AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsInformation Science
GlycosyltransferasesGalactosyltransferasesN-AcetylglucosaminyltransferasesSialyltransferasesN-AcetylgalactosaminyltransferasesGlycosylationGlucosyltransferasesCarbohydrate SequenceFucosyltransferasesPolysaccharidesUridine Diphosphate GlucoseMannosyltransferasesUridine Diphosphate GalactoseOligosaccharidesUridine DiphosphateN-Acetyllactosamine SynthaseHexosyltransferasesMolecular Sequence DataGolgi ApparatusUridine Diphosphate N-AcetylgalactosamineSubstrate SpecificityDolicholCarbohydrate ConformationABO Blood-Group SystemAmino Acid SequenceUridine Diphosphate Glucuronic AcidUridine Diphosphate SugarsGlycolipidsGlycoconjugatesGlobosidesUridine Diphosphate XyloseUridine Diphosphate N-AcetylglucosamineGlycosphingolipidsPeptidoglycan GlycosyltransferaseMacluraGalactoseBambermycinsGlycosidesSequence Homology, Amino AcidExostoses, Multiple Hereditarybeta-N-Acetylglucosaminylglycopeptide beta-1,4-GalactosyltransferaseTransferasesGlycopeptidesGuanosine Diphosphate MannosePasteurella multocidaPentosyltransferasesForssman AntigenDisaccharidesDolichol Monophosphate MannoseRauwolfiaGlycoproteinsArbutinGangliosidesMonosaccharidesSpiramycinCytidine Monophosphate N-Acetylneuraminic AcidDystroglycansCloning, MolecularGuanosine Diphosphate FucoseGanglioside GalactosyltransferaseCell WallAntigens, CD15CatalysisPicrorhizaMultigene FamilyAmino SugarsLactosylceramidesGalactansChondroitinLewis Blood-Group SystemMolecular StructureMutationAcetylglucosamineGlucuronosyltransferaseLectinsAquifoliaceaeFucoseConserved SequenceCatalytic DomainStreptomycesLactose SynthaseCHO CellsRhamnoseCricetinaeSequence AlignmentBase SequenceMucinsRecombinant ProteinsBlood Group AntigensPhylogenyKineticsBacterial ProteinsO AntigensEndoplasmic ReticulumGlycoside HydrolasesEnzyme AssaysGenetic Complementation TestXyloseSulfotransferasesBrefeldin A
Glycosyltransferases
Enzymes that catalyze the transfer of glycosyl groups to an acceptor. Most often another carbohydrate molecule acts as an acceptor, but inorganic phosphate can also act as an acceptor, such as in the case of PHOSPHORYLASES. Some of the enzymes in this group also catalyze hydrolysis, which can be regarded as transfer of a glycosyl group from the donor to water. Subclasses include the HEXOSYLTRANSFERASES; PENTOSYLTRANSFERASES; SIALYLTRANSFERASES; and those transferring other glycosyl groups. EC 2.4.
Galactosyltransferases
Enzymes that catalyze the transfer of galactose from a nucleoside diphosphate galactose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
N-Acetylglucosaminyltransferases
Enzymes that catalyze the transfer of N-acetylglucosamine from a nucleoside diphosphate N-acetylglucosamine to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
Sialyltransferases
A group of enzymes with the general formula CMP-N-acetylneuraminate:acceptor N-acetylneuraminyl transferase. They catalyze the transfer of N-acetylneuraminic acid from CMP-N-acetylneuraminic acid to an acceptor, which is usually the terminal sugar residue of an oligosaccharide, a glycoprotein, or a glycolipid. EC 2.4.99.-.
N-Acetylgalactosaminyltransferases
Enzymes that catalyze the transfer of N-acetylgalactosamine from a nucleoside diphosphate N-acetylgalactosamine to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
Glycosylation
The chemical or biochemical addition of carbohydrate or glycosyl groups to other chemicals, especially peptides or proteins. Glycosyl transferases are used in this biochemical reaction.
Glucosyltransferases
Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
Carbohydrate Sequence
The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.
Fucosyltransferases
Enzymes catalyzing the transfer of fucose from a nucleoside diphosphate fucose to an acceptor molecule which is frequently another carbohydrate, a glycoprotein, or a glycolipid molecule. Elevated activity of some fucosyltransferases in human serum may serve as an indicator of malignancy. The class includes EC 2.4.1.65; EC 2.4.1.68; EC 2.4.1.69; EC 2.4.1.89.
Polysaccharides
Uridine Diphosphate Glucose
A key intermediate in carbohydrate metabolism. Serves as a precursor of glycogen, can be metabolized into UDPgalactose and UDPglucuronic acid which can then be incorporated into polysaccharides as galactose and glucuronic acid. Also serves as a precursor of sucrose lipopolysaccharides, and glycosphingolipids.
Mannosyltransferases
Enzymes that catalyze the transfer of mannose from a nucleoside diphosphate mannose to an acceptor molecule which is frequently another carbohydrate. The group includes EC 2.4.1.32, EC 2.4.1.48, EC 2.4.1.54, and EC 2.4.1.57.
Uridine Diphosphate Galactose
A nucleoside diphosphate sugar which can be epimerized into UDPglucose for entry into the mainstream of carbohydrate metabolism. Serves as a source of galactose in the synthesis of lipopolysaccharides, cerebrosides, and lactose.
Oligosaccharides
Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.
Uridine Diphosphate
A uracil nucleotide containing a pyrophosphate group esterified to C5 of the sugar moiety.
N-Acetyllactosamine Synthase
The A protein of the lactose synthase complex. In the presence of the B protein (LACTALBUMIN) specificity is changed from N-acetylglucosamine to glucose. EC 2.4.1.90.
Hexosyltransferases
Enzymes that catalyze the transfer of hexose groups. EC 2.4.1.-.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Golgi Apparatus
A stack of flattened vesicles that functions in posttranslational processing and sorting of proteins, receiving them from the rough ENDOPLASMIC RETICULUM and directing them to secretory vesicles, LYSOSOMES, or the CELL MEMBRANE. The movement of proteins takes place by transfer vesicles that bud off from the rough endoplasmic reticulum or Golgi apparatus and fuse with the Golgi, lysosomes or cell membrane. (From Glick, Glossary of Biochemistry and Molecular Biology, 1990)
Uridine Diphosphate N-Acetylgalactosamine
A nucleoside diphosphate sugar which serves as a source of N-acetylgalactosamine for glycoproteins, sulfatides and cerebrosides.
Substrate Specificity
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Dolichol
Eicosamethyl octacontanonadecasen-1-o1. Polyprenol found in animal tissues that contains about 20 isoprene residues, the one carrying the alcohol group being saturated.
Carbohydrate Conformation
The characteristic 3-dimensional shape of a carbohydrate.
ABO Blood-Group System
The major human blood type system which depends on the presence or absence of two antigens A and B. Type O occurs when neither A nor B is present and AB when both are present. A and B are genetic factors that determine the presence of enzymes for the synthesis of certain glycoproteins mainly in the red cell membrane.
Amino Acid Sequence
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Uridine Diphosphate Glucuronic Acid
A nucleoside diphosphate sugar which serves as a source of glucuronic acid for polysaccharide biosynthesis. It may also be epimerized to UDP iduronic acid, which donates iduronic acid to polysaccharides. In animals, UDP glucuronic acid is used for formation of many glucosiduronides with various aglycones.
Uridine Diphosphate Sugars
Glycolipids
Any compound containing one or more monosaccharide residues bound by a glycosidic linkage to a hydrophobic moiety such as an acylglycerol (see GLYCERIDES), a sphingoid, a ceramide (CERAMIDES) (N-acylsphingoid) or a prenyl phosphate. (From IUPAC's webpage)
Glycoconjugates
Carbohydrates covalently linked to a nonsugar moiety (lipids or proteins). The major glycoconjugates are glycoproteins, glycopeptides, peptidoglycans, glycolipids, and lipopolysaccharides. (From Biochemical Nomenclature and Related Documents, 2d ed; From Principles of Biochemistry, 2d ed)
Globosides
Glycosphingolipids containing N-acetylglucosamine (paragloboside) or N-acetylgalactosamine (globoside). Globoside is the P antigen on erythrocytes and paragloboside is an intermediate in the biosynthesis of erythrocyte blood group ABH and P 1 glycosphingolipid antigens. The accumulation of globoside in tissue, due to a defect in hexosaminidases A and B, is the cause of Sandhoff disease.
Uridine Diphosphate Xylose
The decarboxylation product of UDPglucuronic acid, which is used for formation of the xylosides of seryl hydroxyl groups in mucoprotein synthesis. Also forms plant xylans.
Uridine Diphosphate N-Acetylglucosamine
Serves as the biological precursor of insect chitin, of muramic acid in bacterial cell walls, and of sialic acids in mammalian glycoproteins.
Glycosphingolipids
Lipids containing at least one monosaccharide residue and either a sphingoid or a ceramide (CERAMIDES). They are subdivided into NEUTRAL GLYCOSPHINGOLIPIDS comprising monoglycosyl- and oligoglycosylsphingoids and monoglycosyl- and oligoglycosylceramides; and ACIDIC GLYCOSPHINGOLIPIDS which comprises sialosylglycosylsphingolipids (GANGLIOSIDES); SULFOGLYCOSPHINGOLIPIDS (formerly known as sulfatides), glycuronoglycosphingolipids, and phospho- and phosphonoglycosphingolipids. (From IUPAC's webpage)
Peptidoglycan Glycosyltransferase
A hexosyltransferase involved in the transfer of disaccharide molecules to the peptidoglycan structure of the CELL WALL SKELETON. It plays an important role in the genesis of the bacterial CELL WALL.
Maclura
A plant genus of the family MORACEAE. Members contain maclurin, antifungal chalcones, and other compounds.
Galactose
An aldohexose that occurs naturally in the D-form in lactose, cerebrosides, gangliosides, and mucoproteins. Deficiency of galactosyl-1-phosphate uridyltransferase (GALACTOSE-1-PHOSPHATE URIDYL-TRANSFERASE DEFICIENCY DISEASE) causes an error in galactose metabolism called GALACTOSEMIA, resulting in elevations of galactose in the blood.
Bambermycins
Antibiotic complex obtained from Streptomyces bambergiensis containing mainly Moenomycins A and C. They are used as feed additives and growth promoters for poultry, swine, and cattle.
Glycosides
Any compound that contains a constituent sugar, in which the hydroxyl group attached to the first carbon is substituted by an alcoholic, phenolic, or other group. They are named specifically for the sugar contained, such as glucoside (glucose), pentoside (pentose), fructoside (fructose), etc. Upon hydrolysis, a sugar and nonsugar component (aglycone) are formed. (From Dorland, 28th ed; From Miall's Dictionary of Chemistry, 5th ed)
Sequence Homology, Amino Acid
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Exostoses, Multiple Hereditary
Hereditary disorder transmitted by an autosomal dominant gene and characterized by multiple exostoses (multiple osteochondromas) near the ends of long bones. The genetic abnormality results in a defect in the osteoclastic activity at the metaphyseal ends of the bone during the remodeling process in childhood or early adolescence. The metaphyses develop benign, bony outgrowths often capped by cartilage. A small number undergo neoplastic transformation.
beta-N-Acetylglucosaminylglycopeptide beta-1,4-Galactosyltransferase
An enzyme that catalyzes the transfer of galactose from UDP-galactose to a specific glycoprotein receptor, 2-acetamido-2-deoxy-D-glucosyl-glycopeptide, during glycopeptide synthesis. EC 2.4.1.38.
Transferases
Transferases are enzymes transferring a group, for example, the methyl group or a glycosyl group, from one compound (generally regarded as donor) to another compound (generally regarded as acceptor). The classification is based on the scheme "donor:acceptor group transferase". (Enzyme Nomenclature, 1992) EC 2.
Glycopeptides
Proteins which contain carbohydrate groups attached covalently to the polypeptide chain. The protein moiety is the predominant group with the carbohydrate making up only a small percentage of the total weight.
Guanosine Diphosphate Mannose
A nucleoside diphosphate sugar which can be converted to the deoxy sugar GDPfucose, which provides fucose for lipopolysaccharides of bacterial cell walls. Also acts as mannose donor for glycolipid synthesis.
Pasteurella multocida
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria normally found in the flora of the mouth and respiratory tract of animals and birds. It causes shipping fever (see PASTEURELLOSIS, PNEUMONIC); HEMORRHAGIC BACTEREMIA; and intestinal disease in animals. In humans, disease usually arises from a wound infection following a bite or scratch from domesticated animals.
Pentosyltransferases
Enzymes of the transferase class that catalyze the transfer of a pentose group from one compound to another.
Forssman Antigen
A glycolipid, cross-species antigen that induces production of antisheep hemolysin. It is present on the tissue cells of many species but absent in humans. It is found in many infectious agents.
Disaccharides
Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.
Dolichol Monophosphate Mannose
A lipophilic glycosyl carrier of the monosaccharide mannose in the biosynthesis of oligosaccharide phospholipids and glycoproteins.
Rauwolfia
A plant genus of the APOCYNACEAE or dogbane family. Alkaloids from plants in this genus have been used as tranquilizers and antihypertensive agents. RESERPINE is derived from R. serpentina.
Glycoproteins
Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.
Arbutin
Gangliosides
A subclass of ACIDIC GLYCOSPHINGOLIPIDS. They contain one or more sialic acid (N-ACETYLNEURAMINIC ACID) residues. Using the Svennerholm system of abbrevations, gangliosides are designated G for ganglioside, plus subscript M, D, or T for mono-, di-, or trisialo, respectively, the subscript letter being followed by a subscript arabic numeral to indicated sequence of migration in thin-layer chromatograms. (From Oxford Dictionary of Biochemistry and Molecular Biology, 1997)
Monosaccharides
Simple sugars, carbohydrates which cannot be decomposed by hydrolysis. They are colorless crystalline substances with a sweet taste and have the same general formula CnH2nOn. (From Dorland, 28th ed)
Spiramycin
A macrolide antibiotic produced by Streptomyces ambofaciens. The drug is effective against gram-positive aerobic pathogens, N. gonorrhoeae, and staphylococci. It is used to treat infections caused by bacteria and Toxoplasma gondii.
Cytidine Monophosphate N-Acetylneuraminic Acid
A nucleoside monophosphate sugar which donates N-acetylneuraminic acid to the terminal sugar of a ganglioside or glycoprotein.
Dystroglycans
Dystrophin-associated proteins that play role in the formation of a transmembrane link between laminin-2 and DYSTROPHIN. Both the alpha and the beta subtypes of dystroglycan originate via POST-TRANSLATIONAL PROTEIN PROCESSING of a single precursor protein.
Cloning, Molecular
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Guanosine Diphosphate Fucose
A nucleoside diphosphate sugar formed from GDPmannose, which provides fucose for lipopolysaccharides of bacterial cell walls, and for blood group substances and other glycoproteins.
Ganglioside Galactosyltransferase
Catalyzes the final step in the galactocerebroside biosynthesis pathway.
Cell Wall
The outermost layer of a cell in most PLANTS; BACTERIA; FUNGI; and ALGAE. The cell wall is usually a rigid structure that lies external to the CELL MEMBRANE, and provides a protective barrier against physical or chemical agents.
Antigens, CD15
A trisaccharide antigen expressed on glycolipids and many cell-surface glycoproteins. In the blood the antigen is found on the surface of NEUTROPHILS; EOSINOPHILS; and MONOCYTES. In addition, CD15 antigen is a stage-specific embryonic antigen.
Catalysis
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
Picrorhiza
A plant genus of the family Plantaginaceae. Members contain scrosides (CINNAMATES) and phenylethanoid glycoside. P. kurrooa is the source of picroliv (a purified iridoid glycoside fraction from the roots having hepatoprotective, anti-inflammatory and antioxidant properties).
Multigene Family
A set of genes descended by duplication and variation from some ancestral gene. Such genes may be clustered together on the same chromosome or dispersed on different chromosomes. Examples of multigene families include those that encode the hemoglobins, immunoglobulins, histocompatibility antigens, actins, tubulins, keratins, collagens, heat shock proteins, salivary glue proteins, chorion proteins, cuticle proteins, yolk proteins, and phaseolins, as well as histones, ribosomal RNA, and transfer RNA genes. The latter three are examples of reiterated genes, where hundreds of identical genes are present in a tandem array. (King & Stanfield, A Dictionary of Genetics, 4th ed)
Amino Sugars
SUGARS containing an amino group. GLYCOSYLATION of other compounds with these amino sugars results in AMINOGLYCOSIDES.
Lactosylceramides
Glycosphingolipids which contain as their polar head group a lactose moiety bound in glycosidic linkage to the hydroxyl group of ceramide. Their accumulation in tissue, due to a defect in lactosylceramide beta-galactosidase, is the cause of lactosylceramidosis.
Galactans
Polysaccharides composed of repeating galactose units. They can consist of branched or unbranched chains in any linkages.
Chondroitin
A mucopolysaccharide constituent of chondrin. (Grant & Hackh's Chemical Dictionary, 5th ed)
Lewis Blood-Group System
A group of dominantly and independently inherited antigens associated with the ABO blood factors. They are glycolipids present in plasma and secretions that may adhere to the erythrocytes. The phenotype Le(b) is the result of the interaction of the Le gene Le(a) with the genes for the ABO blood groups.
Molecular Structure
The location of the atoms, groups or ions relative to one another in a molecule, as well as the number, type and location of covalent bonds.
Mutation
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Acetylglucosamine
The N-acetyl derivative of glucosamine.
Glucuronosyltransferase
A family of enzymes accepting a wide range of substrates, including phenols, alcohols, amines, and fatty acids. They function as drug-metabolizing enzymes that catalyze the conjugation of UDPglucuronic acid to a variety of endogenous and exogenous compounds. EC 2.4.1.17.
Lectins
Proteins that share the common characteristic of binding to carbohydrates. Some ANTIBODIES and carbohydrate-metabolizing proteins (ENZYMES) also bind to carbohydrates, however they are not considered lectins. PLANT LECTINS are carbohydrate-binding proteins that have been primarily identified by their hemagglutinating activity (HEMAGGLUTININS). However, a variety of lectins occur in animal species where they serve diverse array of functions through specific carbohydrate recognition.
Aquifoliaceae
The holly plant family of the order Celastrales, subclass Rosidae, class Magnoliopsida.
Fucose
Conserved Sequence
A sequence of amino acids in a polypeptide or of nucleotides in DNA or RNA that is similar across multiple species. A known set of conserved sequences is represented by a CONSENSUS SEQUENCE. AMINO ACID MOTIFS are often composed of conserved sequences.
Catalytic Domain
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
Streptomyces
A genus of bacteria that form a nonfragmented aerial mycelium. Many species have been identified with some being pathogenic. This genus is responsible for producing a majority of the ANTI-BACTERIAL AGENTS of practical value.
Lactose Synthase
An enzyme complex that catalyzes the transfer of GALACTOSE from UDP GALACTOSE to GLUCOSE, forming LACTOSE. The enzyme complex is composed of a B subunit, ALPHA-LACTALBUMIN, which changes the substrate specificity of the A subunit, N-ACETYLLACTOSAMINE SYNTHASE, from N-ACETYLGLUCOSAMINE to glucose making lactose synthesis the preferred reaction.
CHO Cells
CELL LINE derived from the ovary of the Chinese hamster, Cricetulus griseus (CRICETULUS). The species is a favorite for cytogenetic studies because of its small chromosome number. The cell line has provided model systems for the study of genetic alterations in cultured mammalian cells.
Rhamnose
A methylpentose whose L- isomer is found naturally in many plant glycosides and some gram-negative bacterial lipopolysaccharides.
Cricetinae
A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.
Sequence Alignment
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
Base Sequence
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Mucins
High molecular weight mucoproteins that protect the surface of EPITHELIAL CELLS by providing a barrier to particulate matter and microorganisms. Membrane-anchored mucins may have additional roles concerned with protein interactions at the cell surface.
Recombinant Proteins
Proteins prepared by recombinant DNA technology.
Blood Group Antigens
Sets of cell surface antigens located on BLOOD CELLS. They are usually membrane GLYCOPROTEINS or GLYCOLIPIDS that are antigenically distinguished by their carbohydrate moieties.
Phylogeny
The relationships of groups of organisms as reflected by their genetic makeup.
Kinetics
The rate dynamics in chemical or physical systems.
Bacterial Proteins
Proteins found in any species of bacterium.
O Antigens
The lipopolysaccharide-protein somatic antigens, usually from gram-negative bacteria, important in the serological classification of enteric bacilli. The O-specific chains determine the specificity of the O antigens of a given serotype. O antigens are the immunodominant part of the lipopolysaccharide molecule in the intact bacterial cell. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
Endoplasmic Reticulum
A system of cisternae in the CYTOPLASM of many cells. In places the endoplasmic reticulum is continuous with the plasma membrane (CELL MEMBRANE) or outer membrane of the nuclear envelope. If the outer surfaces of the endoplasmic reticulum membranes are coated with ribosomes, the endoplasmic reticulum is said to be rough-surfaced (ENDOPLASMIC RETICULUM, ROUGH); otherwise it is said to be smooth-surfaced (ENDOPLASMIC RETICULUM, SMOOTH). (King & Stansfield, A Dictionary of Genetics, 4th ed)
Glycoside Hydrolases
Enzyme Assays
Methods used to measure the relative activity of a specific enzyme or its concentration in solution. Typically an enzyme substrate is added to a buffer solution containing enzyme and the rate of conversion of substrate to product is measured under controlled conditions. Many classical enzymatic assay methods involve the use of synthetic colorimetric substrates and measuring the reaction rates using a spectrophotometer.
Genetic Complementation Test
A test used to determine whether or not complementation (compensation in the form of dominance) will occur in a cell with a given mutant phenotype when another mutant genome, encoding the same mutant phenotype, is introduced into that cell.
Xylose
Sulfotransferases
Enzymes which transfer sulfate groups to various acceptor molecules. They are involved in posttranslational sulfation of proteins and sulfate conjugation of exogenous chemicals and bile acids. EC 2.8.2.
Brefeldin A
A fungal metabolite which is a macrocyclic lactone exhibiting a wide range of antibiotic activity.
Carbohydrates
The largest class of organic compounds, including STARCH; GLYCOGEN; CELLULOSE; POLYSACCHARIDES; and simple MONOSACCHARIDES. Carbohydrates are composed of carbon, hydrogen, and oxygen in a ratio of Cn(H2O)n.
Protein Engineering
Procedures by which protein structure and function are changed or created in vitro by altering existing or synthesizing new structural genes that direct the synthesis of proteins with sought-after properties. Such procedures may include the design of MOLECULAR MODELS of proteins using COMPUTER GRAPHICS or other molecular modeling techniques; site-specific mutagenesis (MUTAGENESIS, SITE-SPECIFIC) of existing genes; and DIRECTED MOLECULAR EVOLUTION techniques to create new genes.
Escherichia coli
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Glycomics
The systematic study of the structure and function of the complete set of glycans (the glycome) produced in a single organism and identification of all the genes that encode glycoproteins.
Xylans
Polysaccharides consisting of xylose units.
Dolichol Phosphates
Phosphoric acid esters of dolichol.
Selectins
Transmembrane proteins consisting of a lectin-like domain, an epidermal growth factor-like domain, and a variable number of domains that are homologous to complement regulatory proteins. They are important cell adhesion molecules which help LEUKOCYTES attach to VASCULAR ENDOTHELIUM.
Antigens, Tumor-Associated, Carbohydrate
Carbohydrate antigens expressed by malignant tissue. They are useful as tumor markers and are measured in the serum by means of a radioimmunoassay employing monoclonal antibodies.
Polysaccharides, Bacterial
Polysaccharides found in bacteria and in capsules thereof.
Protein Structure, Tertiary
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Chromatography, Thin Layer
Chromatography on thin layers of adsorbents rather than in columns. The adsorbent can be alumina, silica gel, silicates, charcoals, or cellulose. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Carbohydrate Metabolism
Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.
Evolution, Molecular
The process of cumulative change at the level of DNA; RNA; and PROTEINS, over successive generations.
Crystallography, X-Ray
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Muscular Dystrophies
A heterogeneous group of inherited MYOPATHIES, characterized by wasting and weakness of the SKELETAL MUSCLE. They are categorized by the sites of MUSCLE WEAKNESS; AGE OF ONSET; and INHERITANCE PATTERNS.
Trisaccharides
Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.
Acetylgalactosamine
The N-acetyl derivative of galactosamine.
Deoxy Sugars
Arabidopsis
A plant genus of the family BRASSICACEAE that contains ARABIDOPSIS PROTEINS and MADS DOMAIN PROTEINS. The species A. thaliana is used for experiments in classical plant genetics as well as molecular genetic studies in plant physiology, biochemistry, and development.
Polyisoprenyl Phosphate Oligosaccharides
These compounds function as activated glycosyl carriers in the biosynthesis of glycoproteins and glycophospholipids. Include the pyrophosphates.
Models, Molecular
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
Mannose
A hexose or fermentable monosaccharide and isomer of glucose from manna, the ash Fraxinus ornus and related plants. (From Grant & Hackh's Chemical Dictionary, 5th ed & Random House Unabridged Dictionary, 2d ed)
Gene Expression Regulation, Enzymologic
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in enzyme synthesis.
Magnetic Resonance Spectroscopy
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
Amino Acid Motifs
Commonly observed structural components of proteins formed by simple combinations of adjacent secondary structures. A commonly observed structure may be composed of a CONSERVED SEQUENCE which can be represented by a CONSENSUS SEQUENCE.
Biosynthetic Pathways
Sets of enzymatic reactions occurring in organisms and that form biochemicals by making new covalent bonds.
Chromatography, High Pressure Liquid
Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.
Ficoll
A sucrose polymer of high molecular weight.
N-Acetylneuraminic Acid
An N-acyl derivative of neuraminic acid. N-acetylneuraminic acid occurs in many polysaccharides, glycoproteins, and glycolipids in animals and bacteria. (From Dorland, 28th ed, p1518)
Asparagine
A non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue. It is biosynthesized from ASPARTIC ACID and AMMONIA by asparagine synthetase. (From Concise Encyclopedia Biochemistry and Molecular Biology, 3rd ed)
Binding Sites
The parts of a macromolecule that directly participate in its specific combination with another molecule.
Spectrometry, Mass, Matrix-Assisted Laser Desorption-Ionization
A mass spectrometric technique that is used for the analysis of large biomolecules. Analyte molecules are embedded in an excess matrix of small organic molecules that show a high resonant absorption at the laser wavelength used. The matrix absorbs the laser energy, thus inducing a soft disintegration of the sample-matrix mixture into free (gas phase) matrix and analyte molecules and molecular ions. In general, only molecular ions of the analyte molecules are produced, and almost no fragmentation occurs. This makes the method well suited for molecular weight determinations and mixture analysis.
Cricetulus
A genus of the family Muridae consisting of eleven species. C. migratorius, the grey or Armenian hamster, and C. griseus, the Chinese hamster, are the two species used in biomedical research.
COP-Coated Vesicles
TRANSPORT VESICLES formed when cell-membrane coated pits (COATED PITS, CELL-MEMBRANE) invaginate and pinch off. The outer surface of these vesicles is covered with a lattice-like network of COP (coat protein complex) proteins, either COPI or COPII. COPI coated vesicles transport backwards from the cisternae of the GOLGI APPARATUS to the rough endoplasmic reticulum (ENDOPLASMIC RETICULUM, ROUGH), while COPII coated vesicles transport forward from the rough endoplasmic reticulum to the Golgi apparatus.
DNA, Complementary
Single-stranded complementary DNA synthesized from an RNA template by the action of RNA-dependent DNA polymerase. cDNA (i.e., complementary DNA, not circular DNA, not C-DNA) is used in a variety of molecular cloning experiments as well as serving as a specific hybridization probe.
Polyisoprenyl Phosphates
Phosphoric or pyrophosphoric acid esters of polyisoprenoids.
Anthraquinones
Compounds based on ANTHRACENES which contain two KETONES in any position. Substitutions can be in any position except on the ketone groups.
Recombinant Fusion Proteins
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
Saponins
A type of glycoside widely distributed in plants. Each consists of a sapogenin as the aglycone moiety, and a sugar. The sapogenin may be a steroid or a triterpene and the sugar may be glucose, galactose, a pentose, or a methylpentose.
Genes, Bacterial
The functional hereditary units of BACTERIA.
Glycosaminoglycans
Heteropolysaccharides which contain an N-acetylated hexosamine in a characteristic repeating disaccharide unit. The repeating structure of each disaccharide involves alternate 1,4- and 1,3-linkages consisting of either N-acetylglucosamine or N-acetylgalactosamine.
Enzymes, Immobilized
Enzymes which are immobilized on or in a variety of water-soluble or water-insoluble matrices with little or no loss of their catalytic activity. Since they can be reused continuously, immobilized enzymes have found wide application in the industrial, medical and research fields.
Membrane Proteins
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
DNA Primers
Short sequences (generally about 10 base pairs) of DNA that are complementary to sequences of messenger RNA and allow reverse transcriptases to start copying the adjacent sequences of mRNA. Primers are used extensively in genetic and molecular biology techniques.

Demonstration of molecular interactions between the murein polymerase PBP1B, the lytic transglycosylase MltA, and the scaffolding protein MipA of Escherichia coli. (1/1334)

Enlargement of the stress-bearing murein sacculus of bacteria depends on the coordinated interaction of murein synthases and hydrolases. To understand the mechanism of interaction of these two classes of proteins affinity chromatography and surface plasmon resonance (SPR) studies were performed. The membrane-bound lytic transglycosylase MltA when covalently linked to CNBr-activated Sepharose specifically retained the penicillin-binding proteins (PBPs) 1B, 1C, 2, and 3 from a crude Triton X-100 membrane extract of Escherichia coli. In the presence of periplasmic proteins also PBP1A was specifically bound. At least five different non-PBPs showed specificity for MltA-Sepharose. The amino-terminal amino acid sequence of one of these proteins could be obtained, and the corresponding gene was mapped at 40 min on the E. coli genome. This MltA-interacting protein, named MipA, in addition binds to PBP1B, a bifunctional murein transglycosylase/transpeptidase. SPR studies with PBP1B immobilized to ampicillin-coated sensor chips showed an oligomerization of PBP1B that may indicate a dimerization. Simultaneous application of MipA and MltA onto a PBP1B sensor chip surface resulted in the formation of a trimeric complex. The dissociation constant was determined to be about 10(-6) M. The formation of a complex between a murein polymerase (PBP1B) and a murein hydrolase (MltA) in the presence of MipA represents a first step in a reconstitution of the hypothetical murein-synthesizing holoenzyme, postulated to be responsible for controlled growth of the stress-bearing sacculus of E. coli.  (+info)

Dynamic expression of lunatic fringe suggests a link between notch signaling and an autonomous cellular oscillator driving somite segmentation. (2/1334)

The metameric organization of the vertebrate trunk is a characteristic feature of all members of this phylum. The origin of this metamerism can be traced to the division of paraxial mesoderm into individual units, termed somites, during embryonic development. Despite the identification of somites as the first overt sign of segmentation in vertebrates well over 100 years ago, the mechanism(s) underlying somite formation remain poorly understood. Recently, however, several genes have been identified which play prominent roles in orchestrating segmentation, including the novel secreted factor lunatic fringe. To gain further insight into the mechanism by which lunatic fringe controls somite development, we have conducted a thorough analysis of lunatic fringe expression in the unsegmented paraxial mesoderm of chick embryos. Here we report that lunatic fringe is expressed predominantly in somite -II, where somite I corresponds to the most recently formed somite and somite -I corresponds to the group of cells which will form the next somite. In addition, we show that lunatic fringe is expressed in a highly dynamic manner in the chick segmental plate prior to somite formation and that lunatic fringe expression cycles autonomously with a periodicity of somite formation. Moreover, the murine ortholog of lunatic fringe undergoes a similar cycling expression pattern in the presomitic mesoderm of somite stage mouse embryos. The demonstration of a dynamic periodic expression pattern suggests that lunatic fringe may function to integrate notch signaling to a cellular oscillator controlling somite segmentation.  (+info)

Hyaluronan synthase expression in bovine eyes. (3/1334)

PURPOSE: Hyaluronan (HA), a high-molecular-weight linear glycosaminoglycan, is a component of the extracellular matrix (ECM). It is expressed in eyes and plays important roles in many biologic processes, including cell migration, proliferation, and differentiation. Hyaluronan is produced by HA synthase (HAS), which has three isoforms: HAS1, HAS2, and HAS3. In this study, the HAS expression in the anterior segment of bovine eyes was investigated to determine the significance of HA in eyes. METHODS: To obtain bovine HAS probes, degenerate oligonucleotide primers, based on well-conserved amino acid sequences including the catalytic region of each HAS isoform, were used for reverse transcription-polymerase chain reaction to amplify mRNA from bovine corneal endothelial cells (BCECs). Hyaluronan synthase-1 expression in the anterior segment of bovine eyes at the protein level was investigated by immunohistochemistry. RESULTS: All three HAS isoforms were expressed in BCECs at the mRNA level. Amplified cDNA fragments of HAS1, HAS2, and HAS3 from BCECs can be aligned to human counterparts, showing similarities of 100%, 97.3%, and 100%, respectively, at the amino acid level. Hyaluronan synthase 1 was expressed at the protein level in corneal epithelium, keratocyte, corneal endothelium, conjunctival epithelium, ciliary epithelium, capillary endothelium, and trabecular meshwork. CONCLUSIONS: Hyaluronan synthase isoforms were expressed in the ocular anterior segment and are speculated to be involved in HA production in situ.  (+info)

O-glycosylation potential of lepidopteran insect cell lines. (4/1334)

The enzyme activities involved in O-glycosylation have been studied in three insect cell lines, Spodoptera frugiperda (Sf-9), Mamestra brassicae (Mb) and Trichoplusia ni (Tn) cultured in two different serum-free media. The structural features of O-glycoproteins in these insect cells were investigated using a panel of lectins and the glycosyltransferase activities involved in O-glycan biosynthesis of insect cells were measured (i.e., UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, UDP-Gal:core-1 beta1, 3-galactosyltransferase, CMP-NeuAc:Galbeta1-3GalNAc alpha2, 3-sialyltransferase, and UDP-Gal:Galbeta1-3GalNAc alpha1, 4-galactosyltransferase activities). First, we show that O-glycosylation potential depends on cell type. All three lepidopteran cell lines express GalNAcalpha-O-Ser/Thr antigen, which is recognized by soy bean agglutinin and reflects high UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase activity. Capillary electrophoresis and mass spectrometry studies revealed the presence of at least two different UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferases in these insect cells. Only some O-linked GalNAc residues are further processed by the addition of beta1,3-linked Gal residues to form T-antigen, as shown by the binding of peanut agglutinin. This reflects relative low levels of UDP-Gal:core-1 beta1,3-galactosyltransferase in insect cells, as compared to those observed in mammalian control cells. In addition, we detected strong binding of Bandeiraea simplicifolia lectin-I isolectin B4 to Mamestra brassicae endogenous glycoproteins, which suggests a high activity of a UDP-Gal:Galbeta1-3GalNAc alpha1, 4-galactosyltransferase. This explains the absence of PNA binding to Mamestra brassicae glycoproteins. Furthermore, our results substantiated that there is no sialyltransferase activity and, therefore, no terminal sialic acid production by these cell lines. Finally, we found that the culture medium influences the O-glycosylation potential of each cell line.  (+info)

Genetic localization and molecular characterization of two key genes (mitAB) required for biosynthesis of the antitumor antibiotic mitomycin C. (5/1334)

Mitomycin C (MC) is an antitumor antibiotic derived biosynthetically from 3-amino-5-hydroxybenzoic acid (AHBA), D-glucosamine, and carbamoyl phosphate. A gene (mitA) involved in synthesis of AHBA has been identified and found to be linked to the MC resistance locus, mrd, in Streptomyces lavendulae. Nucleotide sequence analysis showed that mitA encodes a 388-amino-acid protein that has 71% identity (80% similarity) with the rifamycin AHBA synthase from Amycolatopsis mediterranei, as well as with two additional AHBA synthases from related ansamycin antibiotic-producing microorganisms. Gene disruption and site-directed mutagenesis of the S. lavendulae chromosomal copy of mitA completely blocked the production of MC. The function of mitA was confirmed by complementation of an S. lavendulae strain containing a K191A mutation in MitA with AHBA. A second gene (mitB) encoding a 272-amino-acid protein (related to a group of glycosyltransferases) was identified immediately downstream of mitA that upon disruption resulted in abrogation of MC synthesis. This work has localized a cluster of key genes that mediate assembly of the unique mitosane class of natural products.  (+info)

Preferential expression of biotransformation enzymes in the olfactory organs of Drosophila melanogaster, the antennae. (6/1334)

Biotransformation enzymes have been found in the olfactory epithelium of vertebrates. We now show that in Drosophila melanogaster, a UDP-glycosyltransferase (UGT), as well as a short chain dehydrogenase/reductase and a cytochrome P450 are expressed specifically or preferentially in the olfactory organs, the antennae. The evolutionarily conserved expression of biotransformation enzymes in olfactory organs suggests that they play an important role in olfaction. In addition, we describe five Drosophila UGTs belonging to two families. All five UGTs contain a putative transmembrane domain at their C terminus as is the case for vertebrate UGTs where it is required for enzymatic activity. The primary sequence of the C terminus, including part of the transmembrane domain, differs between the two families but is highly conserved not only within each Drosophila family, but also between the members of one of the Drosophila families and vertebrate UGTs. The partial overlap of the conserved primary sequence with the transmembrane domain suggests that this part of the protein is involved in specific interactions occurring at the membrane surface. The presence of different C termini in the two Drosophila families suggests that they interact with different targets, one of which is conserved between Drosophila and vertebrates.  (+info)

Bordetella pertussis waaA encodes a monofunctional 2-keto-3-deoxy-D-manno-octulosonic acid transferase that can complement an Escherichia coli waaA mutation. (7/1334)

Bordetella pertussis lipopolysaccharide (LPS) contains a single 2-keto-3-deoxy-D-manno-octulosonic acid (Kdo) residue, whereas LPS from Escherichia coli contains at least two. Here we report that B. pertussis waaA encodes an enzyme capable of transferring only a single Kdo during the biosynthesis of LPS and that this activity is sufficient to complement an E. coli waaA mutation.  (+info)

Glycosyltransferase domain of penicillin-binding protein 2a from Streptococcus pneumoniae is membrane associated. (8/1334)

Penicillin-binding proteins (PBPs) are bacterial cytoplasmic membrane proteins that catalyze the final steps of the peptidoglycan synthesis. Resistance to beta-lactams in Streptococcus pneumoniae is caused by low-affinity PBPs. S. pneumoniae PBP 2a belongs to the class A high-molecular-mass PBPs having both glycosyltransferase (GT) and transpeptide (TP) activities. Structural and functional studies of both domains are required to unravel the mechanisms of resistance, a prerequisite for the development of novel antibiotics. The extracellular region of S. pneumoniae PBP 2a has been expressed (PBP 2a*) in Escherichia coli as a glutathione S-transferase fusion protein. The acylation kinetic parameters of PBP 2a* for beta-lactams were determined by stopped-flow fluorometry. The acylation efficiency toward benzylpenicillin was much lower than that toward cefotaxime, a result suggesting that PBP 2a participates in resistance to cefotaxime and other beta-lactams, but not in resistance to benzylpenicillin. The TP domain was purified following limited proteolysis. PBP 2a* required detergents for solubility and interacted with lipid vesicles, while the TP domain was water soluble. We propose that PBP 2a* interacts with the cytoplasmic membrane in a region distinct from its transmembrane anchor region, which is located between Lys 78 and Ser 156 of the GT domain.  (+info)

Glycosyltransferase family 64 protein elisa and antibodyGlycosyltransferase family 64 protein elisa and antibody
Shop Glycosyltransferase family 64 protein ELISA Kit, Recombinant Protein and Glycosyltransferase family 64 protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=glycosyltransferase-family-64-protein
Glycosyltransferase family protein 64 protein elisa and antibodyGlycosyltransferase family protein 64 protein elisa and antibody
Shop Glycosyltransferase family protein 64 protein ELISA Kit, Recombinant Protein and Glycosyltransferase family protein 64 protein Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=glycosyltransferase-family-protein-64-protein
Ganglioside glycosyltransferases are S-acylated at conserved cysteine residues involved in homodimerization | CIQUIBIC
Chumpen Ramirez S et at, Biochem J., 2017. Ganglioside glycosyltransferases (GGTs) are type-II membrane proteins bearing a short N-terminal cytoplasmic tail, a transmembrane domain (TMD), and a lumenal catalytic domain. The expression and activity of these enzymes largely determine the quality of the glycolipids that decorate mammalian cells membranes. Many glycosyltransferases are themselves glycosylated and this is important for their proper localisation, but few if any other post-translational modifications of these proteins have been reported. Here we show that the GGTs, ST3Gal-V, ST8Sia-I, and β4GalNAcT-I are S-acylated at conserved cysteine residues located close the cytoplasmic border of their TMDs. ST3Gal-II, a GT that sialylates glycolipids and glycoproteins, is also S-acylated at a conserved cysteine located in the N-terminal cytoplasmic tail. Many others GTs also possess cysteine residues in their cytoplasmic regions suggesting that this modification occurs on these GTs as well. ...
http://ciquibic.fcq.unc.edu.ar/ganglioside-glycosyltransferases-are-s-acylated-at-conserved-cysteine-residues-involved-in-homodimerization/
Expression of xyloglucan endotransglucosylase/hydrolase (XTH) genes and XET activity in ethylene treated apple and tomato...Expression of xyloglucan endotransglucosylase/hydrolase (XTH) genes and XET activity in ethylene treated apple and tomato...
El Archivo Digital UPM alberga en formato digital la documentacion academica y cientifica (tesis, pfc, articulos, etc..) generada en la Universidad Politecnica de Madrid.Los documentos del Archivo Digital UPM son recuperables desde buscadores: Google, Google Academics, Yahoo, Scirus, etc y desde recolectores OAI: E-ciencia, DRRD, Recolecta (REBIUN-FECYT), Driver, Oaister, etc.
http://oa.upm.es/29010/
XTH1 - Probable xyloglucan endotransglucosylase/hydrolase 1 precursor - Solanum lycopersicum (Tomato) - XTH1 gene & proteinXTH1 - Probable xyloglucan endotransglucosylase/hydrolase 1 precursor - Solanum lycopersicum (Tomato) - XTH1 gene & protein
Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity).
http://www.uniprot.org/uniprot/Q40144
Glycoside Hydrolase Family 94 - CAZypediaGlycoside Hydrolase Family 94 - CAZypedia
This family of glycoside hydrolases exclusively contains phosphorylases that cleave β-glycosidic bonds. The substrate specificities found in GH94 are: cellobiose (Glc-β1,4-Glc) phosphorylase (EC 2.4.1.20), cellodextrin ((Glc-β1,4-)n-1Glc; n ≥ 3) phosphorylase (EC 2.4.1.49), and N,N-diacetyl chitobiose (GlcNAc-β1,4-GlcNAc) phosphorylase. Moreover, a phosphorylase domain belonging to this family is found in cyclic β-1,2-glucan synthase, a modular protein that also contains a glycosyltransferase domain from Glycosyltransferase Family 84 [1]. The GH94 domain is thought to phosphorolyze protein-bound β-1,2-glucans synthesized from UDP-glucose by the GT84 domain. GH94 enzymes were initially classified in Glycosyltransferase Family 36 because none of them show hydrolytic activity. However because of the evolutionary, structural and mechanistic relatedness with clan GH-L glycoside hydrolases, the family was re-assigned to family GH94 [2]. ...
https://www.cazypedia.org/index.php/Glycoside_Hydrolase_Family_94
Glycosyltransferase Families - CAZypediaGlycosyltransferase Families - CAZypedia
A detailed explanation of the catalytic mechanism employed by these enzymes can be found on the Glycosyltransferases lexicon page. Note: Transglycosylases are distinct from glycosyltransferases. Although both formally catalyze glycosyl transfer, i.e. transfer of a glycosyl residue from a donor substrate to an acceptor substrate,transglycosylases are mechanistically and structurally related to the glycoside hydrolases. Specifically, transglycosylases catalyze the intra- or intermolecular substitution of the anomeric position of glycosides. ...
http://www.cazypedia.org/index.php/Glycosyltransferase_Families
The Arabidopsis Cytochrome P450, cytochrome b5, P450 reductase, β-Glucosidase, and Glycosyltransferase Family 1 Site
Our site contains information on Cytochromes P450, Cytochromes b5, NADPH-Cytochrome P450 reductases, β-Glucosidases, and Glycosyltransferases (Family 1). Follow any of the links above for more information, or check our recent updates. The four structures shown above are links to the P450 (upper left), UGT (upper right), P450 reductase (lower left), and cytochrome b5 (lower right) sections of our site. Molecular images are made using UCSFs Chimera and Adobe Photoshop. Our last site update was on November 29, 2010 Areas Updated Recently: ...
http://p450.kvl.dk
Xyloglucan endotransglycosylases have a function during the formation of secondary cell walls of vascular tissuesXyloglucan endotransglycosylases have a function during the formation of secondary cell walls of vascular tissues
Xyloglucan transglycosylases (XETs) have been implicated in many aspects of cell wall biosynthesis, but their function in vascular tissues, in general, and in the formation of secondary walls, in particular, is less well understood. Using an in situ XET activity assay in poplar stems, we have demonstrated XET activity in xylem and phloem fibers at the stage of secondary wall formation. Immunolocalization of fucosylated xylogucan with CCRC-M1 antibodies showed that levels of this species increased at the border between the primary and secondary wall layers at the time of secondary wall deposition. Furthermore, one of the most abundant XET isoforms in secondary vascular tissues (PttXET16A) was cloned and immunolocalized to fibers at the stage of secondary wall formation. Together, these data strongly suggest that XET has a previously unreported role in restructuring primary walls at the time when secondary wall layers are deposited, probably creating and reinforcing the connections between the ...
http://kth.diva-portal.org/smash/record.jsf?pid=diva2:340830
wall biosynthesis
The GAUT genes are predicted to encode proteins with molecular masses between 61 and 78 KDa. Most of the GAUT proteins are likely to be type II membrane proteins with a transmembrane domain in their hypervariable N-terminal region. GAUT3,4, and 5 contain a N-terminal signal peptide rather than a transmembrane domain. By contrast, GAUT2 contains no N-terminal transmembrane domain and no signal peptide. The GATL genes encode proteins with molecular masses between 39 and 44 KDa and are predicted to contain only a signal peptide at their N termini suggesting they are processed into the secretory pathway. The 25 proteins in the GAUT1-related superfamily are members of the CAZy glycosyltransferase family 8. The Arabidopsis GAUT-1-related gene family consists of four clades (GAUT-A, GAUT-B, GAUT-C, and GATL, see above figure) that are clearly distinct from the other Arabidopsis glycosyltransferase family 8 proteins. Thus, we believe that the Arabidopsis family-8 proteins should be subdivided to reflect ...
https://www.ccrc.uga.edu/~mao/biosyn/text.htm
Evolution of intron-poor clades and expression patterns of the glycosyltransferase family 47 | SpringerLinkEvolution of intron-poor clades and expression patterns of the glycosyltransferase family 47 | SpringerLink
Main conclusion A large-scale bioinformatics analysis revealed the origin and evolution of GT47 gene family, and identified two clades of intron-poor genes with putative functions in drought stress...
https://link.springer.com/article/10.1007%2Fs00425-017-2821-6
Interaction of penicillin-binding protein 2 with soluble lytic transglycosylase B1 in Pseudomonas aeruginosa. - PubMed - NCBIInteraction of penicillin-binding protein 2 with soluble lytic transglycosylase B1 in Pseudomonas aeruginosa. - PubMed - NCBI
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
https://www.ncbi.nlm.nih.gov/pubmed/18708507
EMBL: CP001743.PE380
CP001743.PE380 Location/Qualifiers FT CDS_pept 365530..366618 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Mrub_0385 FT /product=glycosyl transferase family 2 FT /note=PFAM: glycosyl transferase family 2; SPTR: A4CTP8 FT Putative glycosyltransferase family 2; InterPro IPR001173; FT COGs: COG1215 Glycosyltransferase probably involved in cell FT wall biogenesis; KEGG: met:M446_3158 glycosyl transferase FT family protein; PFAM: Glycosyl transferase family 2 FT /db_xref=EnsemblGenomes-Gn:Mrub_0385 FT /db_xref=EnsemblGenomes-Tr:ADD27162 FT /protein_id=ADD27162.1 FT /translation=MVSILEVLWYGVLAWLGLKLLVLLLNMLFFPVLKREKLRGPRPTV FT SLLVPARNEAHNLRETLPGLLLQGVQEILVLNDHSTDATAQVVEEFSRQDARVRLLAGL FT PKPEGWMGKTWACYQLAQAAQGEVLIFTDADVHWHKRGVRAVLARMERERAGLVSVYPR FT QMTHSLAERVILPLIDDVLLCYLPYPLLRTPFPSASAANGQVMAFTRPAYLASGGHAAV FT RGEVLEDVRLAQKTKGAGQRLALALGGGLVAVRMYRGFAEIVEGLGKNLIEFHGRSRVV FT LALSYMGHLLAYTLCWPLALFNPLWLWVGVLGLLERLLLGLKTGRAWWELVLVPLAPLL FT STPIYWRSAQRKYTWKGREYSR atggtatcta tcctcgaggt ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-id?query=CP001743.PE380&db=EMBL&ident=ACNUC7421
RCSB PDB - Protein Feature View - Xyloglucan endotransglucosylase/hydrolase - Q8GZD5 (Q8GZD5 9ROSI)RCSB PDB - Protein Feature View - Xyloglucan endotransglucosylase/hydrolase - Q8GZD5 (Q8GZD5 9ROSI)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/pdb/protein/Q8GZD5
SMART: Pfam domain Glyco tran 28 CSMART: Pfam domain Glyco tran 28 C
The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-) and related proteins into distinct sequence based families has been described [(PUBMED:9334165)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form clans.. Glycosyltransferase family 28 comprises enzymes with a number of known activities; 1,2-diacylglycerol 3-beta-galactosyltransferase (EC ...
http://smart.embl.de/smart/do_annotation.pl?DOMAIN=Pfam:Glyco_tran_28_C&START=318&END=454&E_VALUE=1.5e-10&TYPE=PFAM&BLAST=EEKANLIASVLAQIPQKVLWRYSGKKPATLGSNTRLFNWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMLGDQPHNIAHMEAKGAALKVSISTMTSTDLLSAVRAVINEPSYKENAMRLSRIHHDQPV
STAT5-Induced Lunatic Fringe during Th2 Development Alters Delta-like 4-Mediated Th2 Cytokine Production in Respiratory...STAT5-Induced Lunatic Fringe during Th2 Development Alters Delta-like 4-Mediated Th2 Cytokine Production in Respiratory...
In this study, we found both in vitro and in vivo that a skewed Th2 environment increased Lfng expression in CD4 T cells. Importantly, Lfng expression exacerbated lung pathology and Th2 immune response during RSV-mediated exacerbation of allergic airway disease by enhancing Dll4-induced Notch activation. These findings are in accordance with previous work demonstrating that Lfng-mediated glycosylation of Notch1 enhances its capacity to be activated by Delta-like Notch ligands (3). Interestingly, a STAT5-dependent mechanism regulated Lfng expression during Th2 differentiation, and, in a positive feedback manner, Lfng further augmented Dll4-induced Notch activation and production of Th2 cytokines.. Mechanisms that regulate the immune response and associated pathology during RSV exacerbation of pulmonary airway disease are largely unknown. RSV exacerbation exploits the allergen-driven Th2 cytokine environment to further enhance Th2 cell development and worsen the inflammatory response. In this ...
http://www.jimmunol.org/content/192/3/996
CAZy - GH94
Formerly known as glycosyltransferase family GT36; Assigned to a GH family following a paper by Hidaka, Honda, Kitaoka, Nirasawa, Hayashi, Wakagi, Shoun and Fushinobu (Structure (Camb). 2004 Jun;12(6):937-947) (PMID: 15274915) that revealed the evolutionary, structural and mechanistic relationship of these phosphorylases with glycoside hydrolases of clan GH-L ...
http://www.cazy.org/GH94.html
CAZy - GH94
Formerly known as glycosyltransferase family GT36; Assigned to a GH family following a paper by Hidaka, Honda, Kitaoka, Nirasawa, Hayashi, Wakagi, Shoun and Fushinobu (Structure (Camb). 2004 Jun;12(6):937-947) (PMID: 15274915) that revealed the evolutionary, structural and mechanistic relationship of these phosphorylases with glycoside hydrolases of clan GH-L ...
http://www.cazy.org/GH94_bacteria.html?debut_TAXO=300
An integrated computational and experimental study uncovers FUT9 as a metabolic driver of colorectal cancer | Molecular Systems...An integrated computational and experimental study uncovers FUT9 as a metabolic driver of colorectal cancer | Molecular Systems...
FUT9 belongs to the glycosyltransferase family and catalyzes the last step in the biosynthesis of Ley glycolipids in the carbohydrate antigen Lex (Nishihara et al, 2003; Gouveia et al, 2012). This reaction takes place in the Golgi compartment, and the product is transported to the cytosol and secreted out from the cell (Duarte et al, 2007). The Ley glycolipid was previously reported to inhibit the procoagulant activity and metastasis of human adenocarcinoma (Nudelman et al, 1986; Suzuki et al, 1997; Inufusa et al, 2001). The loss of FUT9 in the metabolic model prevents Ley glycolipid formation and secretion. To chart the network‐wide metabolic alterations induced by FUT9 inactivation, we performed a Minimization Of Metabolic Adjustment (MOMA) (Segrè et al, 2002) analysis to predict the metabolic state after FUT9 KD in late‐stage colorectal cancers, simulated by the Gene Inactivity Moderated by Metabolism and Expression (GIMME) algorithm (Becker & Palsson, 2008) (Materials and Methods). This ...
http://msb.embopress.org/content/13/12/956
UGT3A2 Gene - GeneCards | UD3A2 Protein | UD3A2 AntibodyUGT3A2 Gene - GeneCards | UD3A2 Protein | UD3A2 Antibody
Complete information for UGT3A2 gene (Protein Coding), UDP Glycosyltransferase Family 3 Member A2, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=UGT3A2
CDw75 - NB100-78093 | acris-antibodies.com
CDw75, 100 Tests. CD75 is a 43-85 kD type II transmembrane sialoprotein, known as lacosamines, or CDw75. It is a member of glycosyltransferase family.
https://www.acris-antibodies.com/antibodies/primary-antibodies/cdw75-nb100-78093.htm
Nucleotide sugar - WikipediaNucleotide sugar - Wikipedia
Nucleotide sugars are the activated forms of monosaccharides. Nucleotide sugars act as glycosyl donors in glycosylation reactions. Those reactions are catalyzed by a group of enzymes called glycosyltransferases. The anabolism of oligosaccharides - and, hence, the role of nucleotide sugars - was not clear until the 1950s when Leloir and his coworkers found that the key enzymes in this process are the glycosyltransferases. These enzymes transfer a glycosyl group from a sugar nucleotide to an acceptor. To act as glycosyl donors, those monosaccharides should exist in a highly energetic form. This occurs as a result of a reaction between nucleoside triphosphate (NTP) and glycosyl monophosphate (phosphate at anomeric carbon). The recent discovery of the reversibility of many glycosyltransferase-catalyzed reactions calls into question the designation of sugar nucleotides as activated donors. There are nine sugar nucleotides in humans which act as glycosyl donors and they can be classified depending ...
https://en.wikipedia.org/wiki/Nucleotide_sugar
UDP-glycosyltransferase family, conserved site (IPR035595) | InterPro | EMBL-EBIUDP-glycosyltransferase family, conserved site (IPR035595) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
https://www.ebi.ac.uk/interpro/entry/IPR035595
Faculty Scholarship | Chemistry | Wesleyan UniversityFaculty Scholarship | Chemistry | Wesleyan University
The Stories Tryptophans Tell: Exploring Protein Dynamics of Heptosyltransferase I from Escherichia coli, Joy M. Cote, Carlos A. Ramirez-Mondragon, Zarek S. Siegel, Daniel J. Czyzyk, Jiali Gao, Yuk Y. Sham, Ishita Mukerji, and Erika A. Taylor. ...
https://wesscholar.wesleyan.edu/chemfacpub/
Using a Glycosyltransferase Activity Assay to Study Glycosylation and the Function of GTs - BellBrook LabsUsing a Glycosyltransferase Activity Assay to Study Glycosylation and the Function of GTs - BellBrook Labs
Learn About Lysosomal Storage Disorders and How A Glycosyltransferase Activity Assay Can Be Used to Find Novel Therapeutics for These Diseases.
https://www.bellbrooklabs.com/glycosyltransferase-activity-assay-function-gts/
Search BRITE
KEGG Orthology (KO) [BR:ccv00001] 09180 Brite Hierarchies 09181 Protein families: metabolism 01005 Lipopolysaccharide biosynthesis proteins [BR:ccv01005] CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6] Enzymes [BR:ccv01000] 2. Transferases 2.7 Transferring phosphorus-containing groups 2.7.8 Transferases for other substituted phosphate groups 2.7.8.6 undecaprenyl-phosphate galactose phosphotransferase CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6] Lipopolysaccharide biosynthesis proteins [BR:ccv01005] O-antigen CCV52592_0291 sugar transferase K00996 rfbP; undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6 ...
https://www.genome.jp/kegg-bin/search_brite?option=-a&search_string=CCV52592_0291&prefix=ccv
OriGene - MFNG (NM 001166343) Human ORF cDNA CloneOriGene - MFNG (NM 001166343) Human ORF cDNA Clone
MFNG - MFNG (Myc-DDK-tagged)-Human MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 2 available for purchase from OriGene - Your Gene Company.
http://www.origene.com/orf_clone/trueclone/NM_001166343/RC229860/MFNG.aspx
The Molecular Characterization of a Predicted Glycosyltransferase from by Alberto G. DistefanoThe Molecular Characterization of a Predicted Glycosyltransferase from by Alberto G. Distefano
The synthesis of the plant cell wall is very complex, and understanding how this process occurs will lead to many benefits for future research and industries dependent upon cell walls for their products. The recent discovery of the functions of AtMUR3 and AtGT18 in Arabidopsis thaliana as xyloglucan galactosyltransferases has led to the identification of many more putative glycosyltransferases in the Arabidopsis genome. Due to the structural differences between the xyloglucans of Arabidopsis and solanaceous plants, we decided to search for putative arabinosyltransferases in the Solanaceae. Solanaceous xyloglucan is substituted by one to two arabinosyl residues at the second xylose position, and sometimes contains an arabinose at the first xylose position. In contrast, Arabidopsis xyloglucan does not contain arabinose, and is substituted by galactose at the second and third xylose position. Furthermore, the second galactose residue in Arabidopsis xyloglucan is usually fucosylated, a modification not
http://opencommons.uconn.edu/srhonors_theses/1/
The hyaluronate synthase from a eukaryotic cell line | Biochemical JournalThe hyaluronate synthase from a eukaryotic cell line | Biochemical Journal
The hyaluronate synthase complex was identified in plasma membranes from B6 cells. It contained two subunits of molecular masses 52 kDa and 60 kDa which bound the precursor UDP-GlcA in digitonin solution and partitioned into the aqueous phase, together with nascent hyaluronate upon Triton X-114 phase separation. The 52 kDa protein cross-reacted with poly- and monoclonal antibodies raised against the streptococcal hyaluronate synthase and the 60 kDa protein was recognized by monoclonal antibodies raised against a hyaluronate receptor. The 52 kDa protein was purified to homogeneity by affinity chromatography with monoclonal anti-hyaluronate synthase. ...
http://www.biochemj.org/content/290/3/791
hyaluronate synthase from a eukaryotic cell line | Biochemical Journal | Portland Presshyaluronate synthase from a eukaryotic cell line | Biochemical Journal | Portland Press
The hyaluronate synthase complex was identified in plasma membranes from B6 cells. It contained two subunits of molecular masses 52 kDa and 60 kDa which bound the precursor UDP-GlcA in digitonin solution and partitioned into the aqueous phase, together with nascent hyaluronate upon Triton X-114 phase separation. The 52 kDa protein cross-reacted with poly- and monoclonal antibodies raised against the streptococcal hyaluronate synthase and the 60 kDa protein was recognized by monoclonal antibodies raised against a hyaluronate receptor. The 52 kDa protein was purified to homogeneity by affinity chromatography with monoclonal anti-hyaluronate synthase. ...
https://portlandpress.com/biochemj/article/290/3/791/28370/The-hyaluronate-synthase-from-a-eukaryotic-cell
Cell wall glucomannan in Arabidopsis is synthesised by CSLA glycosyltransferases, and influences the speed of embryogenesis -...
Goubet, F and Barton, CJ and Mortimer, JC and Xu, X and Zhang, Z and Miles, GP and Richens, J and Liepmann, A and Seffen, KA and Dupree, P (2009) Cell wall glucomannan in Arabidopsis is synthesised by CSLA glycosyltransferases, and influences the speed of embryogenesis. The Plant Journal. ISSN 0960-7412. Full text not available from this repository ...
http://publications.eng.cam.ac.uk/333165/
The Lunatic Fringe (Part 2) - Page 1029The Lunatic Fringe (Part 2) - Page 1029
Before you think of posting here, read back here , then read ahead The Lunatic Fringe (Part 1) http://www.colorado4x4.org/gallery/files/3/1/5/2/Untitled-1.jpg
http://www.colorado4x4.org/vbb/showthread.php?217954-The-Lunatic-Fringe-
Buy Losa (Losartan) Online
Buy Losa Online! Losa is used to treat high blood pressure (hypertension) and to help protect the kidneys from damage due to diabetes. It is also used to lower the risk of strokes in patients with high blood pressure and an enlarged heart. Lowering high blood pressure helps prevent strokes, heart attacks, and kidney problems. Losa belongs to a class of drugs called...
https://visionsxrwabbitt36.cf/cheap_losa.html
Mutagenetix > Incidental...Mutagenetix > Incidental...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] The protein encoded by this gene belongs to the UDP-glycosyltransferase family. It catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central and peripheral nervous systems. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2011 ...
https://mutagenetix.utsouthwestern.edu/incidental/incidental_rec.cfm?mid=64700
RCSB PDB - Protein Feature View - UDP-glycosyltransferase 72B1 - Q9M156 (U72B1 ARATH)RCSB PDB - Protein Feature View - UDP-glycosyltransferase 72B1 - Q9M156 (U72B1 ARATH)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/pdb/protein/Q9M156
SMART: Pfam domain Glycos transf 1SMART: Pfam domain Glycos transf 1
The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form clans. Proteins containing this domain transfer UDP, ADP, GDP or CMP linked sugars to a variety of substrates, including glycogen, ...
http://smart.embl.de/smart/do_annotation.pl?DOMAIN=Pfam:Glycos_transf_1&START=248&END=428&E_VALUE=3.8e-29&TYPE=PFAM&BLAST=IPLHEKKVTPGHLLVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQIRKNARAS
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Suggested Peptide Antigen for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; can be found in Genscripts Peptide Antigen Database. Anti- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; pAb has guaranteed Elisa titer of 1:64000 and 95% WB success rate
https://www.genscript.com/peptide-antigen-database.html?aid=DAD1_HUMAN
A search for pyrophosphate mimics for the development of substrates and inhibitors of glycosyltransferasesA search for pyrophosphate mimics for the development of substrates and inhibitors of glycosyltransferases
The design and synthesis of several beta-1,4-galactosyltransferase inhibitors are reported. Mimics of the pyrophosphate-Mn2+ complex were the focus of the design. Malonic, tartaric, and monosaccharide moieties were used as replacements of the pyrophosphate moiety, and galactose or azasugars with potent galactosidase inhibitory activity were used as the donor component. Compound 6, in which glucose was used as the pyrophosphate-Mn2+ complex mimic and galactose as the donor component, showed the best inhibitory activity towards the transferase with a Ki of 119.6 microM ...
https://vivo.scripps.edu/display/endnote53819
KAKEN - Research Projects | The molecular mechanisms underlying Golgi retention of glycosyltransferases (KAKENHI-PROJECT...KAKEN - Research Projects | The molecular mechanisms underlying Golgi retention of glycosyltransferases (KAKENHI-PROJECT...
Principal Investigator：NISHIHARA Shoko, Project Period (FY)：1998 - 1999, Research Category：Grant-in-Aid for Scientific Research (C), Section：一般, Research Field：Structural biochemistry
https://kaken.nii.ac.jp/grant/KAKENHI-PROJECT-10680590/
KAKEN - Research Projects | The expression mechanism of glycosyltransferases in adenocarcimoma cells -a study using endometrial...KAKEN - Research Projects | The expression mechanism of glycosyltransferases in adenocarcimoma cells -a study using endometrial...
Principal Investigator：NOZAWA Shiro, Project Period (FY)：1994 - 1995, Research Category：Grant-in-Aid for General Scientific Research (B), Research Field：Obstetrics and gynecology
https://kaken.nii.ac.jp/grant/KAKENHI-PROJECT-06454479/
Lunatic fringe in peripheral T cells alters Notch-mediated Th2 pathology in viral - Sumanta MukherjeeLunatic fringe in peripheral T cells alters Notch-mediated Th2 pathology in viral - Sumanta Mukherjee
Childhood allergic asthma has been and still is a growing health problem in the western world. Many children begin to have significant complications from severe...
http://grantome.com/grant/NIH/K99-HL114733-01A1
mltA - Membrane-bound lytic murein transglycosylase - Agrobacterium fabrum (strain C58 / ATCC 33970) - mltA gene & proteinmltA - Membrane-bound lytic murein transglycosylase - Agrobacterium fabrum (strain C58 / ATCC 33970) - mltA gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
http://www.uniprot.org/uniprot/A9CKT8
ADME/Tox? - Prediction of Metabolism | PreMetabo
In the real world, of course, chemical compounds rarely exhibit this ideal combination of characteristics. Few are fully absorbed from the gut. The percentage that does cross is distributed at various sites in the body including, but not exclusively, the intended site of action. A large proportion passes through the liver where it may be metabolized by enzymes, such as the P450 oxygenases, sugar transferases, and drug transport system. Drugs may induce the activity of these molecular bouncers whose main biological role is to show the door to non-nutritious compounds, which the rather more welcoming guardians of the gut, lung, and other epithelia have foolishly allowed entry. The door in this case, of course, is usually the kidney. Elimination, the ultimate fate of all foreign compounds, including drugs, is relatively easy to measure, but much harder to explain or predict for any particular compound. It is, of course, highly dependent on the complex series of molecular, cellular, and ...
https://premetabo.bmdrc.kr/admetox/
EMBL: CP000124.RFAE
CP000124.RFAE Location/Qualifiers FT CDS_pept 620827..621312 FT /codon_start=1 FT /transl_table=11 FT /gene=rfaE FT /locus_tag=BURPS1710b_0607 FT /product=rfaE bifunctional protein, domain II FT /EC_number=2.7.7.- FT /note=identified by match to protein family HMM PF01467; FT match to protein family HMM TIGR00125; match to protein FT family HMM TIGR02199 FT /db_xref=EnsemblGenomes-Gn:BURPS1710b_0607 FT /db_xref=EnsemblGenomes-Tr:ABA50187 FT /db_xref=GOA:Q3JWN2 FT /db_xref=InterPro:IPR004821 FT /db_xref=InterPro:IPR011914 FT /db_xref=InterPro:IPR014729 FT /db_xref=UniProtKB/TrEMBL:Q3JWN2 FT /protein_id=ABA50187.1 FT /translation=MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA FT DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS FT LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR atgcccgctt cgttcgaacg caagctgatc acccgcgacg cgctcgccgc catgcgcgcg 60 tcgctgcccg cgcccgtcgt cttcacgaac ggcgtattcg acatcctgca tcgcggccac 120 gtcagctatc tcgccgacgc gaaggcgctc ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-id?query=CP000124.RFAE&db=EMBL&ident=SCRATCH9089
Digitoxosyltetracenomycin C and Glucosyltetracenomycin C, Two Novel Elloramycin Analogues Obtained by Exploring the Sugar Donor...Digitoxosyltetracenomycin C and Glucosyltetracenomycin C, Two Novel Elloramycin Analogues Obtained by Exploring the Sugar Donor...
Digitoxosyltetracenomycin C and Glucosyltetracenomycin C, Two Novel Elloramycin Analogues Obtained by Exploring the Sugar Donor Substrate Specificity of Glycosyltransferase ElmGT
https://acs.figshare.com/articles/Digitoxosyltetracenomycin_C_and_Glucosyltetracenomycin_C_Two_Novel_Elloramycin_Analogues_Obtained_by_Exploring_the_Sugar_Donor_Substrate_Specificity_of_Glycosyltransferase_ElmGT/3734313
Alle MPIKG Open Access Publikationen | Max-Planck-Institut für Kolloid- und Grenzflächenforschung
Ruprecht, C.; Bartetzko, M. P.; Senf, D.; Lakhina, A.; Smith, P. J.; Soto, M. J.; Oh, H.; Yang, J.-Y.; Chapla, D.; Varón Silva, D. et al.; Clausen, M. H.; Hahn, M. G.; Moremen, K. W.; Urbanowicz, B. R.; Pfrengle, F.: A glycan array-based assay for the identification and characterization of plant glycosyltransferases. Angewandte Chemie International Edition (2020 ...
http://www.mpikg.mpg.de/publication-search/5470814?person=%2Fpersons%2Fresource%2Fpersons97366
Bacteria RfaE protein Summary Report | CureHunterBacteria RfaE protein Summary Report | CureHunter
Bacteria RfaE protein: ADP-heptose synthase, required for lipopolysaccharide biosynthesis; amino acid sequence given in first source
http://www.curehunter.com/public/keywordSummaryC092232-Bacteria-RfaE-protein.do
Sequence Similarity Search - BLAST
ami:Amir_6058 K16150 glycogen synthase [EC:2.4.1.11] , (GenBank) glycosyl transferase group 1 (A) MRVLMLSWEYPPVVVGGLGRHVHALADRLVRAGHEVVVLCRQPEGTDAVTHPTEDVVLGG VRVVRVAEDPAHLVFERDLVAWVLAMGHAMTRAGLALLLEGWRPDVVHAHDWLVTHPAVA LAEASQAPLVATVHATEAGRHSGWLSQTLNQQVHSVEWWLANRADELITCSAAMRAEVAH LFEVEPGGITVLHNGIEPKRWRVRAADVEAARGRHSPDGAPVLLFFGRLEWEKGVQDLIA ALPRVRRRHPGTRLVVAGTGTHREWLVEQARKQKVKRAVEFAGHLSDRELAAAIASAAAV VLPSRYEPFGIVALEAAAAGAPLVASTAGGLGEVVLDGETGLSFPPGDVDALARAVCAVL DDRAAAGRRAKAAKARLATDFDWGTIAEGTVEVYRAAVVRERGALGRPKIGTGNVFL ...
http://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=ami:Amir_6058+aa
Enzymatic properties of native and deglycosylated hybrid aspen (Populus tremula×tremuloides) xyloglucan endotransglycosylase...Enzymatic properties of native and deglycosylated hybrid aspen (Populus tremula×tremuloides) xyloglucan endotransglycosylase...
The cDNA encoding a xyloglucan endotransglycosylase, PttXET16A, from hybrid aspen (Populus tremula×tremuloides) has been isolated from an expressed sequence tag library and expressed in the methylotrophic yeast Pichia pastoris. Sequence analysis indicated a high degree of similarity with other proteins in the XTH (xyloglucan transglycosylase/hydrolase) gene subfamily of GH16 (glycoside hydrolase family 16). In addition to the conserved GH16 catalytic sequence motif, PttXET16A contains a conserved N-glycosylation site situated proximal to the predicted catalytic residues. MS analysis indicated that the recombinant PttXET16A expressed in P. pastoris is heterogeneous due to the presence of variable N-glycosylation and incomplete cleavage of the α-factor secretion signal peptide. Removal of the N-glycan by endoglycosidase H treatment did not influence the catalytic activity significantly. Similarly, site-directed mutagenesis of Asn93 to serine to remove the N-glycosylation site resulted in an ...
https://portlandpress.com/biochemj/article-abstract/390/1/105/42071/Enzymatic-properties-of-native-and-deglycosylated?redirectedFrom=fulltext
Donor substrate promiscuity of bacterial β1-3-N-acetylglucosaminyltransferases and acceptor substrate flexibility of β1-4...
TY - JOUR. T1 - Donor substrate promiscuity of bacterial β1-3-N-acetylglucosaminyltransferases and acceptor substrate flexibility of β1-4-galactosyltransferases. AU - Li, Yanhong. AU - Xue, Mengyang. AU - Sheng, Xue. AU - Yu, Hai. AU - Zeng, Jie. AU - Thon, Vireak. AU - Chen, Yi. AU - Muthana, Musleh M.. AU - Wang, Peng G.. AU - Chen, Xi. PY - 2016/4/15. Y1 - 2016/4/15. N2 - β1-3-N-Acetylglucosaminyltransferases (β3GlcNAcTs) and β1-4-galactosyltransferases (β4GalTs) have been broadly used in enzymatic synthesis of N-acetyllactosamine (LacNAc)-containing oligosaccharides and glycoconjugates including poly-LacNAc, and lacto-N-neotetraose (LNnT) found in the milk of human and other mammals. In order to explore oligosaccharides and derivatives that can be synthesized by the combination of β3GlcNAcTs and β4GalTs, donor substrate specificity studies of two bacterial β3GlcNAcTs from Helicobacter pylori (Hpβ3GlcNAcT) and Neisseria meningitidis (NmLgtA), respectively, using a library of 39 ...
https://ucdavis.pure.elsevier.com/en/publications/donor-substrate-promiscuity-of-bacterial-%CE%B21-3-n-acetylglucosaminy
Altered sugar donor specificity and catalytic activity of pteridine glycosyltransferases by domain swapping or site-directed...
Altered sugar donor specificity and catalytic activity of pteridine glycosyltransferases by domain swapping or site-directed mutagenesis;kpubs;kpubs.org
http://www.kpubs.org/article/articleMain.kpubs?articleANo=E1MBB7_2013_v46n1_37
Root Hair Initiation Is Coupled to a Highly Localized Increase of Xyloglucan Endotransglycosylase Action in Arabidopsis Roots |...Root Hair Initiation Is Coupled to a Highly Localized Increase of Xyloglucan Endotransglycosylase Action in Arabidopsis Roots |...
When entering the differentiation zone, the elongating root cells that are programmed to become trichoblasts drastically add a new growth pattern to allow the highly localized emergence of root hairs. The initiation of a root hair is characterized on the level of gene expression patterns (for review, see Schiefelbein, 2000). On the level of cell physiology, specific enzymes or proteins need to restructure a defined spot of the apical outer periclinal cell wall to allow local wall loosening and bulging. At the time of root hair initiation, inside the cytoplasm actin and microtubules rearrange (Emons and Derksen, 1986; Baluška et al., 2000a, 2000b). A highly localized acidification (pH 4.5) of the cell wall is associated with the initiation process (Bibikova et al., 1998). Once the initiation is completed, the wall pH returns to the pH (approximately 6) found in the rest of the trichoblast. Besides pH changes, other factors are likely to be important to predict the future site of root hair ...
http://www.plantphysiol.org/content/127/3/1125?ijkey=b5ff552aa5cb71856bc370b6e543dc2ea6118894&keytype2=tf_ipsecsha
The donor subsite of trehalose-6-phosphate synthase - Binary complexes with UDP-glucose and UDP-2-deoxy-2-fluoro-glucose at 2...The donor subsite of trehalose-6-phosphate synthase - Binary complexes with UDP-glucose and UDP-2-deoxy-2-fluoro-glucose at 2...
Trehalose is an unusual non-reducing disaccharide that plays a variety of biological roles, from food storage to cellular protection from environmental stresses such as desiccation, pressure, heat-shock, extreme cold, and oxygen radicals. It is also an integral component of the cell-wall glycolipids of mycobacteria. The primary enzymatic route to trehalose first involves the transfer of glucose from a UDP-glucose donor to glucose-6-phosphate to form alpha,alpha-1,1 trehalose-6-phosphate. This reaction, in which the configurations of two glycosidic bonds are set simultaneously, is catalyzed by the glycosyltransferase trehalose-6-phosphate synthase ( OtsA), which acts with retention of the anomeric configuration of the UDP-sugar donor. The classification of activated sugar-dependent glycosyltransferases into approximately 70 distinct families based upon amino acid sequence similarities places OtsA in glycosyltransferase family 20 (see afmb.cnrs-mrs.fr/CAZY/). The recent 2.4 Angstrom structure of ...
https://www.chem.ubc.ca/donor-subsite-trehalose-6-phosphate-synthase-binary-complexes-udp-glucose-and-udp-2-deoxy-2-fluoro
Intermediate trapping on a mutant retaining alpha-galactosyltransferase identifies an unexpected aspartate residue | UBC...Intermediate trapping on a mutant retaining alpha-galactosyltransferase identifies an unexpected aspartate residue | UBC...
Lipopolysaccharyl-alpha-1,4-galactosyltransferase C (LgtC), a glycosyltransferase family 8 alpha-1,4-galactosyltransferase from Neisseria meningitidis, catalyzes the transfer of galactose from UDP galactose to terminal lactose-containing acceptor sugars with net retention of anomeric configuration. To investigate the potential role of discrete nucleophilic catalysis suggested by the double displacement mechanism generally proposed for retaining glycosyltransferases, the side chain amide of Gln-189, which is suitably positioned to act as the catalytic nucleophile of LgtC, was substituted with the more nucleophilic carboxylate-containing side chain of glutamate in the hope of accumulating a glycosyl-enzyme intermediate. The resulting mutant was subjected to kinetic, mass spectrometric, and x-ray crystallographic analysis. Although the K-m for UDP-galactose is not significantly altered, the k(cat) was reduced to 3% that of the wild type enzyme. Electrospray mass spectrometric analysis revealed that ...
https://www.chem.ubc.ca/intermediate-trapping-mutant-retaining-alpha-galactosyltransferase-identifies-unexpected-aspartate
Group III-A XTH Genes of Arabidopsis Encode Predominant Xyloglucan Endohydrolases That Are Dispensable for Normal GrowthGroup III-A XTH Genes of Arabidopsis Encode Predominant Xyloglucan Endohydrolases That Are Dispensable for Normal Growth
The molecular basis of primary wall extension endures as one of the central enigmas in plant cell morphogenesis. Classical cell wall models suggest that xyloglucan endo-transglycosylase activity is the primary catalyst (together with expansins) of controlled cell wall loosening through the transient cleavage and religation of xyloglucan-cellulose cross links. The genome of Arabidopsis (Arabidopsis thaliana) contains 33 phylogenetically diverse XYLOGLUCAN ENDO-TRANSGLYCOSYLASE/HYDROLASE (XTH) gene products, two of which were predicted to be predominant xyloglucan endohydrolases due to clustering into group III-A. Enzyme kinetic analysis of recombinant AtXTH31 confirmed this prediction and indicated that this enzyme had similar catalytic properties to the nasturtium (Tropaeolum majus) xyloglucanase1 responsible for storage xyloglucan hydrolysis during germination. Global analysis of Genevestigator data indicated that AtXTH31 and the paralogous AtXTH32 were abundantly expressed in expanding ...
http://kth.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A578847&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all
N-Acetylgalactosaminyltransferase-14 as a potential biomarker for breast cancer by immunohistochemistry | BMC Cancer | Full TextN-Acetylgalactosaminyltransferase-14 as a potential biomarker for breast cancer by immunohistochemistry | BMC Cancer | Full Text
Abnormal O-glycans expressed by cancer cells have functional importance in cell adhesion, invasion, and metastasis [15]. Alterations in mucin-type O-glycans has been associated with malignant transformation, resulting in the formation of less complex structures and leading to an increase of the simple short determinants. Protein O-glycosylation is deregulated in breast cancer cells, leading to the accumulation of simple mucin-type tumor-associated antigens [37]. The expression of GalNAc-T14 mRNA was analyzed in normal and malignant tissue from breast, skin, lung, pancreas, ovary, endometrium, bladder and lymphoid cancers. A subset of tumor samples, ranging from 10% in lobular breast cancer to 30% in lung cancer and diffuse large B-cell lymphoma, showed GalNAc-T14 mRNA overexpression [36]. Under thees circumstances, we hypothesize the expression of GalNAc-T14 may be a useful biomarker for breast cancer by immunohistochemistry.. It has been shown that several glycosyltransferases are useful tumor ...
https://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-10-123
Browsing publications of the research group cellular proteom research (CPRO) by Subject (MeSH)Browsing publications of the research group cellular proteom research (CPRO) by Subject (MeSH)
Staphylococcus aureus is the most common cause of nosocomial infections. Multiple antibiotic resistance and severe clinical outcomes provide a strong rationale for development of immunoglobulin-based strategies. Traditionally, novel immunological approaches against bacterial pathogens involve antibodies directed against cell surface-exposed virulence-associated epitopes or toxins. In this study, we generated a monoclonal antibody targeting the housekeeping protein IsaA, a suggested soluble lytic transglycosylase of S. aureus, and tested its therapeutic efficacy in two experimental mouse infection models. A murine anti-IsaA antibody of the IgG1 subclass (UK-66P) showed the highest binding affinity in Biacore analysis. This antibody recognized all S. aureus strains tested, including hospital-acquired and community-acquired methicillin-resistant S. aureus strains. Therapeutic efficacy in vivo in mice was analyzed using a central venous catheter-related infection model and a sepsis survival model. ...
https://repository.helmholtz-hzi.de/handle/10033/620721/browse?type=mesh&value=Antigens%2C+Bacterial
WAAC is sponsoring McCrone Microscopy for Conservators in Los AngelesWAAC is sponsoring McCrone Microscopy for Conservators in Los Angeles
Because of the large amount of interest shown by WAAC members in holding the Chicago-based McCrone Research Institute Microscopy for Conservators course on the West Coast, the WAAC Board voted at the 1990 Annual Meeting in Avalon, California to pursue this activity. The McCrone Research Institute has agreed to conduct two sessions of this course in Los Angeles, one session February 10-14, 1992 and the other February 17-21, 1992. The class is held for 8 or more hours per day, with alternating lecture and lab. There are openings for 20 students each week. These sessions will be held at the Getty Conservation Institute, where the Training Program of the GCI has generously extended the use of its laboratory facilities for this WAAC endeavor. Participants will be responsible for arranging their own housing. The McCrone Research Institute is making this course available at a substantial discount to WAAC members. Tuition for each participant will be $700. The McCrone Research Institute will supply ...
http://cool.conservation-us.org/waac/wn/wn13/wn13-3/wn13-303.html
Guarino, US - Patent applicationsGuarino, US - Patent applications
GLYCOSYLATED PROTEIN EXPRESSION IN PROKARYOTES - The present invention relates to a prokaryotic host cell comprising eukaryotic glycosyltransferase activity, where the eukaryotic glycosyltransferase activity is eukaryotic dolichyl-linked UDP-GlcNAc transferase activity and eukaryotic mannosyl-transferase activity. Also disclosed is a method of producing a glycosylated protein by providing a prokaryotic host cell comprising the eukaryotic glycosyltransferase activity and culturing the prokaryotic host cell under conditions effective to produce a glycosylated protein. Another aspect of the present invention pertains to a method for screening bacteria or bacteriophages by expressing one or more glycans on the surface of a bacteria, attaching a label on the one or more glycans on the surface of the bacteria or on the surface of a bacteriophage derived from the bacteria, and analyzing the label in a high-throughput format. A glycosylated antibody comprising an Fv portion which recognizes and binds to ...
http://www.patentsencyclopedia.com/inventor/guarino-us-5/
Publikationen: Leibniz-Institut für Pflanzenbiochemie
Plant genomes encode numerous small molecule glycosyltransferases which modulate the solubility, activity, immunogenicity and/or reactivity of hormones, xenobiotics and natural products. The products of these enzymes can accumulate to very high concentrations, yet somehow avoid inhibiting their own biosynthesis. Glucosyltransferase UGT74B1 (UDP-glycosyltransferase 74B1) catalyses the penultimate step in the core biosynthetic pathway of glucosinolates, a group of natural products with important functions in plant defence against pests and pathogens. We found that mutation of the highly conserved Ser284 to leucine [wei9-1 (weak ethylene insensitive)] caused only very mild morphological and metabolic phenotypes, in dramatic contrast with knockout mutants, indicating that steady state glucosinolate levels are actively regulated even in unchallenged plants. Analysis of the effects of the mutation via a structural modelling approach indicated that the affected serine interacts directly with ...
https://www.ipb-halle.de/forschung/molekulare-signalverarbeitung/publikationen/?tx_solr%5Bfilter%5D%5B0%5D=publisher%3ABiol.+Chem&tx_solr%5Bfilter%5D%5B1%5D=publisher%3ABio+Essays&tx_solr%5Bfilter%5D%5B2%5D=publisher%3ABiochem+J&tx_solr%5Bfilter%5D%5B3%5D=year%3A2013&tx_solr%5Bfilter%5D%5B4%5D=publisher%3A+Annals+of+Botany&tx_solr%5Bfilter%5D%5B5%5D=type%3A1
Publikationen: Leibniz-Institut für Pflanzenbiochemie
Plant genomes encode numerous small molecule glycosyltransferases which modulate the solubility, activity, immunogenicity and/or reactivity of hormones, xenobiotics and natural products. The products of these enzymes can accumulate to very high concentrations, yet somehow avoid inhibiting their own biosynthesis. Glucosyltransferase UGT74B1 (UDP-glycosyltransferase 74B1) catalyses the penultimate step in the core biosynthetic pathway of glucosinolates, a group of natural products with important functions in plant defence against pests and pathogens. We found that mutation of the highly conserved Ser284 to leucine [wei9-1 (weak ethylene insensitive)] caused only very mild morphological and metabolic phenotypes, in dramatic contrast with knockout mutants, indicating that steady state glucosinolate levels are actively regulated even in unchallenged plants. Analysis of the effects of the mutation via a structural modelling approach indicated that the affected serine interacts directly with ...
https://www.ipb-halle.de/forschung/molekulare-signalverarbeitung/publikationen/?tx_solr%5Bfilter%5D%5B0%5D=publisher%3AActa+Biol.+Szeged+&tx_solr%5Bfilter%5D%5B1%5D=publisher%3ABiochem+J&tx_solr%5Bfilter%5D%5B2%5D=publisher%3AJ.+Plant+Growth+Reg
Glycosyltransferase - WikipediaGlycosyltransferase - Wikipedia
Glycosyltransferases (GTFs, Gtfs) are enzymes (EC 2.4) that establish natural glycosidic linkages. They catalyze the transfer of saccharide moieties from an activated nucleotide sugar (also known as the glycosyl donor) to a nucleophilic glycosyl acceptor molecule, the nucleophile of which can be oxygen- carbon-, nitrogen-, or sulfur-based. The result of glycosyl transfer can be a carbohydrate, glycoside, oligosaccharide, or a polysaccharide. Some glycosyltransferases catalyse transfer to inorganic phosphate or water. Glycosyl transfer can also occur to protein residues, usually to tyrosine, serine, or threonine to give O-linked glycoproteins, or to asparagine to give N-linked glycoproteins. Mannosyl groups may be transferred to tryptophan to generate C-mannosyl tryptophan, which is relatively abundant in eukaryotes. Transferases may also use lipids as an acceptor, forming glycolipids, and even use lipid-linked sugar phosphate donors, such as dolichol phosphates. Glycosyltransferases that use ...
https://en.wikipedia.org/wiki/Glycosyltransferase
Enzymatic Approaches to O-Glycoside Introduction: Glycosyltransferases<...
TY - CHAP. T1 - Enzymatic Approaches to O-Glycoside Introduction. T2 - Glycosyltransferases. AU - Chokhawala, H. A.. AU - Chen, Xi. PY - 2007/1/1. Y1 - 2007/1/1. UR - http://www.scopus.com/inward/record.url?scp=79951603384&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=79951603384&partnerID=8YFLogxK. U2 - 10.1016/B978-044451967-2/00012-X. DO - 10.1016/B978-044451967-2/00012-X. M3 - Chapter. AN - SCOPUS:79951603384. SN - 9780444519672. VL - 1-4. SP - 415. EP - 451. BT - Introduction to Glycoscience; Synthesis of Carbohydrates. PB - Elsevier. ER - ...
https://ucdavis.pure.elsevier.com/en/publications/enzymatic-approaches-to-o-glycoside-introduction-glycosyltransfer
glt25d2, glycosyltransferase 25 domain containing 2 - Creative Biogeneglt25d2, glycosyltransferase 25 domain containing 2 - Creative Biogene
GLT25D2; glycosyltransferase 25 domain containing 2; 16790; ENSG00000198756; C1orf17; 1q25; FLJ37771, FLJ37873, KIAA0584; procollagen galactosyltransferase 2; hydroxylysine galactosyltransferase 2; glycosyltransferase 25 family member 2; EC 2.4.1.50 ...
https://www.creative-biogene.com/symbolsearch_glt25d2.html
Fringe-like QuickView - Correlation Engine
The Notch receptor is a large, cell surface transmembrane protein involved in a wide variety of developmental processes in higher organisms. It becomes activated when its extracellular region binds to ligands located on adjacent cells. Much of this extracellular region is composed of EGF-like repeats, many of which can be O-fucosylated. A number of these O-fucosylated repeats can in turn be further modified by the action of a beta-1,3-N-acetylglucosaminyltransferase enzyme known as Fringe. Fringe potentiates the activation of Notch by Delta ligands, while inhibiting activation by Serrate/Jagged ligands. This regulation of Notch signalling by Fringe is important in many processes.Four distinct Fringe proteins have so far been studied in detail; Drosophila Fringe (Dfng) and its three mammalian homologues Lunatic Fringe (Lfng), Radical Fringe (Rfng) and Manic Fringe (Mfng). Dfng, Lfng and Rfng have all been shown to play important roles in developmental processes within their host, though the ...
https://accounts.public.ce.basespace.illumina.com/b/search/details/Fringe-like?id=5033372&type=biogroup
Glycosyltransferases - Transferases - Enzymes - ProductsGlycosyltransferases - Transferases - Enzymes - Products
Axon Medchem | Prime source supplier of high-value life science products, providing Axon Ligands™ for pharmaceutical research as world-wide recognized drug standards
https://www.axonmedchem.com/products/enzymes/transferases/glycosyltransferases
LFNG Gene - GeneCards | LFNG Protein | LFNG AntibodyLFNG Gene - GeneCards | LFNG Protein | LFNG Antibody
Complete information for LFNG gene (Protein Coding), LFNG O-Fucosylpeptide 3-Beta-N-Acetylglucosaminyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
https://www.genecards.org/cgi-bin/carddisp.pl?gene=LFNG&keywords=GH07J002445&prefilter=genomic_location
Have some lunatic fringe elements taken over the humanities?Have some lunatic fringe elements taken over the humanities?
Watch this video and answer the following question: Have the humanities gone mad? https://www.youtube.com/watch?v=vDT-Yj5n6zE
https://www.saddoboxing.com/boxingforum/90441-have-some-lunatic-fringe-elements-taken-over-humanities-3.html
Red Rider - Lunatic Fringe - Radio Paradise - eclectic commercial free Internet radioRed Rider - Lunatic Fringe - Radio Paradise - eclectic commercial free Internet radio
Modern & classic rock, electronica, world music & more - picked & mixed by real humans - highest quality sound with no subscription fees or ads.
https://legacy.radioparadise.com/rp3.php?song_id=30505
What is a contradiction in terms? Perhaps it is todays headline…. | Lunatic FringeWhat is a contradiction in terms? Perhaps it is todays headline…. | Lunatic Fringe
The mad gene hunt gets odder and odder. The headlines are more and more becoming fit fodder for late night television comedy. The Times of India had this to say. Childhood adversity ups genetic disorder risk You can imagine the faces of their collective readership registering shock and dismay. Are children really having that much…
https://lunatickfringe.wordpress.com/2012/02/29/what-is-a-contradiction-in-terms-perhaps-it-is-todays-headline/?replytocom=8032
Losi Adjustable Hinge Pin Brace Insert Set [LOSA1756] | Cars & Trucks - HobbyTownLosi Adjustable Hinge Pin Brace Insert Set [LOSA1756] | Cars & Trucks - HobbyTown
This is a replacement Losi Adjustable Hinge Pin Brace Insert Set, and is intended for use with the Losi 8ight 1/8 Scale Buggy and Truggy.  LOSA1756
https://www.hobbytown.com/losi-adjustable-hinge-pin-brace-insert-set-losa1756/p31499
Proteins matched: Glycosyl transferase family 10 (IPR001503) filtered by domain architecture | InterPro | EMBL-EBIProteins matched: Glycosyl transferase family 10 (IPR001503) filtered by domain architecture | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
http://www.ebi.ac.uk/interpro/entry/IPR001503/proteins-matched?ida=82987
KAKEN - Researchers | OHBA Norio (50010070)KAKEN - Researchers | OHBA Norio (50010070)
Affiliation：平成医療短期大学,リハビリテーション学科,教授, Research Field：Ophthalmology, Keywords：HTLV-I,PAX6,網膜変性,網膜色素変性症,Retina,Retinitis pigmentosa,HLA,加齢黄斑変性,Monoclinal antibody,Sugar transferases, # of Research Projects：9, # of Research Products：0
https://nrid.nii.ac.jp/nrid/1000050010070/
Lysosomal Storage DisordersLysosomal Storage Disorders
Glycosyltransferase (GT) enzymes are incredibly diverse in their abilities to catalyze the transfer of sugar molecules to protein, carbohydrate, and lipid substrates. GTs have various metabolic and regulatory roles in biology. Glycosyltransferase targets provide different areas of therapeutic potential in a wide array of disease, including cancer, metabolic disorders, and infectious disease. A glycosyltransferase ...
https://www.bellbrooklabs.com/tag/lysosomal-storage-disorders/
Centralized Modularity of N-Linked Glycosylation Pathways in Mammalian Cells - pdf descargar
Centralized Modularity of N-Linked Glycosylation Pathways in Mammalian Cells. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
http://libros.duhnnae.com/2017/jun7/149801969496-Centralized-Modularity-of-N-Linked-Glycosylation-Pathways-in-Mammalian-Cells.php
The Half Baked Lunatic | Sleep Aid Found To Be Useful For Extinguishing Forest FiresThe Half Baked Lunatic | Sleep Aid Found To Be Useful For Extinguishing Forest Fires
The Half Baked Lunatic - Bringing a little sanity to this crazy world - News, Politics, Religion, Science, Economics, and More! -
http://www.halfbakedlunatic.com/post/Sleep-Aid-Found-To-Be-Useful-For-Extinguishing-Forest-Fires
JoVE Author Search: Ono E
Arsenic, Copper, Iron, Cells, Gene, Virus, Donor, Flavonoids, Glucose, Glucuronic Acid, Glycosyltransferases, Guanidinium, Plant, Plants, Plays, Report, Role, Specificity, Udp, Udpga
http://labindex.jove.com/author/Ono-E
extl1, exostosin-like glycosyltransferase 1 - Creative Biogeneextl1, exostosin-like glycosyltransferase 1 - Creative Biogene
Creative Biogene offers challenging job opportunities for people looking for career growth in an entrepreneurial environment that recognizes individual contributions ...
https://www.creative-biogene.com/symbolsearch_extl1.html
GlycosyltransferaseGlycosyltransferase
Supplementary Materials10549_2017_4442_MOESM1_ESM. blotting, luciferase reporter assays, TUNEL assays, analysis of the gene, and ChIP assays. Results NSC35446.HCl inhibited proliferation and induced apoptosis in antiestrogen resistant LCC9, T47DCO, MCF-7/RR, and LY2 cells but not in ER-negative breast malignancy cell lines. (mRNA and protein expression in LCC9 cells. NSC35446.HCl also inhibited NF-B activity and expression of NF-B target genes. analysis of the promoter recognized nine estrogen response element (ERE) half-sites and one ERE-like full-site. ChIP assays revealed that ER was recruited to the ERE-like full-site and five from the nine half-sites which ER recruitment was inhibited by NSC35446.HCl in T47DCO and. ...
http://www.health-ground.com/category/glycosyltransferase/
fluorescent | PhD notebookfluorescent | PhD notebook
Washed antibody and started developing. Pax6 came up quite fast. I exchanged the solution after 1h and stopped after 2h. The remaining are slowly coming up, except asym and bilateral of engrailed. I used one tube of 0.8 ng/µL of probe and it must have been even lower concentration because the other 3 engrailed wells are coming up ok (same probe batch, but from another tube). Another issue is that there is not early gastrula like I wanted, they seem to be already have the differentiated lateral patches.. Lunatic fringe and runx are not showing up. I exchanged AP from all wells except engrailed after 3h and then all wells before leaving at 4 °C overnight.. ...
https://phd.organelas.com/tag/fluorescent/
Computational tools for Glycomics StudiesComputational tools for Glycomics Studies
Sugars are involved in almost every aspect of biology, from recognising pathogens and to blood clotting.The glycomes basic building blocks are far more numerous and varied than the four letters of the DNA alphabet or the score of amino acids that make proteins.In the late 1980s, when researchers isolated the first gene for a glycosyl transferase, an enzyme that adds sugars to fats and proteins. The discovery gave scientists the first opportunity to study this process, which is usually called glycoslyation, by manipulating the activity of such enzymes ...
http://bimatics.blogspot.com/2007/04/computational-tools-for-glycomics.html
Reasonably Well: ...I Am Hardly Sorry For Upending Thee..Reasonably Well: ...I Am Hardly Sorry For Upending Thee..
Say the Act of Contrition, I demanded before I even said good morning. Now, before you think Im a crazy lunatic you must know that tonight was her first reconciliation. A big night. So Im not a crazy lunatic, just a regular kind of fathery type lunatic whos been studying the Act of Contrition to the point where at night we all dream about how heartily sorry we all are. Just say the Act of Contrition, I said. One last time and Ill never ask again ...
http://www.reasonablywell.net/2011/03/so-this-is-not-catechism-class-type.html
Fringe 1×02 The Same Old Story: Reactions from a First Time Viewer | Pop Culture NexusFringe 1×02 The Same Old Story: Reactions from a First Time Viewer | Pop Culture Nexus
My Fringe journey continues! Sex talks, rapid aging, and Peter singing Row row row your boat made episode 2 quite enjoyable. Someone call Sigourney Weaver! This girl is gonna burst Alien style. Its the Fringe committee and they are talking about their new ragtag team (the best kind!). Ooh la la. Peter in his boxers.…
https://popculturenexus.com/2012/05/26/fringe-1x02-the-same-old-story-reactions-from-a-first-time-viewer/
Nelly - Ride Wit Me ft. St. Lunatics | PoGo PortalNelly - Ride Wit Me ft. St. Lunatics | PoGo Portal
All data and information provided on this site is for informational purposes only. pogoport.com makes no representations as to accuracy, completeness, currentness, suitability, or validity of any information on this site and will not be liable for any errors, omissions, or delays in this information or any losses, injuries, or damages arising from its display or use. All information is provided on an as-is basis ...
https://www.pogoport.com/nelly-ride-wit-me-ft-st-lunatics/
A4GNT antibody | acris-antibodies.com
A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched…
https://www.acris-antibodies.com/target/a4gnt-antibody.htm
A4GALT - SNPediaA4GALT - SNPedia
A4GALT encodes a type II membrane glycosyltransferase and results in Pk and P1 antigens of the P Non-ABO blood group along with B3GALNT1. ...
https://snpedia.com/index.php/A4GALT
Publications | ROSTLAB.ORGPublications | ROSTLAB.ORG
Ardiccioni C, Clarke OB, Tomasek D, Issa HA, von Alpen DC, Pond HL, Banerjee S, Rajashankar KR, Liu Q, Guan Z, et al. Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. Nat Commun. 2016 ;7:10175. ...
https://rostlab.org/research/publications?amp%3Bamp%3Bf%5Bauthor%5D=1409&%3Bf%5Bauthor%5D=1416&f%5Bauthor%5D=2015
Publications | ROSTLAB.ORGPublications | ROSTLAB.ORG
Ardiccioni C, Clarke OB, Tomasek D, Issa HA, von Alpen DC, Pond HL, Banerjee S, Rajashankar KR, Liu Q, Guan Z, et al. Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. Nat Commun. 2016 ;7:10175. ...
https://rostlab.org/research/publications?page=1&%3Bf%5Bauthor%5D=1106&f%5Bauthor%5D=1893
Fringe 3×06 6955 kHz: Reactions from a First Time Viewer | Pop Culture NexusFringe 3×06 6955 kHz: Reactions from a First Time Viewer | Pop Culture Nexus
Guys, Im ready for Olivia to come home. Things need to be set right in the blue universe. Peter is making AltLivia breakfast in bed and buying her U2 tickets. AltLivia is winning Walters heart with food and the Fringe team is being manipulated by Darth Vader Walternate. Things are falling apart and I dont…
https://popculturenexus.com/2012/10/24/fringe-3x06-6955-khz-reactions-from-a-first-time-viewer/
Sequence DetailSequence Detail
pep chromosome:GRCm38:5:140607320:140615545:1 gene:ENSMUSG00000029570 transcript:ENSMUST00000031555 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Lfng description:LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1095413 ...
http://www.informatics.jax.org/sequence/ENSMUSP00000031555
GlycosyltransferaseGlycosyltransferase
CAZypedia Glycosyltransferases CAZy Glycosyl Transferase Singh, S; Phillips GN, Jr; Thorson, JS (October 2012). "The structural ... a new glycosyltransferase fold was identified for the glycosyltransferases involved in the biosynthesis of the NAG-NAM polymer ... The combination of glycosyltransferases by both alleles present in each person determines whether there is an AB, A, B or O ... Some glycosyltransferase inhibitors are of use as drugs or antibiotics. Moenomycin is used in animal feed as a growth promoter ...
https://en.wikipedia.org/wiki/Glycosyltransferase
N-glycosyltransferaseN-glycosyltransferase
... including N-glycosyltransferases. N-glycosyltransferases are an unusual type of glycosyltransferase which joins single hexoses ... The N-glycosyltransferase is accompanied by another glycosyltransferase which attaches glucose to a protein-bound glycan, and ... Structurally N-glycosyltransferases belong to the GT41 family of glycosyltransferases and resemble protein O-GlcNAc transferase ... a pattern frequently observed in glycosyltransferases, and some N-glycosyltransferases can attach additional hexoses on oxygen ...
https://en.wikipedia.org/wiki/N-glycosyltransferase
Peptidoglycan glycosyltransferasePeptidoglycan glycosyltransferase
... (EC 2.4.1.129) is an enzyme used in the biosynthesis of peptidoglycan. It transfers a ... Yuan Y, Barrett D, Zhang Y, Kahne D, Sliz P, Walker S (March 2007). "Crystal structure of a peptidoglycan glycosyltransferase ... Peptidoglycan glycosyltransferase couples Lipid II subunits to synthesize the peptidoglycan chains. Transpeptidases crosslink ... This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ...
https://en.wikipedia.org/wiki/Peptidoglycan_glycosyltransferase
Glycosyltransferase DesVIIGlycosyltransferase DesVII
... (EC 2.4.1.277, DesVII) is an enzyme with systematic name dTDP-3-dimethylamino-3,4,6-trideoxy-alpha-D ... Glycosyltransferase+DesVII at the US National Library of Medicine Medical Subject Headings (MeSH) Portal: Biology (EC 2.4.1). ... Borisova SA, Liu HW (September 2010). "Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII ... 10-deoxymethymycin DesVII is the glycosyltransferase responsible for the attachment of TDP-D-desosamine to macrolactones of ...
https://en.wikipedia.org/wiki/Glycosyltransferase_DesVII
D-inositol-3-phosphate glycosyltransferaseD-inositol-3-phosphate glycosyltransferase
... (EC 2.4.1.250, mycothiol glycosyltransferases, MshA) is an enzyme with systematic ... Newton GL, Koledin T, Gorovitz B, Rawat M, Fahey RC, Av-Gay Y (June 2003). "The glycosyltransferase gene encoding the enzyme ... D-inositol-3-phosphate+glycosyltransferase at the US National Library of Medicine Medical Subject Headings (MeSH) Portal: ... name UDP-N-acetyl-D-glucosamine:1D-myo-inositol 3-phosphate alpha-D-glycosyltransferase. This enzyme catalyses the following ...
https://en.wikipedia.org/wiki/D-inositol-3-phosphate_glycosyltransferase
GALNT1GALNT1
2004). "Nuclear magnetic resonance-based dissection of a glycosyltransferase specificity for the mucin MUC1 tandem repeat". ... "Glycosyltransferases. Structure, localization, and control of cell type-specific glycosylation". J. Biol. Chem. 264 (30): 17615 ...
https://en.wikipedia.org/wiki/GALNT1
Procollagen glucosyltransferaseProcollagen glucosyltransferase
Kivirikko KI; Myllyla R (1979). Hall, D.A.; Jackson, D.S. (eds.). "Collagen Glycosyltransferases". International Review of ... This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ...
https://en.wikipedia.org/wiki/Procollagen_glucosyltransferase
Procollagen galactosyltransferaseProcollagen galactosyltransferase
Kivirikko KI; Myllyla R (1979). Hall, D.A.; Jackson, D.S. (eds.). "Collagen glycosyltransferases". International Review of ... This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ...
https://en.wikipedia.org/wiki/Procollagen_galactosyltransferase
PhycodnaviridaePhycodnaviridae
"Glycosyltransferases encoded by viruses". Journal of General Virology. 85 (10): 2741-2754. doi:10.1099/vir.0.80320-0. PMID ... and Golgi apparatus by host-encoded glycosyltransferases, PBCV-1 glycosylates its major capsid protein independently by ...
https://en.wikipedia.org/wiki/Phycodnaviridae
ABO (gene)ABO (gene)
Histo-blood group ABO system transferase is an enzyme with glycosyltransferase activity, which is encoded by the ABO gene in ... Remarkably, the difference between the A and B glycosyltransferase enzymes is only four amino acids. The O allele lacks both ... Nagai M, Davè V, Kaplan BE, Yoshida A (January 1978). "Human blood group glycosyltransferases. I. Purification of n- ... In human cells, the ABO alleles and their encoded glycosyltransferases have been described in several oncologic conditions. ...
https://en.wikipedia.org/wiki/ABO_(gene)
X8 protein domainX8 protein domain
Henrissat B, Davies GJ (December 2000). "Glycoside hydrolases and glycosyltransferases. Families, modules, and implications for ...
https://en.wikipedia.org/wiki/X8_protein_domain
MyrosinaseMyrosinase
Henrissat B, Davies GJ (December 2000). "Glycoside hydrolases and glycosyltransferases. Families, modules, and implications for ...
https://en.wikipedia.org/wiki/Myrosinase
Sucrose-phosphate synthaseSucrose-phosphate synthase
Breton C, Snajdrová L, Jeanneau C, Koca J, Imberty A (February 2006). "Structures and mechanisms of glycosyltransferases". ... This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ...
https://en.wikipedia.org/wiki/Sucrose-phosphate_synthase
XylanXylan
Several glycosyltransferases are involved in the biosynthesis of xylans. In eukaryotes, GTs represent about 1% to 2% of gene ... Lairson, L.L.; Henrissat, B.; Davies, G.J.; Withers, S.G. (2008-06-02). "Glycosyltransferases: Structures, Functions, and ... "Analysis of the Arabidopsis IRX9/IRX9-L and IRX14/IRX14-L Pairs of Glycosyltransferase Genes Reveals Critical Contributions to ...
https://en.wikipedia.org/wiki/Xylan
Nucleotide sugars metabolismNucleotide sugars metabolism
They are substrates for glycosyltransferases. The nucleotide sugars are also intermediates in nucleotide sugar interconversions ...
https://en.wikipedia.org/wiki/Nucleotide_sugars_metabolism
B4GALNT2B4GALNT2
Berger EG (Feb 2002). "Ectopic localizations of Golgi glycosyltransferases". Glycobiology. 12 (2): 29R-36R. doi:10.1093/glycob/ ...
https://en.wikipedia.org/wiki/B4GALNT2
AlleleAllele
Victor A. McKusick; Cassandra L. Kniffin; Paul J. Converse; Ada Hamosh (10 November 2009). "ABO Glycosyltransferase; ABO". ...
https://en.wikipedia.org/wiki/Allele
TransferaseTransferase
Glycosyltransferase is a subcategory of EC 2.4 transferases that is involved in biosynthesis of disaccharides and ... Both A and B transferases are glycosyltransferases, meaning they transfer a sugar molecule onto an H-antigen. This allows H- ... "Keyword Glycosyltransferase". UniProt. UniProt Consortium. Retrieved 26 November 2013. Fitzgerald DK, Brodbeck U, Kiyosawa I, ... An example of a prominent glycosyltransferase is lactose synthase which is a dimer possessing two protein subunits. Its primary ...
https://en.wikipedia.org/wiki/Transferase
Natural selectionNatural selection
McKusick, Victor A.; Gross, Matthew B. (18 November 2014). "ABO Glycosyltransferase; ABO". Online Mendelian Inheritance in Man ...
https://en.wikipedia.org/wiki/Natural_selection
Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferaseLactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this ... Percy AK, Gottfries J, Vilbergsson G, Mansson JE, Svennerholm L (1991). "Glycosphingolipid glycosyltransferases in human fetal ... "Glycolipids and glycosyltransferases in permanent cell lines established from human medulloblastomas". Biochim. Biophys. Acta. ...
https://en.wikipedia.org/wiki/Lactosylceramide_1,3-N-acetyl-beta-D-glucosaminyltransferase
UGGTUGGT
Handbook of Glycosyltransferases and Related Genes. Japan, Tokyo: Springer. pp. 15-30. doi:10.1007/978-4-431-54240-7_107. ISBN ...
https://en.wikipedia.org/wiki/UGGT
AvasimibeAvasimibe
"Repurposing Avasimibe to Inhibit Bacterial Glycosyltransferases". Pathogens. 11 (3). doi:10.3390/pathogens11030370. PMC 8953086 ...
https://en.wikipedia.org/wiki/Avasimibe
Gal operonGal operon
Williams, Gavin J.; Thorson, Jon S. (2009). Natural product glycosyltransferases: properties and applications. Advances in ...
https://en.wikipedia.org/wiki/Gal_operon
GlycolipidGlycolipid
Enzymes called glycosyltransferases link the saccharide to the lipid molecule, and also play a role in assembling the correct ... Williams GJ, Thorson JS (2009). "Natural product glycosyltransferases: properties and applications". Advances in Enzymology. ...
https://en.wikipedia.org/wiki/Glycolipid
Peripheral membrane proteinPeripheral membrane protein
"Pfam entry: Glycosyl transferases group 1". Archived from the original on 2007-09-29. Retrieved 2007-01-25. "Pfam entry: ... glycosyltransferase and transglycosidases), or proteins (signal peptidase and palmitoyl protein thioesterases). Lipases can ...
https://en.wikipedia.org/wiki/Peripheral_membrane_protein
Gideon DaviesGideon Davies
"An evolving hierarchical family classification for glycosyltransferases". Journal of Molecular Biology. 328 (2): 307-317. doi: ...
https://en.wikipedia.org/wiki/Gideon_Davies
Glycogen synthaseGlycogen synthase
It is a glycosyltransferase (EC 2.4.1.11) that catalyses the reaction of UDP-glucose and (1,4-α-D-glucosyl)n to yield UDP and ( ... such as glycogen phosphorylase and other glycosyltransferases of the GT-B superfamily. Nonetheless, a more recent ... "An evolving hierarchical family classification for glycosyltransferases". J. Mol. Biol. 328 (2): 307-17. doi:10.1016/S0022-2836 ...
https://en.wikipedia.org/wiki/Glycogen_synthase
CAZyCAZy
... contains 94 families of Glycosyl transferase enzymes, 22 families of polysaccharide lysases and 16 families of ... Included in the database are families of glycoside hydrolases, glycosyltransferases, polysaccharide lyases, carbohydrate ... Current statistics are available on each Glycoside Hydrolase, Glycosyltransferase, Polysaccharide Lyase, Carbohydrate Esterase ... "An evolving hierarchical family classification for glycosyltransferases". Journal of Molecular Biology. 328 (2): 307-317. doi: ...
https://en.wikipedia.org/wiki/CAZy
GDP-fucose protein O-fucosyltransferase 2GDP-fucose protein O-fucosyltransferase 2
Almost all glycosyltransferases reside in the Golgi apparatus. However, POFUT2 as well as the related enzyme POFUT1 have ... The protein is an inverting glycosyltransferase, which means that the enzyme uses GDP-β-L-fucose as a donor substrate and ...
https://en.wikipedia.org/wiki/GDP-fucose_protein_O-fucosyltransferase_2
N-acetyllactosamine synthaseN-acetyllactosamine synthase
Taniguchi N, Honke K, Fukuda M (2002). Handbook of glycosyltransferases and related genes (1st ed.). Springer. ISBN 443170311X ... "Intracellular localization of liver sugar nucleotide glycoprotein glycosyltransferases in a Golgi-rich fraction". The Journal ...
https://en.wikipedia.org/wiki/N-acetyllactosamine_synthase
British Library EThOS: Structure-based enzyme engineering of glycosyltransferasesBritish Library EThOS: Structure-based enzyme engineering of glycosyltransferases
Background: Plant UDP-dependent glycosyltransferases (UGTs) play important roles in biology via the glycosylation of secondary ...
https://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.756330
Extl3 MGI Mouse Gene Detail - MGI:1860765 - exostosin-like glycosyltransferase 3Extl3 MGI Mouse Gene Detail - MGI:1860765 - exostosin-like glycosyltransferase 3
View mouse Extl3 Chr14:65289509-65387304 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
http://www.informatics.jax.org/marker/MGI:1860765
SCOPe 2.08: Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylaseSCOPe 2.08: Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase
c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins). Glycosyltransferase family 28. *. c.87.1.6: Trehalose-6-phosphate ... Timeline for Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase: *Superfamily c.87.1: UDP-Glycosyltransferase/ ... c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins). Pfam PF00534. *. c.87.1.9: Sialyltransferase-like [142773] (2 ... Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase). *. c.87.1.12: O-GlcNAc transferase, OGT [254190] (1 protein) ...
http://scop.berkeley.edu/sunid=53756
RCSB PDB - 3H4T: Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-GlcRCSB PDB - 3H4T: Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc
Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc ... Glycosyltransferase GtfA, Glycosyltransferase. A. 404. Amycolatopsis orientalis, Actinoplanes teichomyceticus. This entity is ... Chimeric glycosyltransferases for the generation of hybrid glycopeptides. Truman, A.W., Dias, M.V.B., Wu, S., Blundell, T.L., ... Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc. *PDB DOI: ...
https://www.rcsb.org/structure/3H4T
Alternative donor substrates for inverting and retaining glycosyltransferases | UBC ChemistryAlternative donor substrates for inverting and retaining glycosyltransferases | UBC Chemistry
... glycosyltransferase were found to catalyse glycosylation reactions of natural acceptor substrates in the presence of the ...
https://www.chem.ubc.ca/alternative-donor-substrates-inverting-and-retaining-glycosyltransferases
Plus itPlus it
We also discovered that SidI possesses GDP-dependent glycosyltransferase activity and that this activity is regulated by ... regulates SidI-mediated translation inhibition and GDP-dependent glycosyltransferase activity. Ashley M. Joseph, Adrienne E. ... regulates SidI-mediated translation inhibition and GDP-dependent glycosyltransferase activity ... regulates SidI-mediated translation inhibition and GDP-dependent glycosyltransferase activity ...
https://www.biorxiv.org/content/10.1101/845313v1
Production of a Thermoactive Β-cyclodextrin Glycosyltransferase with a High Starch Hydrolytic Activity from an Alkalitolerant...Production of a Thermoactive Β-cyclodextrin Glycosyltransferase with a High Starch Hydrolytic Activity from an Alkalitolerant...
Production of a Thermoactive Β-cyclodextrin Glycosyltransferase with a High Starch Hydrolytic Activity from an Alkalitolerant ... Cyclodextrin Glycosyltransferase Production by the Bacillus sp., Subgroup alcalophilus using a Central Composite Design. ... Production of a Thermoactive Β-cyclodextrin Glycosyltransferase with a High Starch Hydrolytic Activity from an Alkalitolerant ... Production of a Thermoactive Β-cyclodextrin Glycosyltransferase with a High Starch Hydrolytic Activity from an Alkalitolerant ...
https://scialert.net/abstract/index.php?doi=ajbkr.2011.214.225
Structural modification of herboxidiene by substrate-flexible cytochrome P450 and glycosyltransferase<...Structural modification of herboxidiene by substrate-flexible cytochrome P450 and glycosyltransferase<...
Structural modification of herboxidiene by substrate-flexible cytochrome P450 and glycosyltransferase. Amit Kumar Jha, Dipesh ... Structural modification of herboxidiene by substrate-flexible cytochrome P450 and glycosyltransferase. / Jha, Amit Kumar ; ... Structural modification of herboxidiene by substrate-flexible cytochrome P450 and glycosyltransferase. Applied Microbiology and ... Structural modification of herboxidiene by substrate-flexible cytochrome P450 and glycosyltransferase. In: Applied Microbiology ...
https://experts.umn.edu/en/publications/structural-modification-of-herboxidiene-by-substrate-flexible-cyt
Characterization of PmHS2 glycosyltransferases for the controlled synthesis of heparosan : a precursor of heparin and heparan...
Characterization of PmHS2 glycosyltransferases for the controlled synthesis of heparosan : a precursor of heparin and heparan ...
https://research.wur.nl/en/publications/characterization-of-pmhs2-glycosyltransferases-for-the-controlled/projects/?status=FINISHED&ordering=statusStartDate&descending=true
The effect of inflammation on rat liver glycosidases and glycosyltransferasesThe effect of inflammation on rat liver glycosidases and glycosyltransferases
JavaScript is disabled for your browser. Some features of this site may not work without it ...
https://mspace.lib.umanitoba.ca/xmlui/handle/1993/14258
putative glycosyl transferase | NIH 3D Print Exchangeputative glycosyl transferase | NIH 3D Print Exchange
Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, putative glycosyl transferase, general stress ...
https://3dprint.nih.gov/discover/putative-glycosyl-transferase
Genetic and functional characterization of Sg-4 glycosyltransferase involved in the formation of sugar chain structure at the C...
Genetic and functional characterization of Sg-4 glycosyltransferase involved in the formation of sugar chain structure at the C ... This gene encodes a putative glycosyltransferase (UGT73P10) and is a homolog of GmSGT2 (UGT73P2) whose recombinant protein has ... Genetic and functional characterization of Sg-4 glycosyltransferase involved in the formation of sugar chain structure at the C ... Genetic and functional characterization of Sg-4 glycosyltransferase involved in the formation of sugar chain structure at the C ...
https://kyushu-u.pure.elsevier.com/en/publications/genetic-and-functional-characterization-of-sg-4-glycosyltransfera
Glycosyltransferases | Profiles RNS
"Glycosyltransferases" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical ... This graph shows the total number of publications written about "Glycosyltransferases" by people in this website by year, and ... Below are the most recent publications written about "Glycosyltransferases" by people in Profiles. ... whether "Glycosyltransferases" was a major or minor topic of these publications. To see the data from this visualization as ...
https://researchers.childrensmercy.org/display/18422
Glycosyltransferases Archives | Chemily GlycoscienceGlycosyltransferases Archives | Chemily Glycoscience
Plant secondary metabolism glycosyltransferases: the emerging functional analysis - Fingerprint - University of the...Plant secondary metabolism glycosyltransferases: the emerging functional analysis - Fingerprint - University of the...
Plant secondary metabolism glycosyltransferases: the emerging functional analysis. Claire Gachon, Mathilde Langlois-Meurinne, ... Dive into the research topics of Plant secondary metabolism glycosyltransferases: the emerging functional analysis. Together ...
https://pure.uhi.ac.uk/en/publications/plant-secondary-metabolism-glycosyltransferases-the-emerging-func/fingerprints/
IMSEAR at SEARO: Biosynthesis of eukaryotic cell surface glycosphingolipids using solubilized glycosyltransferases.
Biosynthesis of eukaryotic cell surface glycosphingolipids using solubilized glycosyltransferases.. Authors: Basu, Subash. De, ... Biosynthesis of eukaryotic cell surface glycosphingolipids using solubilized glycosyltransferases. Journal of Biosciences. 1985 ...
https://imsear.searo.who.int/handle/123456789/160406
Glycosyltransferase 18 family | canSARSGlycosyltransferase 18 family | canSARS
The Glycosyltransferase 18 family has 2 members , canSARS
https://corona-2.cansar.icr.ac.uk/protein-family/glycosyltransferase%2018%20family
Network Portal - Function Membrane glycosyltransferase
Membrane glycosyltransferase. id: COG2943. name: Membrane glycosyltransferase. namespace: cog. type: cog. obsolete: False. ...
http://networks.systemsbiology.net/function/38073
Cyclodextrin Glycosyltransferase complexed with Beta-Cyclodextrin | 3dcienciaCyclodextrin Glycosyltransferase complexed with Beta-Cyclodextrin | 3dciencia
Cyclodextrin glycosyltransferase (CGTase) is an important enzyme with multiple functions, in particular the production of ... Cyclodextrin Glycosyltransferase complexed with Beta-Cyclodextrin. Posted on February 18, 2014. February 19, 2014. by 3dciencia ... Cyclodextrin glycosyltransferase (CGTase) is an important enzyme with multiple functions, in particular the production of ...
https://3dciencia.wordpress.com/2014/02/18/cyclodextrin-glycosyltransferase-complexed-with-beta-cyclodextrin/
Contribution of UDP-glycosyltransferases to chlorpyrifos resistance in Nilaparvata lugens. | Pestic Biochem Physiol;190:...Contribution of UDP-glycosyltransferases to chlorpyrifos resistance in Nilaparvata lugens. | Pestic Biochem Physiol;190:...
Contribution of UDP-glycosyltransferases to chlorpyrifos resistance in Nilaparvata lugens. Contribution of UDP- ... As a multigene superfamily of Phase II detoxification enzymes, uridine diphosphate (UDP)-glycosyltransferases (UGTs) play ... glycosyltransferases to chlorpyrifos resistance in Nilaparvata lugens. Yang, Zhiming; Xiao, Tianxiang; Lu, Kai. Afiliación * ...
https://pesquisa.bvsalud.org/bolivia/resource/es/mdl-36740334
EOGT gene: MedlinePlus GeneticsEOGT gene: MedlinePlus Genetics
AER61 glycosyltransferase. *AOS4. *C3orf64. *EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase ...
https://medlineplus.gov/genetics/gene/eogt/
Table 1 - Rickettsia felis-associated Uneruptive Fever, Senegal - Volume 16, Number 7-July 2010 - Emerging Infectious Diseases...
Glycosyltransferase. TGC-TTC-ATG-GGC-AAT-GTC-TG. TTG-AGC-ATA-AAA-CTG-CCC-TGC-T. 6-FAM-CGC-TGG-ATT-ATC-AAA-AGA-ATT-AGC-ACG-TAMRA ...
https://wwwnc.cdc.gov/eid/content/16/7/1140-t1.htm
A universal glycoenzyme biosynthesis pipeline that enables efficient cell-free remodeling of glycansA universal glycoenzyme biosynthesis pipeline that enables efficient cell-free remodeling of glycans
Here, we describe a strategy for topologically converting membrane-bound glycosyltransferases (GTs) into water soluble ...
https://pubmed.ncbi.nlm.nih.gov/36280670/
Comamonas testosteronan synthase, a bifunctional glycosyltransferase that produces a unique heparosan polysaccharide analog
... ... Comamonas testosteronan synthase, a bifunctional glycosyltransferase that produces a unique heparosan polysaccharide analog, N ...
https://dspace.rpi.edu/handle/20.500.13015/5724
CAZy - Bacteria
Glycoside Hydrolases GlycosylTransferases Polysaccharide Lyases Carbohydrate Esterases Auxiliary Activities Carbohydrate- ...
http://www.cazy.org/b20715.html
Sucrose synthase: A unique glycosyltransferase for biocatalytic glycosylation process development - Fingerprint -...Sucrose synthase: A unique glycosyltransferase for biocatalytic glycosylation process development - Fingerprint -...
Sucrose synthase: A unique glycosyltransferase for biocatalytic glycosylation process development. Katharina Schmoelzer, ... Untersuchen Sie die Forschungsthemen von „Sucrose synthase: A unique glycosyltransferase for biocatalytic glycosylation process ...
https://graz.pure.elsevier.com/de/publications/sucrose-synthase-a-unique-glycosyltransferase-for-biocatalytic-gl/fingerprints/?sortBy=alphabetically
12-Hydroxyjasmonic acid glucoside causes leaf-folding of Samanea saman through ROS accumulation | Scientific Reports12-Hydroxyjasmonic acid glucoside causes leaf-folding of Samanea saman through ROS accumulation | Scientific Reports
Haroth, S. et al. The glycosyltransferase UGT76E1 significantly contributes to 12-O-glucopyranosyl-jasmonic acid formation in ...
https://www.nature.com/articles/s41598-022-11414-2?error=cookies_not_supported&code=9fb9c951-a3d3-493b-8a0b-a658744f5792
Frontiers | Metabolic Potential, Ecology and Presence of Associated Bacteria Is Reflected in Genomic Diversity of MucoromycotinaFrontiers | Metabolic Potential, Ecology and Presence of Associated Bacteria Is Reflected in Genomic Diversity of Mucoromycotina
GH, glycoside hydrolases; GT, glycosyltransferases; CMB, carbohydrate-binding modules; CE, carbohydrate esterase. ...
https://www.frontiersin.org/articles/10.3389/fmicb.2021.636986/full
Computational BiologyComputational Biology
Modularity of the hydrophobic core and evolution of functional diversity in fold A glycosyltransferases. Journal of Biological ... Here, we investigated the role of conserved hydrophobic cores in fold-A glycosyltransferases (GT-As), a large superfamily of ...
https://www.jbc.org/Computational-Biology?startPage=&Ppub=%5B20201124%20TO%2020221124%5D
IJMS | Special Issue : Carbohydrate-Active Enzymes: Structure, Activity and Reaction ProductsIJMS | Special Issue : Carbohydrate-Active Enzymes: Structure, Activity and Reaction Products
Forty glycosyltransferase (GT) family genes were identified from the complete genome, among which three genes (FQZ25_16345, ... A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for ... The application of Leloir glycosyltransferases has received considerable attention in recent years and offers excellent control ... With recent advances, LeLoir glycosyltransferases are close to being applied industrially in multi-enzyme, programmable cascade ...
https://www.mdpi.com/journal/ijms/special_issues/carbohydrate-active_enzymes
GlycosylationEnzymeProteinEncodesSuperfamilyCyclodextrin glycosyltransferaseGlycosideGeneSynthaseFamilyFunctionalBiosynthesisMembraneRepertoireAcceptorDescriptorResistanceDonorTypeSpecificShowsLeadsActivityGolgiTransferaseProteinsEnzymesInhibitorPeptidoglycan glycosyltransferase activitySubstrateBacterialPutativeInhibitorsCatalysisActivated sugar-nucleotide donorsMechanismsSynthesisCharacterizationGlycansMetabolismMolecular functionMechanismSugarsGlycoproteinsCatalyticCellsExpressionCompoundsFunction
Glycosylation3
  • Background: Plant UDP-dependent glycosyltransferases (UGTs) play important roles in biology via the glycosylation of secondary metabolites. (bl.uk)
  • By the use of glycosyl donors containing aromatic leaving groups linked with opposite anomeric configurations compared to those of the natural donor substrates, an inverting (Cst II) and a retaining (LgtC) glycosyltransferase were found to catalyse glycosylation reactions of natural acceptor substrates in the presence of the corresponding nucleotide. (ubc.ca)
  • Nucleotide sugars are the activated form of monosaccharides used by glycosyltransferases during glycosylation. (warwick.ac.uk)
Enzyme4
  • Cyclodextrin glycosyltransferase (CGTase) is an important enzyme with multiple functions, in particular the production of cyclodextrins. (wordpress.com)
  • For the configuration of A, B, and AB antigens, an additional alpha 1,3-N acetylgalactosaminyltransferase and/or glycosyltransferase enzyme is encoded to attach additional sugars to the "H" antigen. (medscape.com)
  • The similar activities of trypanosome TbGT10 and higher-eukaryote I-branching enzyme (EC 2.4.1.150), which belong to glycosyltransferase families GT67 and GT14, respectively, in elaborating N-linked glycans, are a novel example of convergent evolution. (dundee.ac.uk)
  • An ABO gene determines the blood type by encoding an enzyme glycosyltransferase, which modifies the carbohydrate (oligosaccharide) content of the red blood cell antigens. (cram.com)
Protein1
  • This gene encodes a putative glycosyltransferase (UGT73P10) and is a homolog of GmSGT2 (UGT73P2) whose recombinant protein has been previously shown, in vitro, to conjugate the second galactose moiety at the C-3 position of soyasapogenol B monoglucuronide (SBMG). (elsevier.com)
Encodes1
  • This gene encodes a member of glycosyltransferase family 29. (3billion.io)
Superfamily3
  • As a multigene superfamily of Phase II detoxification enzymes , uridine diphosphate ( UDP )- glycosyltransferases (UGTs) play important roles in the metabolism of xenobiotics including insecticides . (bvsalud.org)
  • Here, we investigated the role of conserved hydrophobic cores in fold-A glycosyltransferases (GT-As), a large superfamily of enzymes that catalyze formation of glycosidic linkages between diverse donor and acceptor substrates through distinct catalytic mechanisms (inverting versus retaining). (jbc.org)
  • Here, we probe the function(s) of the uncharacterized GT67 glycosyltransferase family and a β3 glycosyltransferase (β3GT) superfamily gene, TbGT10. (dundee.ac.uk)
Cyclodextrin glycosyltransferase2
  • The effects of different carbon, nitrogen and metal ion sources on the production of a β-cyclodextrin glycosyltransferase from a new alkalitolerant Bacillus licheniformis SK 13.002 strain were studied and effects of pH and temperature on the cyclization and hydrolysis activities assessed. (scialert.net)
  • Maltose binding site 2 mutations affect product inhibition of Bacilluscirculans stb01 cyclodextrin glycosyltransferase. (usda.gov)
Glycoside1
  • Carbohydrate-active enzymes are classified into glycoside hydrolases, glycosyltransferases, polysaccharide lyases, carbohydrate esterases, and enzymes with auxiliary activities (CAZy database, www.cazy.org). (mdpi.com)
Gene3
  • Suppression of UDP-glycosyltransferase-coding arabidopsis thaliana UGT74E2 gene expression leads to increased resistance to psuedomonas syringae pv. (elsevier.com)
  • PDF] The neomycin biosynthetic gene cluster of Streptomyces fradiae NCIMB 8233: genetic and biochemical evidence for the roles of two glycosyltransferases and a deacetylase. (semanticscholar.org)
  • The same subspecies exhibits expansion of its carbohydrate metabolism gene repertoire including the acquisition of a genomic island strongly enriched in glycosyltransferase genes involved in exopolysaccharide synthesis. (biomedcentral.com)
Synthase1
  • Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. (unl.edu)
Family1
  • The glycosyltransferase family 18 consists of alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferases. (embl.de)
Functional1
  • Here we report the production of functional chimeric glycosyltransferases by mixing and matching the N- and C-terminal domains of glycopeptide glycosyltransferases. (rcsb.org)
Biosynthesis2
  • IMSEAR at SEARO: Biosynthesis of eukaryotic cell surface glycosphingolipids using solubilized glycosyltransferases. (who.int)
  • This has allowed the in vivo analysis of the respective roles of the glycosyltransferases Neo8 and Neo15, and of the deacetylase Neo16 in neomycin biosynthesis. (semanticscholar.org)
Membrane1
  • Here, we describe a strategy for topologically converting membrane-bound glycosyltransferases (GTs) into water soluble biocatalysts, which are expressed at high levels in the cytoplasm of living cells with retention of biological activity. (nih.gov)
Repertoire2
  • The parasite's glycoconjugate repertoire suggests at least 38 glycosyltransferase (GT) activities, 16 of which are currently uncharacterized. (dundee.ac.uk)
  • The glycosyltransferase repertoire of the spikemoss Selaginella moellendorffii and a comparative study of its cell wall. (cell.com)
Acceptor1
  • Glycodiversification, an invaluable tool for generating biochemical diversity, can be catalyzed by glycosyltransferases, which attach activated sugar "donors" onto "acceptor" molecules. (rcsb.org)
Descriptor1
  • Glycosyltransferases" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (childrensmercy.org)
Resistance2
  • Contribution of UDP-glycosyltransferases to chlorpyrifos resistance in Nilaparvata lugens. (bvsalud.org)
  • Among them, member of uridin diphosphate (UDP)-glycosyltransferase (UGT) was of particular interest, since a UGT mutant (At1g05680) showed enhanced resistance to Pst-infection in Arabidopsis. (elsevier.com)
Donor1
  • The determination of the structure of a chimera in complex with a sugar donor analog shows that almost all sugar-glycosyltransferase binding interactions occur in the C-terminal domain. (rcsb.org)
Type2
  • phosphorylation of AlphaIIbBeta3 stimulates subunits and is to type glycosyltransferases, and specifically rickets( Philips et al. (erik-mill.de)
  • Glycosyltransferase B4GALNT1 and type 1 diabetes in Croatian population: clinical investigation. (cdc.gov)
Specific2
  • Ceramide-specific glycosyltransferase inhibitor. (tocris.com)
  • B4galnt2 is subject to long-term balancing selection in house mice, where two divergent allele classes direct alternative tissue-specific expression of a glycosyltransferase in the intestine versus blood vessels. (univie.ac.at)
Shows1
  • This graph shows the total number of publications written about "Glycosyltransferases" by people in this website by year, and whether "Glycosyltransferases" was a major or minor topic of these publications. (childrensmercy.org)
Leads1
  • It is discovered that the kanamycin biosynthetic pathway contains an early branch point, governed by the substrate promiscuity of a glycosyltransferase, that leads to the formation of two parallel pathways in which early intermediates are further modified. (semanticscholar.org)
Activity1
  • We also discovered that SidI possesses GDP-dependent glycosyltransferase activity and that this activity is regulated by Lpg2505. (biorxiv.org)
Golgi1
  • Their biosynthesis occurs through stepwise addition of carbohydrate residues from their nucleotide sugar donors to the growing glycan by a series of specific glycosyltransferases in the Golgi apparatus [ 3 , 4 ]. (hindawi.com)
Transferase2
  • Emerging paradigms for the initiation of mucin-type protein O-glycosylation by the polypeptide GalNAc transferase family of glycosyltransferases. (nih.gov)
  • O-GlcNAc Transferase (OGT) is a glycosyltransferase essential for the viability of most multicellular organisms, including mammals. (nih.gov)
Proteins5
  • We recommend the name 'UDP glycosyltransferase' because many of the proteins do not preferentially use UDP glucuronic acid, or their nucleotide sugar preference is unknown. (nih.gov)
  • Topics covered include: how to find and mine data generated by the CFG, how to find information about specific glycans, glycan-binding proteins (GBPs) and glycosyltransferases in the CFG Molecule Pages, and how to request CFG reagents (carbohydrates, mass spectrometry standards, enzymes and antibodies) and glycan array screening services. (functionalglycomics.org)
  • Assembly of discrete carbohydrate structures requires the coordinated activity of a repertoire of proteins, including glycosyltransferases and glycosidases. (pnas.org)
  • Once inside the chlorella, the virus DNA makes an enzyme called glycosyltransferase, which is needed to produce structural proteins that are assembled to create the outer shells, or capsids, for new virus particles. (phys.org)
  • To characterize these interactions, purified membrane proteins were assayed using different approaches including Microscale Thermophoresis and crosslink-pulldown experiments, analytical ultracentrifugation and glycosyltransferase and transpeptidase activity assays. (europa.eu)
Enzymes1
  • Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes. (nih.gov)
Inhibitor2
  • Moenomycin A, the well-known natural product inhibitor of peptidoglycan glycosyltransferase (PGT), is a large amphiphilic molecule of molecular mass of 1583 g/mol and its bioavailablity as a drug is relatively poor. (edu.hk)
  • In this Tutorial, learn how to use Transcreener ® HTS assays for direct detection of glycosyltransferases that use different sugar-nucleotide donors, how to measure enzyme activity and inhibitor dose responses for several GTs, including human fucosyltransferase, glucosylceramide synthase, galactose N-acetyltransferases, β1-4 galactosyltransferase, sialyltransferase and C. dificile Toxin B. (bellbrooklabs.com)
Peptidoglycan glycosyltransferase activity2
  • Link to all annotated objects annotated to peptidoglycan glycosyltransferase activity. (cyverse.org)
  • Link to all direct and indirect annotations to peptidoglycan glycosyltransferase activity. (cyverse.org)
Substrate4
  • Substrate-induced conformational changes in glycosyltransferases. (avemaria.edu)
  • I thought you might be interested in this item at http://www.worldcat.org/oclc/110328847 Title: Substrate-induced conformational changes in glycosyltransferases. (avemaria.edu)
  • Whilst the mechanism of inverting GTs is well-known, the catalytic process of retaining GTs is as yet unclear.Glycosyltransferase family 6 (GT6), according to the Carbohydrate Active Enzyme (CAZy) database, is a retaining GT family which catalyses the transfer of α-galactose (α-Gal) or α-N-acetyl-galactosamine (α-GalNAc) to the 3-OH group of a β-linked Gal or GalNAc in an acceptor substrate. (bath.ac.uk)
  • Substrate specificity of plant UDP-dependent glycosyltransferases predicted from crystal structures and homology modeling. (semanticscholar.org)
Bacterial1
  • The glycosyltransferase Maf is involved in bacterial flagella formation. (rcsb.org)
Putative1
  • This review describes all virally encoded glycosyltransferases and discusses their established or putative functions. (microbiologyresearch.org)
Inhibitors1
  • This Case Study shows how to develop an HTS workflow for glycosyltransferases (GTs) with an optimized Transcreener ® UDP 2 Assay (FP and TR-FRET formats), use the assay to measure GT activity and determine K m values, run a pilot screen for specific enzyme inhibitors on 8,000 compounds using Orthogonal Pooled Screening (OPS™) technology, and confirm, validate, and characterize hits. (bellbrooklabs.com)
Catalysis2
  • O-/N-/S-Specificity in Glycosyltransferase Catalysis: From Mechanistic Understanding to Engineering. (lbl.gov)
  • Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB and insights into the mechanism of catalysis. (rostlab.org)
Activated sugar-nucleotide donors1
  • Oligosaccharide chains of glycoproteins, glycolipids and glycosaminoglycans are synthesized by glycosyltransferases by the transfer of specific glycosyl moieties from activated sugar-nucleotide donors to specific acceptors. (avemaria.edu)
Mechanisms2
  • Glycosyltransferases: structures, functions, and mechanisms. (semanticscholar.org)
  • Learning the fundamental mechanisms for how this glycosyltransferase works may later enable scientists to develop drugs that inhibit certain viral infections, Zhang said. (phys.org)
Synthesis1
  • A Processive Glycosyltransferase Involved in Glycolipid Synthesis during Phosphate Deprivation in Mesorhizobium loti. (mpg.de)
Characterization1
  • A glycan array-based assay for the identification and characterization of plant glycosyltransferases. (mpg.de)
Glycans1
  • A focus on the glycobiology of cancer thus offers the possibility of revealing both new diagnostic biomarkers, and therapeutic targets (glycosyltransferases, cancer-associated glycans). (nih.gov)
Metabolism1
  • UDP-Glycosyltransferase 3A Metabolism of Polycyclic Aromatic Hydrocarbons: Potential Importance in Aerodigestive Tract Tissues. (nih.gov)
Molecular function1
  • We illustrate the effectiveness of our approach by answering a real-world biomedical query linking a specific molecular function, glycosyltransferase, to the disorder congenital muscular dystrophy. (nih.gov)
Mechanism1
  • A Native Ternary Complex Trapped in a Crystal Reveals the Catalytic Mechanism of a Retaining Glycosyltransferase. (irbbarcelona.org)
Sugars2
  • Glycosyltransferases catalyze the transfer of sugars to produce extremely structurally diverse glycosaminoglycans. (nih.gov)
  • The invention exploits the reversibility of glycosyltransferases to generate new sugars, unnatural biomol. (warf.org)
Glycoproteins1
  • Optimized methods for globally surveying the response of individual glycoproteins to genetic alterations in glycosyltransferase expression were developed to aid in these evaluations. (caltech.edu)
Catalytic1
  • Moreover, the high flexibility of the enzyme conformation when it interacts with the ligands provides a general picture of how the enzyme processes UDP-GalNAc.Together, these structures illustrate how a significant divergence in catalytic properties can be accommodated by minor structural adjustments, and propose a role for the NXN motif, which replaces the DXD motif in the metal independent glycosyltransferases. (bath.ac.uk)
Cells2
  • Restricted replication of two alphaviruses in ricin-resistant mouse L cells with altered glycosyltransferase activities. (wustl.edu)
  • Dive into the research topics of 'Restricted replication of two alphaviruses in ricin-resistant mouse L cells with altered glycosyltransferase activities. (wustl.edu)
Expression2
  • Viruses reach that goal either by regulating expression of host glycosyltransferases or by expressing their own glycosyltransferases. (microbiologyresearch.org)
  • Other transgenic pig strains express different glycosyltransferases which compete with alpha-1,3- galactosyltransferase, the enzyme that generates the gal epitope, to decrease the gal antigen expression. (nih.gov)
Compounds1
  • The present invention relates to methods of use of glycosyltransferases and related compounds. (warf.org)
Function1
  • The Pharmacogenetics Group also investigates the structure and function of glycosyltransferases. (nih.gov)
EOGT gene: MedlinePlus Genetics
EOGT gene: MedlinePlus Genetics (medlineplus.gov)
12-Hydroxyjasmonic acid glucoside causes leaf-folding of Samanea saman through ROS accumulation | Scientific Reports
12-Hydroxyjasmonic acid glucoside causes leaf-folding of Samanea saman through ROS accumulation | Scientific Reports (nature.com)
IJMS | Special Issue : Carbohydrate-Active Enzymes: Structure, Activity and Reaction Products
IJMS | Special Issue : Carbohydrate-Active Enzymes: Structure, Activity and Reaction Products (mdpi.com)
ABO Grouping: Overview, Clinical Indications/Applications, Test Performance
ABO Grouping: Overview, Clinical Indications/Applications, Test Performance (medscape.com)
Materials | Free Full-Text | Gene Expression, Bacteria Viability and Survivability Following Spray Drying of Mycobacterium...
Materials | Free Full-Text | Gene Expression, Bacteria Viability and Survivability Following Spray Drying of Mycobacterium... (mdpi.com)
Limb-Girdle Muscular Dystrophy Clinical Presentation: History, Causes
Limb-Girdle Muscular Dystrophy Clinical Presentation: History, Causes (medscape.com)
Peters plus syndrome: MedlinePlus Genetics
Peters plus syndrome: MedlinePlus Genetics (medlineplus.gov)
Limb-Girdle Muscular Dystrophy Clinical Presentation: History, Causes
Limb-Girdle Muscular Dystrophy Clinical Presentation: History, Causes (emedicine.medscape.com)
Metabolic compensation of steroidal glycoalkaloid biosynthesis in transgenic potato tubers: using reverse genetics to confirm...
Metabolic compensation of steroidal glycoalkaloid biosynthesis in transgenic potato tubers: using reverse genetics to confirm... (hutton.ac.uk)
Plus it
Plus it (biorxiv.org)
Molecules | Free Full-Text | Optimization of Regioselective α-Glucosylation of Hesperetin Catalyzed by Cyclodextrin...
Molecules | Free Full-Text | Optimization of Regioselective α-Glucosylation of Hesperetin Catalyzed by Cyclodextrin... (mdpi.com)
SGN Unigene - Show All Stored BLAST Hits - Sol Genomics Network
SGN Unigene - Show All Stored BLAST Hits - Sol Genomics Network (sgn.cornell.edu)
Unraveling the early molecular and physiological mechanisms involved in response to phenanthrene exposure | BMC Genomics | Full...
Unraveling the early molecular and physiological mechanisms involved in response to phenanthrene exposure | BMC Genomics | Full... (bmcgenomics.biomedcentral.com)
Frontiers | An Overview of Sucrose Synthases in Plants
Frontiers | An Overview of Sucrose Synthases in Plants (frontiersin.org)
Cellular glucuronidation - Ontology Report - Rat Genome Database
Cellular glucuronidation - Ontology Report - Rat Genome Database (rgd.mcw.edu)
PDF] The neomycin biosynthetic gene cluster of Streptomyces fradiae NCIMB 8233: genetic and biochemical evidence for the roles...
PDF] The neomycin biosynthetic gene cluster of Streptomyces fradiae NCIMB 8233: genetic and biochemical evidence for the roles... (semanticscholar.org)
IJMS | Free Full-Text | Glutathione Plays a Positive Role in the Proliferation of Pinus koraiensis Embryogenic Cells
IJMS | Free Full-Text | Glutathione Plays a Positive Role in the Proliferation of Pinus koraiensis Embryogenic Cells (mdpi.com)
Glycomics/ Glycobiology Market Size and Forecast 2025
Glycomics/ Glycobiology Market Size and Forecast 2025 (credenceresearch.com)
Analysis of 1321 Eubacterium rectale genomes from metagenomes uncovers complex phylogeographic population structure and...
Analysis of 1321 Eubacterium rectale genomes from metagenomes uncovers complex phylogeographic population structure and... (genomebiology.biomedcentral.com)
SCOPe 2.08: Domain d1v3ja3: 1v3j A:407-496
SCOPe 2.08: Domain d1v3ja3: 1v3j A:407-496 (scop.berkeley.edu)
SCOPe 2.08: Domain d1v3ja4: 1v3j A:1-406
SCOPe 2.08: Domain d1v3ja4: 1v3j A:1-406 (scop.berkeley.edu)
Information on EC 4.1.1.50 - adenosylmethionine decarboxylase - BRENDA Enzyme Database
Information on EC 4.1.1.50 - adenosylmethionine decarboxylase - BRENDA Enzyme Database (brenda-enzymes.org)
Congenital Muscular Dystrophy Clinical Presentation: History, Causes, Clinical Aspects
Congenital Muscular Dystrophy Clinical Presentation: History, Causes, Clinical Aspects (medscape.com)