the glycosyltransferase trehalose-6-phosphate synthase ( OtsA), which acts with retention of the anomeric configuration of the UDP-sugar donor. The classification of activated sugar-dependent glycosyltransferases into approximately 70 distinct families based upon amino acid sequence similarities places OtsA in glycosyltransferase family 20 (see afmb.cnrs-mrs.fr/CAZY/). The recent 2.4 Angstrom structure of ...
Lipopolysaccharyl-alpha-1,4-galactosyltransferase C (LgtC), a glycosyltransferase family 8 alpha-1,4-galactosyltransferase from Neisseria meningitidis, catalyzes the transfer of galactose from UDP galactose to terminal lactose-containing acceptor sugars with net retention of anomeric configuration. To investigate the potential role of discrete nucleophilic catalysis suggested by the double displacement mechanism generally proposed for retaining glycosyltransferases, the side chain amide of Gln-189, which is suitably positioned to act as the catalytic nucleophile of LgtC, was substituted with the more nucleophilic carboxylate-containing side chain of glutamate in the hope of accumulating a glycosyl-enzyme intermediate. The resulting mutant was subjected to kinetic, mass spectrometric, and x-ray crystallographic analysis. Although the K-m for UDP-galactose is not significantly altered, the k(cat) was reduced to 3% that of the wild type enzyme. Electrospray mass spectrometric analysis revealed that ...
The molecular basis of primary wall extension endures as one of the central enigmas in plant cell morphogenesis. Classical cell wall models suggest that xyloglucan endo-transglycosylase activity is the primary catalyst (together with expansins) of controlled cell wall loosening through the transient cleavage and religation of xyloglucan-cellulose cross links. The genome of Arabidopsis (Arabidopsis thaliana) contains 33 phylogenetically diverse XYLOGLUCAN ENDO-TRANSGLYCOSYLASE/HYDROLASE (XTH) gene products, two of which were predicted to be predominant xyloglucan endohydrolases due to clustering into group III-A. Enzyme kinetic analysis of recombinant AtXTH31 confirmed this prediction and indicated that this enzyme had similar catalytic properties to the nasturtium (Tropaeolum majus) xyloglucanase1 responsible for storage xyloglucan hydrolysis during germination. Global analysis of Genevestigator data indicated that AtXTH31 and the paralogous AtXTH32 were abundantly expressed in expanding ...
Abnormal O-glycans expressed by cancer cells have functional importance in cell adhesion, invasion, and metastasis [15]. Alterations in mucin-type O-glycans has been associated with malignant transformation, resulting in the formation of less complex structures and leading to an increase of the simple short determinants. Protein O-glycosylation is deregulated in breast cancer cells, leading to the accumulation of simple mucin-type tumor-associated antigens [37]. The expression of GalNAc-T14 mRNA was analyzed in normal and malignant tissue from breast, skin, lung, pancreas, ovary, endometrium, bladder and lymphoid cancers. A subset of tumor samples, ranging from 10% in lobular breast cancer to 30% in lung cancer and diffuse large B-cell lymphoma, showed GalNAc-T14 mRNA overexpression [36]. Under thees circumstances, we hypothesize the expression of GalNAc-T14 may be a useful biomarker for breast cancer by immunohistochemistry.. It has been shown that several glycosyltransferases are useful tumor ...
Because of the large amount of interest shown by WAAC members in holding the Chicago-based McCrone Research Institute Microscopy for Conservators course on the West Coast, the WAAC Board voted at the 1990 Annual Meeting in Avalon, California to pursue this activity. The McCrone Research Institute has agreed to conduct two sessions of this course in Los Angeles, one session February 10-14, 1992 and the other February 17-21, 1992. The class is held for 8 or more hours per day, with alternating lecture and lab. There are openings for 20 students each week. These sessions will be held at the Getty Conservation Institute, where the Training Program of the GCI has generously extended the use of its laboratory facilities for this WAAC endeavor. Participants will be responsible for arranging their own housing. The McCrone Research Institute is making this course available at a substantial discount to WAAC members. Tuition for each participant will be $700. The McCrone Research Institute will supply ...
GLYCOSYLATED PROTEIN EXPRESSION IN PROKARYOTES - The present invention relates to a prokaryotic host cell comprising eukaryotic glycosyltransferase activity, where the eukaryotic glycosyltransferase activity is eukaryotic dolichyl-linked UDP-GlcNAc transferase activity and eukaryotic mannosyl-transferase activity. Also disclosed is a method of producing a glycosylated protein by providing a prokaryotic host cell comprising the eukaryotic glycosyltransferase activity and culturing the prokaryotic host cell under conditions effective to produce a glycosylated protein. Another aspect of the present invention pertains to a method for screening bacteria or bacteriophages by expressing one or more glycans on the surface of a bacteria, attaching a label on the one or more glycans on the surface of the bacteria or on the surface of a bacteriophage derived from the bacteria, and analyzing the label in a high-throughput format. A glycosylated antibody comprising an Fv portion which recognizes and binds to ...
Plant genomes encode numerous small molecule glycosyltransferases which modulate the solubility, activity, immunogenicity and/or reactivity of hormones, xenobiotics and natural products. The products of these enzymes can accumulate to very high concentrations, yet somehow avoid inhibiting their own biosynthesis. Glucosyltransferase UGT74B1 (UDP-glycosyltransferase 74B1) catalyses the penultimate step in the core biosynthetic pathway of glucosinolates, a group of natural products with important functions in plant defence against pests and pathogens. We found that mutation of the highly conserved Ser284 to leucine [wei9-1 (weak ethylene insensitive)] caused only very mild morphological and metabolic phenotypes, in dramatic contrast with knockout mutants, indicating that steady state glucosinolate levels are actively regulated even in unchallenged plants. Analysis of the effects of the mutation via a structural modelling approach indicated that the affected serine interacts directly with ...
Plant genomes encode numerous small molecule glycosyltransferases which modulate the solubility, activity, immunogenicity and/or reactivity of hormones, xenobiotics and natural products. The products of these enzymes can accumulate to very high concentrations, yet somehow avoid inhibiting their own biosynthesis. Glucosyltransferase UGT74B1 (UDP-glycosyltransferase 74B1) catalyses the penultimate step in the core biosynthetic pathway of glucosinolates, a group of natural products with important functions in plant defence against pests and pathogens. We found that mutation of the highly conserved Ser284 to leucine [wei9-1 (weak ethylene insensitive)] caused only very mild morphological and metabolic phenotypes, in dramatic contrast with knockout mutants, indicating that steady state glucosinolate levels are actively regulated even in unchallenged plants. Analysis of the effects of the mutation via a structural modelling approach indicated that the affected serine interacts directly with ...
Glycosyltransferases (GTFs, Gtfs) are enzymes (EC 2.4) that establish natural glycosidic linkages. They catalyze the transfer of saccharide moieties from an activated nucleotide sugar (also known as the glycosyl donor) to a nucleophilic glycosyl acceptor molecule, the nucleophile of which can be oxygen- carbon-, nitrogen-, or sulfur-based. The result of glycosyl transfer can be a carbohydrate, glycoside, oligosaccharide, or a polysaccharide. Some glycosyltransferases catalyse transfer to inorganic phosphate or water. Glycosyl transfer can also occur to protein residues, usually to tyrosine, serine, or threonine to give O-linked glycoproteins, or to asparagine to give N-linked glycoproteins. Mannosyl groups may be transferred to tryptophan to generate C-mannosyl tryptophan, which is relatively abundant in eukaryotes. Transferases may also use lipids as an acceptor, forming glycolipids, and even use lipid-linked sugar phosphate donors, such as dolichol phosphates. Glycosyltransferases that use ...
TY - CHAP. T1 - Enzymatic Approaches to O-Glycoside Introduction. T2 - Glycosyltransferases. AU - Chokhawala, H. A.. AU - Chen, Xi. PY - 2007/1/1. Y1 - 2007/1/1. UR - http://www.scopus.com/inward/record.url?scp=79951603384&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=79951603384&partnerID=8YFLogxK. U2 - 10.1016/B978-044451967-2/00012-X. DO - 10.1016/B978-044451967-2/00012-X. M3 - Chapter. AN - SCOPUS:79951603384. SN - 9780444519672. VL - 1-4. SP - 415. EP - 451. BT - Introduction to Glycoscience; Synthesis of Carbohydrates. PB - Elsevier. ER - ...
GLT25D2; glycosyltransferase 25 domain containing 2; 16790; ENSG00000198756; C1orf17; 1q25; FLJ37771, FLJ37873, KIAA0584; procollagen galactosyltransferase 2; hydroxylysine galactosyltransferase 2; glycosyltransferase 25 family member 2; EC 2.4.1.50 ...
The Notch receptor is a large, cell surface transmembrane protein involved in a wide variety of developmental processes in higher organisms. It becomes activated when its extracellular region binds to ligands located on adjacent cells. Much of this extracellular region is composed of EGF-like repeats, many of which can be O-fucosylated. A number of these O-fucosylated repeats can in turn be further modified by the action of a beta-1,3-N-acetylglucosaminyltransferase enzyme known as Fringe. Fringe potentiates the activation of Notch by Delta ligands, while inhibiting activation by Serrate/Jagged ligands. This regulation of Notch signalling by Fringe is important in many processes.Four distinct Fringe proteins have so far been studied in detail; Drosophila Fringe (Dfng) and its three mammalian homologues Lunatic Fringe (Lfng), Radical Fringe (Rfng) and Manic Fringe (Mfng). Dfng, Lfng and Rfng have all been shown to play important roles in developmental processes within their host, though the ...
Axon Medchem | Prime source supplier of high-value life science products, providing Axon Ligands™ for pharmaceutical research as world-wide recognized drug standards
Complete information for LFNG gene (Protein Coding), LFNG O-Fucosylpeptide 3-Beta-N-Acetylglucosaminyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Watch this video and answer the following question: Have the humanities gone mad? https://www.youtube.com/watch?v=vDT-Yj5n6zE
The mad gene hunt gets odder and odder. The headlines are more and more becoming fit fodder for late night television comedy. The Times of India had this to say. Childhood adversity ups genetic disorder risk You can imagine the faces of their collective readership registering shock and dismay. Are children really having that much…
This is a replacement Losi Adjustable Hinge Pin Brace Insert Set, and is intended for use with the Losi 8ight 1/8 Scale Buggy and Truggy.  LOSA1756
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Affiliation:平成医療短期大学,リハビリテーション学科,教授, Research Field:Ophthalmology, Keywords:HTLV-I,PAX6,網膜変性,網膜色素変性症,Retina,Retinitis pigmentosa,HLA,加齢黄斑変性,Monoclinal antibody,Sugar transferases, # of Research Projects:9, # of Research Products:0
Glycosyltransferase (GT) enzymes are incredibly diverse in their abilities to catalyze the transfer of sugar molecules to protein, carbohydrate, and lipid substrates. GTs have various metabolic and regulatory roles in biology. Glycosyltransferase targets provide different areas of therapeutic potential in a wide array of disease, including cancer, metabolic disorders, and infectious disease. A glycosyltransferase ...
Centralized Modularity of N-Linked Glycosylation Pathways in Mammalian Cells. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Arsenic, Copper, Iron, Cells, Gene, Virus, Donor, Flavonoids, Glucose, Glucuronic Acid, Glycosyltransferases, Guanidinium, Plant, Plants, Plays, Report, Role, Specificity, Udp, Udpga
Creative Biogene offers challenging job opportunities for people looking for career growth in an entrepreneurial environment that recognizes individual contributions ...
Supplementary Materials10549_2017_4442_MOESM1_ESM. blotting, luciferase reporter assays, TUNEL assays, analysis of the gene, and ChIP assays. Results NSC35446.HCl inhibited proliferation and induced apoptosis in antiestrogen resistant LCC9, T47DCO, MCF-7/RR, and LY2 cells but not in ER-negative breast malignancy cell lines. (mRNA and protein expression in LCC9 cells. NSC35446.HCl also inhibited NF-B activity and expression of NF-B target genes. analysis of the promoter recognized nine estrogen response element (ERE) half-sites and one ERE-like full-site. ChIP assays revealed that ER was recruited to the ERE-like full-site and five from the nine half-sites which ER recruitment was inhibited by NSC35446.HCl in T47DCO and. ...
Sugars are involved in almost every aspect of biology, from recognising pathogens and to blood clotting.The glycomes basic building blocks are far more numerous and varied than the four letters of the DNA alphabet or the score of amino acids that make proteins.In the late 1980s, when researchers isolated the first gene for a glycosyl transferase, an enzyme that adds sugars to fats and proteins. The discovery gave scientists the first opportunity to study this process, which is usually called glycoslyation, by manipulating the activity of such enzymes ...
Say the Act of Contrition, I demanded before I even said good morning. Now, before you think Im a crazy lunatic you must know that tonight was her first reconciliation. A big night. So Im not a crazy lunatic, just a regular kind of fathery type lunatic whos been studying the Act of Contrition to the point where at night we all dream about how heartily sorry we all are. Just say the Act of Contrition, I said. One last time and Ill never ask again ...
My Fringe journey continues! Sex talks, rapid aging, and Peter singing Row row row your boat made episode 2 quite enjoyable. Someone call Sigourney Weaver! This girl is gonna burst Alien style. Its the Fringe committee and they are talking about their new ragtag team (the best kind!). Ooh la la. Peter in his boxers.…
A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched…
A4GALT encodes a type II membrane glycosyltransferase and results in Pk and P1 antigens of the P Non-ABO blood group along with B3GALNT1. ...
Ardiccioni C, Clarke OB, Tomasek D, Issa HA, von Alpen DC, Pond HL, Banerjee S, Rajashankar KR, Liu Q, Guan Z, et al. Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. Nat Commun. 2016 ;7:10175. ...
Ardiccioni C, Clarke OB, Tomasek D, Issa HA, von Alpen DC, Pond HL, Banerjee S, Rajashankar KR, Liu Q, Guan Z, et al. Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. Nat Commun. 2016 ;7:10175. ...
Guys, Im ready for Olivia to come home. Things need to be set right in the blue universe. Peter is making AltLivia breakfast in bed and buying her U2 tickets. AltLivia is winning Walters heart with food and the Fringe team is being manipulated by Darth Vader Walternate. Things are falling apart and I dont…
pep chromosome:GRCm38:5:140607320:140615545:1 gene:ENSMUSG00000029570 transcript:ENSMUST00000031555 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Lfng description:LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1095413 ...
Ive been fighting a lunatic A ludicrous maker of little white lies An avid fantasizer of little legs, And Bambi eyes, with shallow heads * He says he can give me everything I say, make me a better woman Because Im sickened by my diet Because Im silenced by ignorant ears Because Im different in…
2004). "Nuclear magnetic resonance-based dissection of a glycosyltransferase specificity for the mucin MUC1 tandem repeat". ... "Glycosyltransferases. Structure, localization, and control of cell type-specific glycosylation". J. Biol. Chem. 264 (30): 17615 ...
Glycosyltransferases (GTs) catalyze the formation of glycosidic bonds between sugar molecules using nucleotide sugar as donor ... Lairson, L.L.; Henrissat, B.; Davies, G.J.; Withers, S.G. (2008-06-02). "Glycosyltransferases: Structures, Functions, and ... Keegstra, Kenneth; Raikhel, Natasha (2001-06-01). "Plant glycosyltransferases". Current Opinion in Plant Biology. 4 (3): 219- ... "Analysis of the Arabidopsis IRX9/IRX9-L and IRX14/IRX14-L Pairs of Glycosyltransferase Genes Reveals Critical Contributions to ...
"Glycosyltransferases encoded by viruses". Journal of General Virology. 85 (10): 2741-2754. doi:10.1099/vir.0.80320-0. PMID ... and Golgi apparatus by host-encoded glycosyltransferases, PBCV-1 glycosylates its major capsid protein independently by ...
Histo-blood group ABO system transferase is an enzyme with glycosyltransferase activity, which is encoded by the ABO gene in ... Remarkably, the difference between the A and B glycosyltransferase enzymes is only four amino acids. The O allele lacks both ... Nagai M, Davè V, Kaplan BE, Yoshida A (January 1978). "Human blood group glycosyltransferases. I. Purification of n- ... In human cells, the ABO alleles and their encoded glycosyltransferases have been described in several oncologic conditions. ...
Henrissat B, Davies GJ (December 2000). "Glycoside hydrolases and glycosyltransferases. Families, modules, and implications for ...
Breton C, Snajdrová L, Jeanneau C, Koca J, Imberty A (February 2006). "Structures and mechanisms of glycosyltransferases". ... This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ...
They are substrates for glycosyltransferases. The nucleotide sugars are also intermediates in nucleotide sugar interconversions ...
Berger EG (Feb 2002). "Ectopic localizations of Golgi glycosyltransferases". Glycobiology. 12 (2): 29R-36R. doi:10.1093/glycob/ ...
"ABO Glycosyltransferase; ABO". Online Mendelian Inheritance in Man. National Library of Medicine. Archived from the original on ...
Glycosyltransferase is a subcategory of EC 2.4 transferases that is involved in biosynthesis of disaccharides and ... Both A and B transferases are glycosyltransferases, meaning they transfer a sugar molecule onto an H-antigen. This allows H- ... "Keyword Glycosyltransferase". UniProt. UniProt Consortium. Retrieved 26 November 2013. Fitzgerald DK, Brodbeck U, Kiyosawa I, ... An example of a prominent glycosyltransferase is lactose synthase which is a dimer possessing two protein subunits. Its primary ...
McKusick, Victor A.; Gross, Matthew B. (18 November 2014). "ABO Glycosyltransferase; ABO". Online Mendelian Inheritance in Man ...
This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ... "Glycosphingolipid glycosyltransferases in human fetal brain". J. Neurochem. 56 (5): 1461-5. doi:10.1111/j.1471-4159.1991. ... "Glycolipids and glycosyltransferases in permanent cell lines established from human medulloblastomas". Biochim. Biophys. Acta. ...
Handbook of Glycosyltransferases and Related Genes. Japan, Tokyo: Springer. pp. 15-30. doi:10.1007/978-4-431-54240-7_107. ISBN ...
Williams, Gavin J.; Thorson, Jon S. (2009). Natural product glycosyltransferases: properties and applications. Advances in ...
Enzymes called glycosyltransferases link the saccharide to the lipid molecule, and also play a role in assembling the correct ... Williams GJ, Thorson JS (2009). "Natural product glycosyltransferases: properties and applications". Advances in Enzymology. ...
"Pfam entry: Glycosyl transferases group 1". Archived from the original on 2007-09-29. Retrieved 2007-01-25. "Pfam entry: ... glycosyltransferase and transglycosidases), or proteins (signal peptidase and palmitoyl protein thioesterases). Lipases can ...
"An evolving hierarchical family classification for glycosyltransferases". Journal of Molecular Biology. 328 (2): 307-317. doi: ...
It is a glycosyltransferase (EC 2.4.1.11) that catalyses the reaction of UDP-glucose and (1,4-α-D-glucosyl)n to yield UDP and ( ... such as glycogen phosphorylase and other glycosyltransferases of the GT-B superfamily. Nonetheless, a more recent ... "An evolving hierarchical family classification for glycosyltransferases". J. Mol. Biol. 328 (2): 307-17. doi:10.1016/S0022-2836 ...
... contains 94 families of Glycosyl transferase enzymes, 22 families of polysaccharide lysases and 16 families of ... Included in the database are families of glycoside hydrolases, glycosyltransferases, polysaccharide lyases, carbohydrate ... Current statistics are available on each Glycoside Hydrolase, Glycosyltransferase, Polysaccharide Lyase, Carbohydrate Esterase ... "An evolving hierarchical family classification for glycosyltransferases". Journal of Molecular Biology. 328 (2): 307-317. doi: ...
Category:EC 2.4 (glycosyltransferases)Edit. *Category:EC 2.4.2 *Hypoxanthine-guanine phosphoribosyltransferase EC 2.4.2.8 ...
"ABO Glycosyltransferase; ABO". Online Mendelian Inheritance in Man. National Library of Medicine. Retrieved 7 November 2016 ...
Almost all glycosyltransferases reside in the Golgi apparatus. However, POFUT2 as well as the related enzyme POFUT1 have ... The protein is an inverting glycosyltransferase, which means that the enzyme uses GDP-β-L-fucose as a donor substrate and ...
Taniguchi N, Honke K, Fukuda M (2002). Handbook of glycosyltransferases and related genes (1st ed.). Springer. ISBN 443170311X ... "Intracellular localization of liver sugar nucleotide glycoprotein glycosyltransferases in a Golgi-rich fraction". The Journal ...
Glycosyltransferases associated with taxons: gene and enzyme identifiers, full structures, donor and substrates, methods used ... Toukach Ph.V.; Egorova K.S. (2017). "CSDB_GT: a new curated database on glycosyltransferases". Glycobiology. 27 (4): 285-290. ... Egorova K.S.; Knirel Y.A.; Toukach Ph.V. (2019). "Expanding CSDB_GT glycosyltransferase database with Escherichia coli". ... Taxon clustering based on similarities of glycomes (carbohydrate-based tree of life) Glycosyltransferase subdatabase (GT- ...
Mucopolysaccharidoses Glucosidase Lysozyme Glycosyltransferase List of glycoside hydrolase families Clans of glycoside ... Together with glycosyltransferases, glycosidases form the major catalytic machinery for the synthesis and breakage of ... "Glycoside hydrolases and glycosyltransferases: families and functional modules". Current Opinion in Structural Biology. 11 (5 ...
Glycosyltransferase-like protein LARGE1 is an enzyme that in humans is encoded by the LARGE gene. This gene, which is one of ... It encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan, and may carry out the synthesis of ... "Entrez Gene: LARGE like-glycosyltransferase". Nagase T, Ishikawa K, Miyajima N, et al. (1998). "Prediction of the coding ... 2005). "Localization and functional analysis of the LARGE family of glycosyltransferases: significance for muscular dystrophy ...
Palamarczyk G, Lehle L, Mankowski T, Chojnacki T, Tanner W (1980). "Specificity of solubilized yeast glycosyl transferases for ... This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ...
Whereas in the medial portion of the Golgi, glycosyltransferases add sugar residues to the core glycan structure, giving rise ... These modifications are catalyzed by glycosyltransferases and glycosidases respectively. In the cis-Golgi, a series of ... Glycosylation O-linked glycosylation Gene expression N-Glycosyltransferase "Glycosylation". UniProt: Protein sequence and ...
The complex glycan structures are then elaborated by a suite of glycosyltransferases, the majority of which are bio-chemically ... Li, Wenhua L.; Liu, Yuanyuan; Douglas, Carl J. (2017-01-01). "Role of Glycosyltransferases in Pollen Wall Primexine Formation ... Showalter, Allan M.; Basu, Debarati (2016). "Extensin and Arabinogalactan-Protein Biosynthesis: Glycosyltransferases, Research ... Showalter, Allan M.; Basu, Debarati (2016-06-15). "Extensin and Arabinogalactan-Protein Biosynthesis: Glycosyltransferases, ...
It is a type of glycosyltransferase. The sugar Glc3Man9GlcNAc2 (where Glc=Glucose, Man=Mannose, and GlcNAc=N-acetylglucosamine ...
CAZypedia Glycosyltransferases CAZy Glycosyl Transferase Singh, S; Phillips GN, Jr; Thorson, JS (October 2012). "The structural ... a new glycosyltransferase fold was identified for the glycosyltransferases involved in the biosynthesis of the NAG-NAM polymer ... The combination of glycosyltransferases by both alleles present in each person determines whether there is an AB, A, B or O ... Some glycosyltransferase inhibitors are of use as drugs or antibiotics. Moenomycin is used in animal feed as a growth promoter ...
Molecular modeling of glycosyltransferases.. Imberty A1, Wimmerová M, Koca J, Breton C. ... Glycosyltransferases, the enzymes that build oligosaccharides and glycoconjugates, have received much interest in recent years ...
... including N-glycosyltransferases. N-glycosyltransferases are an unusual type of glycosyltransferase which joins single hexoses ... The N-glycosyltransferase is accompanied by another glycosyltransferase which attaches glucose to a protein-bound glycan, and ... Structurally N-glycosyltransferases belong to the GT41 family of glycosyltransferases and resemble protein O-GlcNAc transferase ... a pattern frequently observed in glycosyltransferases, and some N-glycosyltransferases can attach additional hexoses on oxygen ...
Gateau O., Morélis R., Louisot P. (1986) Solubilization of Lipid-Glycosyltransferases from Mitochondrial Outer Membranes. In: ...
... Dr. P. Dupree p.dupree at bioc.cam.ac.uk Mon Sep 28 10:42:41 EST 1998 *Previous ... The aim of the project is to determine the function of a family of putative Golgi-glycosyltransferases in cell wall ...
Glycosyltransferases are a ubiquitous group of enzymes that catalyse the transfer of a sugar moiety from an activated sugar ... An evolving hierarchical family classification for glycosyltransferases.. Coutinho PM1, Deleury E, Davies GJ, Henrissat B. ... Although many glycosyltransferases catalyse chemically similar reactions, presumably through transition states with substantial ... We have performed a comprehensive survey of glycosyltransferase-related sequences (over 7200 to date) and present here a ...
Probable peptidoglycan glycosyltransferase FtsW/RodA (IPR001182). Short name: FtsW/RodA Family relationships *Probable ... peptidoglycan glycosyltransferase FtsW/RodA (IPR001182) *Cell division protein FtsW (IPR013437). *Probable peptidoglycan ...
Literature: Glycosyl transferase family 10 (IPR001503). References used in this entry. The following publications were referred ... A classification of nucleotide-diphospho-sugar glycosyltransferases based on amino acid sequence similarities.. Campbell JA, ...
Glycosyltransferases - Equus caballus (horse). [ Brite menu , Organism menu , Download htext , Download json ] ...
Glycosyltransferases - Capra hircus (goat). [ Brite menu , Organism menu , Download htext , Download json ] ...
In vitro characterization of IroB, a pathogen-associated C-glycosyltransferase. Michael A. Fischbach, Hening Lin, David R. Liu ... In vitro characterization of IroB, a pathogen-associated C-glycosyltransferase. Michael A. Fischbach, Hening Lin, David R. Liu ... In vitro characterization of IroB, a pathogen-associated C-glycosyltransferase. Michael A. Fischbach, Hening Lin, David R. Liu ... In vitro characterization of IroB, a pathogen-associated C-glycosyltransferase Message Subject (Your Name) has sent you a ...
Structural basis of the molecular ruler mechanism of a bacterial glycosyltransferase.. Ramirez, A.S., Boilevin, J., Mehdipour, ... The membrane-associated, processive and retaining glycosyltransferase PglH from Campylobacter jejuni is part of the ... The membrane-associated, processive and retaining glycosyltransferase PglH from Campylobacter jejuni is part of the ...
Glycan imaging with glycosyltransferases and click chemistry. Immunofluorescence detection of terminal heparan sulfate, ... Since glycosyltransferases have well defined substrate specificities, this method offers precise detection of target glycans. ... We describe here a method for enzyme-based glycan imaging using glycosyltransferases. Azido-sugars are incorporated into target ...
UDP-glycosyltransferase (UGT) enzymes catalyze the conjugation of an activated sugar form, uridine diphosphate (UDP)-glycoside ... UDP-glycosyltransferase (UGT) enzymes catalyze the conjugation of an activated sugar form, uridine diphosphate (UDP)-glycoside ... UDP-glycosyltransferase (UGT) enzymes catalyze the conjugation of an activated sugar form, uridine diphosphate (UDP)-glycoside ... This Research Topic will focus on the invertebrate UDP-glycosyltransferases (UGTs) and we welcome the submission of Original ...
Glycosyltransferase 6 gene family includes ABO, Ggta1, iGb3S, and GBGT1 genes and by three putative genes restricted to mammals ... Molecular Evolution of the Glycosyltransferase 6 Gene Family in Primates. Eliane Evanovich,1 Patricia Jeanne de Souza Mendonça- ...
The glycosyl transferase module is linked, via a short junction site, to the amino end of a Q447-N844 acyl transferase module, ... The glycosyl transferase module of PBP1b, the lysozymes and the lytic transglycosylase Slt70 have much the same catalytic ... The catalytic, glycosyl transferase and acyl transferase modules of the cell wall peptidoglycan-polymerizing penicillin-binding ... This segment is linked, via an ≅ 100-amino-acid insert, to a D198-G435 glycosyl transferase module that possesses the five ...
This technology is expected to provide glycosyltransferase enzymes that can catalyze the biosynthesis of 12-, 14-, and 16- ... DESCRIPTION (provided by applicant): Glycosyltransferases involved in linking polyketide macrolactones with deoxysugars are key ...
These substituents are transferred as nucleotide-activated sugars to an aglycon by glycosyltransferases. Engineering these ... A bacterial glycosyltransferase gene toolbox: generation and applications Phytochemistry. Oct-Nov 2009;70(15-16):1812-21. doi: ... In this review we present the generation of a glycosyltransferase gene toolbox which contains more than 70 bacterial ... Investigations of the function, specificity and structure of these glycosyltransferases help to understand the great potential ...
redirected from glycosyl transferases). Also found in: Dictionary, Encyclopedia. glycosyl. [gli´ko-sil] a radical derived from ... glycosyl transferases. enzymes catalyzing the transfer of a monosaccharide unit from a nucleotide-linked sugar to the non- ... Glycosyl transferases , definition of glycosyl transferases by Medical dictionary https://medical-dictionary.thefreedictionary. ...
Bifunctional O-glycosyltransferase and N-glycosyltransferase that can detoxify xenobiotics. Possesses high activity to ...
Recent design of glycosyltransferase inhibitors. Shuai Wang and Sébastien Vidal Carbohydrates are implicated in several ... The present review will provide an overview of the past two decades of glycosyltransferase inhibitors development, and will ... displayed at the surface of the cell through glycoproteins or glycolipids is orchestrated by glycosyltransferases and ...
GlycosyltransferaseUniRule annotation. ,p>Information which has been generated by the UniProtKB automatic annotation system, ... Belongs to the UDP-glycosyltransferase family.UniRule annotation. Automatic assertion according to rulesi ... tr,K3ZSR6,K3ZSR6_SETIT Glycosyltransferase OS=Setaria italica OX=4555 GN=101783443 PE=3 SV=1 ...
C. Jeanneau, D. Grando, A. Imberty, C. Breton; Conserved peptide motifs of glycosyltransferases. Biochem Soc Trans 1 February ...
... Nature. 2000 Jul 27;406(6794):369-75. doi: 10.1038/35019000. ...
tr,H2C585,H2C585_9CREN Glycosyltransferase OS=Metallosphaera yellowstonensis MK1 OX=671065 GN=MetMK1DRAFT_00017080 PE=4 SV=1 ...
UDP-glycosyltransferases (UGTs) participate in the metabolic inactivation of anthelmintics and other xenobiotic substrates ... UDP-glycosyltransferases (UGTs) participate in the metabolic inactivation of anthelmintics and other xenobiotic substrates ... UDP-Glycosyltransferases and Albendazole Metabolism in the Juvenile Stages of Haemonchus contortus. Pavlína Kellerová, Martina ... 2020). UDP-glycosyltransferases contribute to spirotetramat resistance in Aphis gossypii Glover. Pestic. Biochem. Physiol. 166: ...
Keywords: pteridine glycosyltransferase; Chlorobium tepidum; tetrahydrobiopterin; UDP-N-acetylglucosamine; L. -threo- ... The pteridine glycosyltransferase (PGT) found in Chlorobium tepidum (CtPGT) catalyzes the conversion of L. -threo- ... In C. tepidum, there is a gene for pteridine glycosyltransferase (CtPGT; Gene ID 1007245; UniProt ID Q8KE51). In the CAZy ... The gene for pteridine glycosyltransferase from C. tepidum (CtPGT) was isolated and amplified by polymerase chain reaction ...
Computer model showing ABO glycosyltransferase (green, purple) with UDP-galactose in red and yellow, the target sugar chain in ... Caption: ABO blood type glycosyltransferase. Computer model showing ABO glycosyltransferase (green, purple) with UDP-galactose ... glycosyltransferase, illustration, molecular model, molecular structure, molecule, nobody, space-fill, space-filled, spacefill ...
... like-glycosyltransferase , glycosyltransferase-like protein LARGE1-like , glycosyltransferase-like protein LARGE2 , like- ... Am meisten referenzierte anti-Like-Glycosyltransferase Antikörper. Show all anti-Like-Glycosyltransferase (LARGE) Antikörper ... Zusätzlich bieten wir Ihnen Like-Glycosyltransferase Proteine (6) und Like-Glycosyltransferase Kits (3) und viele weitere ... glycosyltransferase-like protein LARGE1 , glycosyltransferase-like 1A , acetylglucosaminyltransferase-like 1A , ...
Absence of the basilar pons in mice lacking a functional Large glycosyltransferase gene suggests a defect in pontine neuron ... Mutation of Large, which encodes a putative glycosyltransferase, in an animal model of muscular dystrophy. Grewal, P.K., Hewitt ... Mutant glycosyltransferase and altered glycosylation of alpha-dystroglycan in the myodystrophy mouse. Grewal, P.K., Holzfeind, ... Here we show that the gene mutated in myd encodes a glycosyltransferase, Large. The human homolog of this gene (LARGE) maps to ...
  • Glycosyltransferases, the enzymes that build oligosaccharides and glycoconjugates, have received much interest in recent years owing to their biological functions and their potential uses in biotechnology. (nih.gov)
  • Glycosyltransferases (GTFs, Gtfs) are enzymes (EC 2.4) that establish natural glycosidic linkages. (wikipedia.org)
  • Glycosyltransferases that use sugar nucleotide donors are Leloir enzymes, after Luis F. Leloir, the scientist who discovered the first sugar nucleotide and who received the 1970 Nobel Prize in Chemistry for his work on carbohydrate metabolism. (wikipedia.org)
  • Many glycosyltransferases are single-pass transmembrane proteins, and they are usually anchored to membranes of Golgi apparatus Glycosyltransferases can be segregated into "retaining" or "inverting" enzymes according to whether the stereochemistry of the donor's anomeric bond is retained (α→α) or inverted (α→β) during the transfer. (wikipedia.org)
  • Such enzymes have been found in the bacteria Actinobacillus pleuropneumoniae (whose N-glycosyltransferase is the best researched member of this enzyme family) and Haemophilus influenzae, and later in other bacterial species such as Escherichia coli. (wikipedia.org)
  • Glycosyltransferases are a ubiquitous group of enzymes that catalyse the transfer of a sugar moiety from an activated sugar donor onto saccharide or non-saccharide acceptors. (nih.gov)
  • We have performed a comprehensive survey of glycosyltransferase-related sequences (over 7200 to date) and present here a classification of these enzymes akin to that proposed previously for glycoside hydrolases, into a hierarchical system of families, clans, and folds. (nih.gov)
  • This evolving classification rationalises structural and mechanistic investigation, harnesses information from a wide variety of related enzymes to inform cell biology and overcomes recurrent problems in the functional prediction of glycosyltransferase-related open-reading frames. (nih.gov)
  • UDP-glycosyltransferase (UGT) enzymes catalyze the conjugation of an activated sugar form, uridine diphosphate (UDP)-glycoside, with a variety of small lipophilic compounds. (frontiersin.org)
  • Abstract DESCRIPTION (provided by applicant): Glycosyltransferases involved in linking polyketide macrolactones with deoxysugars are key enzymes for combinatorial biosynthesis of novel macrolide anti-infective agents. (sbir.gov)
  • This technology is expected to provide glycosyltransferase enzymes that can catalyze the biosynthesis of 12-, 14-, and 16-membered ring macrolides. (sbir.gov)
  • Investigations of the function, specificity and structure of these glycosyltransferases help to understand the great potential of these enzymes for natural product biosynthesis. (nih.gov)
  • Cyclodextrin glycosyltransferase (CGTase) is one of the most important groups of microbial amylolytic enzymes that have been used for degradation of starch to yield cyclodextrin (CD) via cyclization reaction. (academicjournals.org)
  • Like other glycosyltransferases, these two enzymes have been shown to recognize substrates through dramatic conformational changes in mobile polypeptide loops surrounding the active site. (sigmaaldrich.com)
  • Nucleotide sugar-dependent glycosyltransferases are often referred to as Leloir enzymes. (axonmedchem.com)
  • The human UDP glycosyltransferase (UGT) superfamily comprises four families of enzymes that catalyze the addition of sugar residues to small lipophilic chemicals. (aspetjournals.org)
  • The UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyze conjugation of lipophilic chemicals with sugar groups. (aspetjournals.org)
  • This review outlines current knowledge of these glycosyltransferases drawing on information gained from studies of plant and mammalian enzymes. (deepdyve.com)
  • Dedicated prolyl hydroxylase, lysyl hydroxylase, and collagen glycosyltransferase enzymes localized in the endoplasmic reticulum mediate these modifications prior to the formation of the collagen triple helix. (uzh.ch)
  • H3 looks like a glycosyltransferase, a family of enzymes that transfer carbohydrate molecules to a variety of acceptor substrates. (asm.org)
  • Glycosyltransferase (GT) enzymes participate in diverse metabolic and regulatory roles by catalyzing the transfer of sugars to protein, lipid and carbohydrate acceptors as well as to other molecules. (bellbrooklabs.com)
  • Transcreener is the only HTS-compatible glycosyltransferase assay method allows direct detection of reaction products without the use of coupling enzymes. (bellbrooklabs.com)
  • Authoritative and easily accessible, Glycosyltransferases: Methods and Protocols is a vital contribution to glycobiology and glycopathology, and to applications of these enzymes in biotechnology and drug development. (aacoa.net)
  • Glycosyltransferase (GT) enzymes are incredibly diverse in their abilities to catalyze the transfer of sugar molecules to protein, carbohydrate, and lipid substrates. (bellbrooklabs.com)
  • Utilization of wild-type and mutant glycosyltransferase for linking glycoconjugates via glycan moieties: The mutant enzymes that have been generated in our laboratory can transfer a sugar residue with a chemically reactive unique functional group to a sugar moiety of a glycoprotein or glycolipids (glycoconjugates). (grantome.com)
  • Protein glycosylation is a form of post-translational modification, which is important for many biological processes and often serves as an analog switch that modulates protein activity.The class of enzymes responsible for transferring the sugar moiety onto proteins is called a glycosyltransferase (GT). (promegaconnections.com)
  • These enzymes, called glycosyltransferases (GTs), transfer sugar molecules. (thefreedictionary.com)
  • Specific topics include glycosyltransferases and glycan-processing enzymes, proteoglycans and sulfated glycosamingoglycans, the discovery and classification of glycan-binding proteins, glycans in acquired human diseases, and the chemoenzymatic synthesis of glycans and glycoconjugates. (thefreedictionary.com)
  • In fact, according to the Structural Classification of Proteins database, only three different folds have been observed for glycosyltransferases Very recently, a new glycosyltransferase fold was identified for the glycosyltransferases involved in the biosynthesis of the NAG-NAM polymer backbone of peptidoglycan. (wikipedia.org)
  • The biosynthesis of oligosaccharides displayed at the surface of the cell through glycoproteins or glycolipids is orchestrated by glycosyltransferases and glycosidases creating and hydrolysing glycosidic bonds, respectively. (rsc.org)
  • SPG2 (synonymous with IRREGULAR XYLEM9-LIKE [ IRX9L ]) encodes a family GT43 glycosyltransferase involved in xylan backbone biosynthesis, while UPEX1 encodes a family GT31 glycosyltransferase likely involved in galactosylation of arabinogalactan proteins. (plantphysiol.org)
  • In this study, we have set up a bioinformatics strategy aimed at identifying putative glycosyltransferases (GTs) involved in RG-II biosynthesis. (plos.org)
  • Based on homologies with glycosyltransferases of known functions, putative roles in the RG-II biosynthesis are proposed for some GT candidates. (plos.org)
  • With regards to glycosyltransferases (GTs) involved in RG-II biosynthesis, only a unique xylosyltransferase activity has been so far biochemically characterised out of approximately 20 GTs that are required for the synthesis of this pectic molecule. (plos.org)
  • The human ABO(H) A and B blood group glycosyltransferases GTA and GTB differ by only four amino acids, yet this small dissimilarity is responsible for significant differences in biosynthesis, kinetics and structure. (sigmaaldrich.com)
  • Cooperative Involvement of Glycosyltransferases in the Transfer of Amino Sugars during the Biosynthesis of the Macrolactam Sipanmycin by Streptomyces sp. (asm.org)
  • We present evidence for the possible involvement of a glycosyltransferase of this family in the synthesis of pectic polysaccharides, suggesting that other members of this large multigene family in Arabidopsis also may be important for pectin biosynthesis. (plantcell.org)
  • Glucosaminylglycan biosynthesis: what we can learn from the X-ray crystal structures of glycosyltransferases GlcAT1 and EXTL2. (semanticscholar.org)
  • The structural basis for a coordinated reaction catalyzed by a bifunctional glycosyltransferase in chondroitin biosynthesis. (semanticscholar.org)
  • Here we report the identification of a highly conserved putative glycosyltransferase encoding gene, Pectic ArabinoGalactan synthesis-Related ( PAGR ), affecting the biosynthesis of RG-I arabinogalactans and critical for pollen tube growth. (biomedcentral.com)
  • Glycosyltransferases (GTs) are essential for the biosynthesis of complex glycoconjugates and are powerful tools to study the functions of complex glycans in health, development and disease. (aacoa.net)
  • In this transcriptome, the key role of glycosyltransferases and the main players involved in signal transduction, biosynthesis and deactivation of gibberellic acid has been demonstrated in the resistance reaction. (thefreedictionary.com)
  • In addition, 2 nonsynonymous substitutions were observed in the capsule biosynthesis genes csiC/cskC and csiD/cskD, for which the deduced amino acid sequence encoded putative glycosyltransferases belonging to families 1 and 2, respectively. (thefreedictionary.com)
  • The ABO gene locus expressing the glycosyltransferases has three main allelic forms: A, B, and O. The A allele encodes 1-3-N-acetylgalactosaminyltransferase that bonds α-N-acetylgalactosamine to D-galactose end of H antigen, producing the A antigen. (wikipedia.org)
  • Glycosyltransferase 6 gene family includes ABO, Ggta1, iGb3S, and GBGT1 genes and by three putative genes restricted to mammals, GT6m6, GTm6, and GT6m7, only the latter is found in primates. (hindawi.com)
  • In this review we present the generation of a glycosyltransferase gene toolbox which contains more than 70 bacterial glycosyltransferases to date. (nih.gov)
  • Quantitative analysis of glycosyltransferase gene expression in human normal and cancerous colorectal tissue'Lab.Invest. (nii.ac.jp)
  • We report ALS-causing mutations within the gene encoding the glycosyltransferase GLT8D1. (soton.ac.uk)
  • Further specifically disclosed is a glycosyltransferase gene comprising DNA encoding the glycosyltransferase. (go.jp)
  • In the above-mentioned Patent Document 1, incorporating the glycosyltransferase is encoded by the gene, as a sugar donor UDP - glucose, glucose transfer to the catalyst to catalyze a reaction (see Patent Document 1 embodiment 4). (go.jp)
  • Both mutants carry a T-DNA insertion in a gene ( QUA1 ) that encodes a putative membrane-bound glycosyltransferase of family 8. (plantcell.org)
  • A member of the Glycosyltransferase Family 64, homologous to Poplar cambium-expressed GT64 gene. (mybiosource.com)
  • Cyclodextrin, cyclodextrin glycosyltransferase, starch. (academicjournals.org)
  • Cyclodextrin glycosyltransferases (CGTases) from Paenibacillus macerans, Thermoanaerobacter sp. (semanticscholar.org)
  • Recent advances in discovery, heterologous expression, and molecular engineering of cyclodextrin glycosyltransferase for versatile applications. (semanticscholar.org)
  • Substrate complexation and aggregation influence the cyclodextrin glycosyltransferase (CGTase) catalyzed synthesis of alkyl glycosides. (semanticscholar.org)
  • The physicochemical properties and kinetics of cyclodextrin glycosyltransferase from Bacillus lehensis were determined. (longdom.org)
  • Extractive bioconversion of cyclodextrins by Bacillus cereus cyclodextrin glycosyltransferase in aqueous two-phase system. (pubfacts.com)
  • An extractive bioconversion with Bacillus cereus cyclodextrin glycosyltransferase (CGTase, EC 2.4.1.19) in aqueous two-phase system (ATPS) was investigated for the synthesis and recovery of cyclodextrins (CDs). (pubfacts.com)
  • The carbohydrate-active enzyme database presents a sequence-based classification of glycosyltransferases into over 90 families. (wikipedia.org)
  • N-glycosyltransferase is an enzyme in prokaryotes which transfers individual hexoses onto asparagine sidechains in substrate proteins, using a nucleotide-bound intermediary, within the cytoplasm. (wikipedia.org)
  • The Actinobacillus pleuropneumoniae N-glycosyltransferase is the best researched enzyme of this family. (wikipedia.org)
  • The glutamine-469 residue in the Actinobacillus pleuropneumoniae N-glycosyltransferase and its homologues in other N-glycosyltransferases is important for the selectivity of the enzyme. (wikipedia.org)
  • Structurally N-glycosyltransferases belong to the GT41 family of glycosyltransferases and resemble protein O-GlcNAc transferase, an eukaryotic enzyme with various nuclear, mitochondrial and cytosolic targets. (wikipedia.org)
  • We describe here a method for enzyme-based glycan imaging using glycosyltransferases. (rndsystems.com)
  • We demonstrate that the L230 open reading frame of the giant virus Acanthamoeba polyphaga mimivirus encodes an enzyme that has distinct lysyl hydroxylase and collagen glycosyltransferase domains. (uzh.ch)
  • In conclusion, we have linked ALS pathophysiology to inherited mutations that diminish the activity of a glycosyltransferase enzyme. (soton.ac.uk)
  • The formation of these structures is performed by glycosyltransferases (GT), an enzyme group structurally conserved within all kingdoms. (diva-portal.org)
  • In most cases, the target enzyme is a glycosyltransferase. (bellbrooklabs.com)
  • The principal substrates of N-glycosyltransferases are adhesins. (wikipedia.org)
  • UDP-glycosyltransferases (UGTs) participate in the metabolic inactivation of anthelmintics and other xenobiotic substrates through their conjugation with activated sugar, which drives the elimination of the xenobiotics due to enhanced solubility. (frontiersin.org)
  • Glycosidation or conjugation of activated sugar to a lipophilic compound, in general, is performed by UDP-glycosyltransferases (UGTs), during the second phase of biotransformation, causing the metabolic inactivation of xenobiotic substrates. (frontiersin.org)
  • The acceptor substrates utilized by glycosyltransferases are most commonly other sugars but can also be a lipid, protein, nucleic acid, antibiotic, or another small molecule. (axonmedchem.com)
  • The X-ray crystal structures of two glycosyltransferases (GTs)--beta 1,3-glucuronyltransferase 1 (GlcAT1) and alpha 1,4-N-acetylhexosaminyltransferase (EXTL2)--have now been determined in the presence of both donor and acceptor substrates. (semanticscholar.org)
  • Florescent substrates for glycosyltransferases? (bio.net)
  • oligosaccharides as substrates for glycosyltransferases. (bio.net)
  • Glycosyltransferases that use non-nucleotide donors such as dolichol or polyprenol pyrophosphate are non-Leloir glycosyltransferases. (wikipedia.org)
  • A classification of nucleotide-diphospho-sugar glycosyltransferases based on amino acid sequence similarities. (ebi.ac.uk)
  • These substituents are transferred as nucleotide-activated sugars to an aglycon by glycosyltransferases. (nih.gov)
  • We demonstrate that H3 binds the sugar nucleotide UDP-glucose, as do glycosyltransferases. (asm.org)
  • However, glycosyltransferases cannot simply transfer a monosaccharide by itself-the monosacharide must be conjugated to a nucleotide. (promegaconnections.com)
  • The most common nucleotide used by glycosyltransferases is uridine diphosphate (UDP). (promegaconnections.com)
  • According to the results of phylogenetic analysis with several identified flavonoid-catalyzing glycosyltransferases (GTs), three glycosyltransferase genes ( BsGT110 , BsGT292 and BsGT296 ) from the genome of the Bacillus subtilis ATCC 6633 strain were cloned and expressed in Escherichia coli . (mdpi.com)
  • Initially, protein glycosylation was considered to be a purely eukaryotic process before such processes were discovered in prokaryotes, including N-glycosyltransferases. (wikipedia.org)
  • N-glycosyltransferases are an unusual type of glycosyltransferase which joins single hexoses to the target protein. (wikipedia.org)
  • At least the Actinobacillus pleuropneumoniae N-glycosyltransferase can also hydrolyze sugar-nucleotides in the absence of a substrate, a pattern frequently observed in glycosyltransferases, and some N-glycosyltransferases can attach additional hexoses on oxygen atoms of the protein-linked hexose. (wikipedia.org)
  • The membrane-associated, processive and retaining glycosyltransferase PglH from Campylobacter jejuni is part of the biosynthetic pathway of the lipid-linked oligosaccharide (LLO) that serves as the glycan donor in bacterial protein N-glycosylation. (rcsb.org)
  • Zusätzlich bieten wir Ihnen Like-Glycosyltransferase Proteine (6) und Like-Glycosyltransferase Kits (3) und viele weitere Produktgruppen zu diesem Protein an. (antikoerper-online.de)
  • Also, a third protein with homology to P450 monooxygenases, SipO2, is shown to be essential in the second glycosylation step, forming a complex with the glycosyltransferase pair SipS9-SipS14. (asm.org)
  • The H3 crystal structure shows that it has a glycosyltransferase protein fold. (asm.org)
  • Below are the list of possible Glycosyltransferase family 64 protein products. (mybiosource.com)
  • Also known as Glycosyltransferase family 64 protein C4 (GT64 C4) (Protein ECTOPICALLY PARTING CELLS 1) (AtEPC1). (mybiosource.com)
  • During an acute-phase response, not only are concentrations of serum acute-phase glycoproteins altered, but their glycan structures are also dynamically modified by circulating glycosidases and glycosyltransferases (5, 6). (thefreedictionary.com)
  • This review summarizes recent results about biochemical characterization of bifunctional PBPs and enzymatic properties of the glycosyltransferase domain. (eurekaselect.com)
  • A glycosyltransferase activity assay provides a means of which to thoroughly interrogate GT targets for novel treatments. (bellbrooklabs.com)
  • Issues remain with glycosyltransferase activity assay methods. (bellbrooklabs.com)
  • A viable alternative is UDP detection through a universal assay for any UDP-sugar glycosyltransferase. (bellbrooklabs.com)
  • Therefore, a robust, in vitro high-throughput assay targeting glycosyltransferases that enables screening of chemical libraries or optimizing leads could enhance the ability to develop inhibitors with improved therapeutic properties. (bellbrooklabs.com)
  • BellBrook Labs pioneered the development of HTS-compatible assays for glycosyltransferases with the introduction of the Transcreener® UDP Glycosyltransferase Activity Assay in 2005. (bellbrooklabs.com)
  • To this end, Promega is developing assays to address the needs of the glycosylation community-starting with a bioluminescent assay to detect UDP, the key product of the glycosyltransferase reaction. (promegaconnections.com)
  • Following the glycosyltransferase reaction the assay converts UDP to ATP, which can then be used in a coupled reaction with Ultra-Glo™ Luciferase to produce light (see figure). (promegaconnections.com)
  • The human UDP glycosyltransferase (UGT) 3A family is one of three families involved in the metabolism of small lipophilic compounds. (aspetjournals.org)
  • The present review will provide an overview of the past two decades of glycosyltransferase inhibitors development, and will consider not only the design of bioactive molecules but also fundamental studies of the roles of such proteins. (rsc.org)
  • Glycosyltransferases in the Golgi apparatus are type-II membrane proteins which consist of an N-terminal cytoplasmic region, a trans membrane region, a stem region and a c-terminal catalytic region facing to lumen of Golgi. (nii.ac.jp)
  • 2) Cloning and identification of genes encoding proteins interacting with glycosyltransferases : The two-hybrid system is an in vivo yeast-based system that identifies interaction between two proteins by reconstituting active transcription factor dimmers. (nii.ac.jp)
  • en] The glycosyltransferase (GT) module of class A penicillin-binding proteins (PBPs) and monofunctional GTs (MGTs) belong to the GT51 family in the sequence-based classification of GTs. (ac.be)
  • Search for new antibiotic molecules is widely focused on bifunctional Penicillin-Binding Proteins (PBPs), with particular emphasis on their glycosyltransferase activity. (eurekaselect.com)
  • Anne Marie Di Guilmi, Andrea Dessen, Otto Dideberg and Thierry Vernet, " Bifunctional Penicillin-Binding Proteins: Focus on the Glycosyltransferase Domain and its Specific Inhibitor Moenomycin", Current Pharmaceutical Biotechnology (2002) 3: 63. (eurekaselect.com)
  • Phosphorylation of TET proteins is regulated via O-GlcNAcylation by the glycosyltransferase OGT. (diagenode.com)
  • The glycosyltransferase OGT, which we identified as a strong interactor of all three TET proteins, catalyzes the addition of an N-acetylglucosamine (GlcNAc) group to serine and threonine residues of TET proteins and thereby decreases both the number of phosphorylation sites as well as the site occupancy. (diagenode.com)
  • Many inhibitors of glycosyltransferases are known. (wikipedia.org)
  • Some of these are natural products, such as moenomycin, an inhibitor of peptidoglycan glycosyltransferases, the nikkomycins, inhibitors of chitin synthase, and the echinocandins, inhibitors of fungal β-1,3-glucan synthases. (wikipedia.org)
  • Some glycosyltransferase inhibitors are of use as drugs or antibiotics. (wikipedia.org)
  • Imidazolium-based synthetic inhibitors of glycosyltransferases have been designed for use as antimicrobial and antiseptic agents. (wikipedia.org)
  • Thus, assays that measure glycosyltransferase activities are desirable to study and understand their mode of regulation and to identify selective and potent inhibitors as potential therapeutics. (promegaconnections.com)
  • Contrasting the transcriptomes of young and old corms revealed differentially expressed UDP-sugar-dependent glycosyltransferases (UGTs) and BAHD-acyltransferases (BAHD-ATs). (plantcell.org)
  • Our results define a new family of bacterial glycosyltransferases. (prolekare.cz)
  • The aim of the project is to determine the function of a family of putative Golgi-glycosyltransferases in cell wall polysaccharide synthesis. (bio.net)
  • We show that LTA is required for efficient peptidoglycan cross-linking in S. aureus and inactivation of a peptidoglycan glycosyltransferase can partially rescue this defect, together revealing an intimate link between peptidoglycan and LTA synthesis. (asm.org)
  • Novel functions for glycosyltransferases Jhp0562 and GalT in Lewis antigen synthesis and variation in Helicobacter pylori. (thefreedictionary.com)
  • The molecular biology of moenomycins: towards novel antibiotics based on inhibition of bacterial peptidoglycan glycosyltransferases. (scienceexchange.com)
  • Barvkar VT, Pardeshi VC, Kale SM, Kadoo NY, Gupta VS (2012) Phylogenomic analysis of UDP glycosyltransferase 1 multigene family in Linum usitatissimum identified genes with varied expression patterns. (springer.com)
  • Molecular modeling of glycosyltransferases. (nih.gov)
  • Additionally, to facilitate further studies of the reactivity of this system and related glycosyltransferases, a ReaxFF reactive force field for classical molecular dynamics of biomolecules is being parameterised. (muni.cz)
  • N-glycosylation by Actinobacillus pleuropneumoniae HMW1C does not require metals, consistent with observations made on other GT41 family glycosyltransferases and a distinction from oligosaccharyltransferases. (wikipedia.org)
  • An evolving hierarchical family classification for glycosyltransferases. (nih.gov)
  • Glycosyltransferase family 47 (GT47) genes encode β-galactosyltransferases and β-glucuronyltransferases that synthesize pectin, xyloglucans and xylan, which are important components of the plant cell wall. (springer.com)
  • The glycosyltransferases involved in biotransformations of small molecules have been grouped into Family 1 of the 69 families that are classified on the basis of substrate recognition and sequence relatedness. (deepdyve.com)
  • The glycosyltransferases in family GT108 were originally identified by bioinformatics analysis using GH130 sequences as a query. (cazypedia.org)
  • The EXT genes encode glycosyltransferases , catalyzing heparan sulfate polymerization (2). (thefreedictionary.com)
  • We also showed that an S. aureus sgtB transposon mutant, with the monofunctional peptidoglycan glycosyltransferase SgtB inactivated, displayed a 4-fold increase in the MIC of oxacillin, suggesting that alterations in the peptidoglycan structure could help bacteria compensate for the lack of LTA. (asm.org)
  • the glycosyltransferases include the hexosyltransferases (EC 2.4.1), the pentosyltransferases (EC 2.4.2), and those transferring other glycosyl groups (EC 2.4.99). (enacademic.com)
  • Moenomycin, a well studied glycosyltransferase activity inhibitor has provided useful informations about lipid binding properties and about cellular role of bifunctional PBPs. (eurekaselect.com)
  • We carried out screening and obtained clones as the candidate molecules interacting with glycosyltransferases. (nii.ac.jp)
  • The transfer of a modified sugar residue that has a chemical handle by the mutant or wild type glycosyltransferases to a specific sugar residue on a glycoconjugate or to a specific site in a polypeptide engineered in the non-glycoprotein makes it possible to link bioactive molecules via the modified sugar residue. (grantome.com)
  • Although many glycosyltransferases catalyse chemically similar reactions, presumably through transition states with substantial oxocarbenium ion character, they display remarkable diversity in their donor, acceptor and product specificity and thereby generate a potentially infinite number of glycoconjugates, oligo- and polysaccharides. (nih.gov)
  • In contrast to the diversity of 3D structures observed for glycoside hydrolases, glycosyltransferase have a much smaller range of structures. (wikipedia.org)
  • Glycosyltransferases: Structures, Functions, and Mechanisms. (axonmedchem.com)
  • Here we present the crystal structures of apo-majastridin and the complex of majastridin with Mn2+ and UDP and show it has extensive structural similarity to glycosyltransferases (EC 2.4). (diva-portal.org)
  • Chokhawala, HA & Chen, X 2007, Enzymatic Approaches to O-Glycoside Introduction: Glycosyltransferases . (elsevier.com)
  • Deletion of the glycosyltransferase bgsA in Enterococcus faecalis leads to loss of diglucosyldiacylglycerol from the cell membrane and accumulation of its precursor monoglucosyldiacylglycerol, associated with impaired biofilm formation and reduced virulence in vivo. (biomedcentral.com)
  • In this study, Arabidopsis UGT75D1 was at the first time identified to be an indole-3-butyric acid (IBA) preferring glycosyltransferase. (deepdyve.com)
  • The N-glycosyltransferases are subdivided into two functional classes, the first (e.g several Yersinia, Escherichia coli and Burkholderia sp. (wikipedia.org)
  • Since glycosyltransferases have well defined substrate specificities, this method offers precise detection of target glycans. (rndsystems.com)
  • Glycosyltransferases catalyze glycosidic bond formation using sugar donors containing a nucleoside phosphate or a lipid phosphate leaving group. (axonmedchem.com)
  • For example, the non-patent document 1, shiso, derived from verbena UDP - glucose: anthocyanidin glycosyltransferase is 5 -, UDP - glucose as a sugar donor, sugar to a hydroxy group at position 5 of the anthocyanidins transfer to catalyze the reaction described. (go.jp)
  • The recent discovery of the reversibility of many reactions catalyzed by inverting glycosyltransferases served as a paradigm shift in the field and raises questions regarding the designation of sugar nucleotides as 'activated' donors. (wikipedia.org)
  • N-glycosyltransferases from Actinobacillus pleuropneumoniae and Haemophilus influenzae use an asparagine-amino acid-serine or threonine sequences as target sequences, the same sequence used by oligosaccharyltransferases. (wikipedia.org)
  • A homology search with the deduced amino acid sequence of the open reading frame disrupted by Tn 5 revealed limited homology with various glycosyltransferases. (asm.org)