A 29-amino acid pancreatic peptide derived from proglucagon which is also the precursor of intestinal GLUCAGON-LIKE PEPTIDES. Glucagon is secreted by PANCREATIC ALPHA CELLS and plays an important role in regulation of BLOOD GLUCOSE concentration, ketone metabolism, and several other biochemical and physiological processes. (From Gilman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 9th ed, p1511)
A peptide of 36 or 37 amino acids that is derived from PROGLUCAGON and mainly produced by the INTESTINAL L CELLS. GLP-1(1-37 or 1-36) is further N-terminally truncated resulting in GLP-1(7-37) or GLP-1-(7-36) which can be amidated. These GLP-1 peptides are known to enhance glucose-dependent INSULIN release, suppress GLUCAGON release and gastric emptying, lower BLOOD GLUCOSE, and reduce food intake.
Cell surface receptors that bind glucagon with high affinity and trigger intracellular changes which influence the behavior of cells. Activation of glucagon receptors causes a variety of effects; the best understood is the initiation of a complex enzymatic cascade in the liver which ultimately increases the availability of glucose to body organs.
A 27-amino acid peptide with histidine at the N-terminal and isoleucine amide at the C-terminal. The exact amino acid composition of the peptide is species dependent. The peptide is secreted in the intestine, but is found in the nervous system, many organs, and in the majority of peripheral tissues. It has a wide range of biological actions, affecting the cardiovascular, gastrointestinal, respiratory, and central nervous systems.
Poisonous animal secretions forming fluid mixtures of many different enzymes, toxins, and other substances. These substances are produced in specialized glands and secreted through specialized delivery systems (nematocysts, spines, fangs, etc.) for disabling prey or predator.
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
A tetradecapeptide originally obtained from the skins of toads Bombina bombina and B. variegata. It is also an endogenous neurotransmitter in many animals including mammals. Bombesin affects vascular and other smooth muscle, gastric secretion, and renal circulation and function.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
A collection of cloned peptides, or chemically synthesized peptides, frequently consisting of all possible combinations of amino acids making up an n-amino acid peptide.
A type of pancreatic cell representing about 5-20% of the islet cells. Alpha cells secrete GLUCAGON.
Small cationic peptides that are an important component, in most species, of early innate and induced defenses against invading microbes. In animals they are found on mucosal surfaces, within phagocytic granules, and on the surface of the body. They are also found in insects and plants. Among others, this group includes the DEFENSINS, protegrins, tachyplesins, and thionins. They displace DIVALENT CATIONS from phosphate groups of MEMBRANE LIPIDS leading to disruption of the membrane.
A 51-amino acid pancreatic hormone that plays a major role in the regulation of glucose metabolism, directly by suppressing endogenous glucose production (GLYCOGENOLYSIS; GLUCONEOGENESIS) and indirectly by suppressing GLUCAGON secretion and LIPOLYSIS. Native insulin is a globular protein comprised of a zinc-coordinated hexamer. Each insulin monomer containing two chains, A (21 residues) and B (30 residues), linked by two disulfide bonds. Insulin is used as a drug to control insulin-dependent diabetes mellitus (DIABETES MELLITUS, TYPE 1).
Peptides whose amino and carboxy ends are linked together with a peptide bond forming a circular chain. Some of them are ANTI-INFECTIVE AGENTS. Some of them are biosynthesized non-ribosomally (PEPTIDE BIOSYNTHESIS, NON-RIBOSOMAL).
Analysis of PEPTIDES that are generated from the digestion or fragmentation of a protein or mixture of PROTEINS, by ELECTROPHORESIS; CHROMATOGRAPHY; or MASS SPECTROMETRY. The resulting peptide fingerprints are analyzed for a variety of purposes including the identification of the proteins in a sample, GENETIC POLYMORPHISMS, patterns of gene expression, and patterns diagnostic for diseases.
Peptides composed of between two and twelve amino acids.
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
A 14-amino acid peptide named for its ability to inhibit pituitary GROWTH HORMONE release, also called somatotropin release-inhibiting factor. It is expressed in the central and peripheral nervous systems, the gut, and other organs. SRIF can also inhibit the release of THYROID-STIMULATING HORMONE; PROLACTIN; INSULIN; and GLUCAGON besides acting as a neurotransmitter and neuromodulator. In a number of species including humans, there is an additional form of somatostatin, SRIF-28 with a 14-amino acid extension at the N-terminal.
Peptides derived from proglucagon which is also the precursor of pancreatic GLUCAGON. Despite expression of proglucagon in multiple tissues, the major production site of glucagon-like peptides (GLPs) is the INTESTINAL L CELLS. GLPs include glucagon-like peptide 1, glucagon-like peptide 2, and the various truncated forms.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Irregular microscopic structures consisting of cords of endocrine cells that are scattered throughout the PANCREAS among the exocrine acini. Each islet is surrounded by connective tissue fibers and penetrated by a network of capillaries. There are four major cell types. The most abundant beta cells (50-80%) secrete INSULIN. Alpha cells (5-20%) secrete GLUCAGON. PP cells (10-35%) secrete PANCREATIC POLYPEPTIDE. Delta cells (~5%) secrete SOMATOSTATIN.
Glucose in blood.
A highly basic, 28 amino acid neuropeptide released from intestinal mucosa. It has a wide range of biological actions affecting the cardiovascular, gastrointestinal, and respiratory systems and is neuroprotective. It binds special receptors (RECEPTORS, VASOACTIVE INTESTINAL PEPTIDE).
The common precursor polypeptide of pancreatic GLUCAGON and intestinal GLUCAGON-LIKE PEPTIDES. Proglucagon is the 158-amino acid segment of preproglucagon without the N-terminal signal sequence. Proglucagon is expressed in the PANCREAS; INTESTINES; and the CENTRAL NERVOUS SYSTEM. Posttranslational processing of proglucagon is tissue-specific yielding numerous bioactive peptides.
The rate dynamics in chemical or physical systems.
A PEPTIDE that is secreted by the BRAIN and the HEART ATRIA, stored mainly in cardiac ventricular MYOCARDIUM. It can cause NATRIURESIS; DIURESIS; VASODILATION; and inhibits secretion of RENIN and ALDOSTERONE. It improves heart function. It contains 32 AMINO ACIDS.
A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
A syndrome of abnormally low BLOOD GLUCOSE level. Clinical hypoglycemia has diverse etiologies. Severe hypoglycemia eventually lead to glucose deprivation of the CENTRAL NERVOUS SYSTEM resulting in HUNGER; SWEATING; PARESTHESIA; impaired mental function; SEIZURES; COMA; and even DEATH.
Biosynthesis of GLUCOSE from nonhexose or non-carbohydrate precursors, such as LACTATE; PYRUVATE; ALANINE; and GLYCEROL.
A 36-amino acid pancreatic hormone that is secreted mainly by endocrine cells found at the periphery of the ISLETS OF LANGERHANS and adjacent to cells containing SOMATOSTATIN and GLUCAGON. Pancreatic polypeptide (PP), when administered peripherally, can suppress gastric secretion, gastric emptying, pancreatic enzyme secretion, and appetite. A lack of pancreatic polypeptide (PP) has been associated with OBESITY in rats and mice.
A nodular organ in the ABDOMEN that contains a mixture of ENDOCRINE GLANDS and EXOCRINE GLANDS. The small endocrine portion consists of the ISLETS OF LANGERHANS secreting a number of hormones into the blood stream. The large exocrine portion (EXOCRINE PANCREAS) is a compound acinar gland that secretes several digestive enzymes into the pancreatic ductal system that empties into the DUODENUM.
Peptide hormones secreted into the blood by cells in the ISLETS OF LANGERHANS of the pancreas. The alpha cells secrete glucagon; the beta cells secrete insulin; the delta cells secrete somatostatin; and the PP cells secrete pancreatic polypeptide.
A 36-amino acid peptide produced by the L cells of the distal small intestine and colon. Peptide YY inhibits gastric and pancreatic secretion.
Calcitonin gene-related peptide. A 37-amino acid peptide derived from the calcitonin gene. It occurs as a result of alternative processing of mRNA from the calcitonin gene. The neuropeptide is widely distributed in neural tissue of the brain, gut, perivascular nerves, and other tissue. The peptide produces multiple biological effects and has both circulatory and neurotransmitter modes of action. In particular, it is a potent endogenous vasodilator.
Organic compounds that generally contain an amino (-NH2) and a carboxyl (-COOH) group. Twenty alpha-amino acids are the subunits which are polymerized to form proteins.
Protein precursors, also known as proproteins or prohormones, are inactive forms of proteins that undergo post-translational modification, such as cleavage, to produce the active functional protein or peptide hormone.
The production of PEPTIDES or PROTEINS by the constituents of a living organism. The biosynthesis of proteins on RIBOSOMES following an RNA template is termed translation (TRANSLATION, GENETIC). There are other, non-ribosomal peptide biosynthesis (PEPTIDE BIOSYNTHESIS, NUCLEIC ACID-INDEPENDENT) mechanisms carried out by PEPTIDE SYNTHASES and PEPTIDYLTRANSFERASES. Further modifications of peptide chains yield functional peptide and protein molecules.
Peptides that have the ability to enter cells by crossing the plasma membrane directly, or through uptake by the endocytotic pathway.
Genetically identical individuals developed from brother and sister matings which have been carried out for twenty or more generations or by parent x offspring matings carried out with certain restrictions. This also includes animals with a long history of closed colony breeding.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
The parts of a macromolecule that directly participate in its specific combination with another molecule.
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
An adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH.
Established cell cultures that have the potential to propagate indefinitely.
DNA analogs containing neutral amide backbone linkages composed of aminoethyl glycine units instead of the usual phosphodiester linkage of deoxyribose groups. Peptide nucleic acids have high biological stability and higher affinity for complementary DNA or RNA sequences than analogous DNA oligomers.
The active sympathomimetic hormone from the ADRENAL MEDULLA. It stimulates both the alpha- and beta- adrenergic systems, causes systemic VASOCONSTRICTION and gastrointestinal relaxation, stimulates the HEART, and dilates BRONCHI and cerebral vessels. It is used in ASTHMA and CARDIAC FAILURE and to delay absorption of local ANESTHETICS.
Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.
Cell surface proteins that bind gastrointestinal hormones with high affinity and trigger intracellular changes influencing the behavior of cells. Most gastrointestinal hormones also act as neurotransmitters so these receptors are also present in the central and peripheral nervous systems.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
A PEPTIDE of 22 amino acids, derived mainly from cells of VASCULAR ENDOTHELIUM. It is also found in the BRAIN, major endocrine glands, and other tissues. It shares structural homology with ATRIAL NATRIURETIC FACTOR. It has vasorelaxant activity thus is important in the regulation of vascular tone and blood flow. Several high molecular weight forms containing the 22 amino acids have been identified.
The level of protein structure in which regular hydrogen-bond interactions within contiguous stretches of polypeptide chain give rise to alpha helices, beta strands (which align to form beta sheets) or other types of coils. This is the first folding level of protein conformation.
The relationship between the chemical structure of a compound and its biological or pharmacological activity. Compounds are often classed together because they have structural characteristics in common including shape, size, stereochemical arrangement, and distribution of functional groups.
Peptides that regulate the WATER-ELECTROLYTE BALANCE in the body, also known as natriuretic peptide hormones. Several have been sequenced (ATRIAL NATRIURETIC FACTOR; BRAIN NATRIURETIC PEPTIDE; C-TYPE NATRIURETIC PEPTIDE).
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Hydrolases that specifically cleave the peptide bonds found in PROTEINS and PEPTIDES. Examples of sub-subclasses for this group include EXOPEPTIDASES and ENDOPEPTIDASES.
Neuropeptide and gut hormone that helps regulate GASTRIC ACID secretion and motor function. Once released from nerves in the antrum of the STOMACH, the neuropeptide stimulates release of GASTRIN from the GASTRIN-SECRETING CELLS.
Sites on an antigen that interact with specific antibodies.
An enzyme of the lyase class that catalyzes the formation of CYCLIC AMP and pyrophosphate from ATP. EC 4.6.1.1.
A family of G-protein-coupled receptors that was originally identified by its ability to bind N-formyl peptides such as N-FORMYLMETHIONINE LEUCYL-PHENYLALANINE. Since N-formyl peptides are found in MITOCHONDRIA and BACTERIA, this class of receptors is believed to play a role in mediating cellular responses to cellular damage and bacterial invasion. However, non-formylated peptide ligands have also been found for this receptor class.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
The domestic dog, Canis familiaris, comprising about 400 breeds, of the carnivore family CANIDAE. They are worldwide in distribution and live in association with people. (Walker's Mammals of the World, 5th ed, p1065)
HORMONES secreted by the gastrointestinal mucosa that affect the timing or the quality of secretion of digestive enzymes, and regulate the motor activity of the digestive system organs.
Ligases that catalyze the joining of adjacent AMINO ACIDS by the formation of carbon-nitrogen bonds between their carboxylic acid groups and amine groups.
Cell surface receptors that bind peptide messengers with high affinity and regulate intracellular signals which influence the behavior of cells.
An analytical method used in determining the identity of a chemical based on its mass using mass analyzers/mass spectrometers.
Glycogen stored in the liver. (Dorland, 28th ed)
A serine endopeptidase that is formed from TRYPSINOGEN in the pancreas. It is converted into its active form by ENTEROPEPTIDASE in the small intestine. It catalyzes hydrolysis of the carboxyl group of either arginine or lysine. EC 3.4.21.4.
A potent natriuretic and vasodilatory peptide or mixture of different-sized low molecular weight PEPTIDES derived from a common precursor and secreted mainly by the HEART ATRIUM. All these peptides share a sequence of about 20 AMINO ACIDS.
The relationship between the dose of an administered drug and the response of the organism to the drug.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Proteins prepared by recombinant DNA technology.
An essential amino acid that is physiologically active in the L-form.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Hormones synthesized from amino acids. They are distinguished from INTERCELLULAR SIGNALING PEPTIDES AND PROTEINS in that their actions are systemic.
The interaction of two or more substrates or ligands with the same binding site. The displacement of one by the other is used in quantitative and selective affinity measurements.
Chemical substances having a specific regulatory effect on the activity of a certain organ or organs. The term was originally applied to substances secreted by various ENDOCRINE GLANDS and transported in the bloodstream to the target organs. It is sometimes extended to include those substances that are not produced by the endocrine glands but that have similar effects.
Classic quantitative assay for detection of antigen-antibody reactions using a radioactively labeled substance (radioligand) either directly or indirectly to measure the binding of the unlabeled substance to a specific antibody or other receptor system. Non-immunogenic substances (e.g., haptens) can be measured if coupled to larger carrier proteins (e.g., bovine gamma-globulin or human serum albumin) capable of inducing antibody formation.
A peptide hormone of about 27 amino acids from the duodenal mucosa that activates pancreatic secretion and lowers the blood sugar level. (USAN and the USP Dictionary of Drug Names, 1994, p597)
Elements of limited time intervals, contributing to particular results or situations.
Domesticated bovine animals of the genus Bos, usually kept on a farm or ranch and used for the production of meat or dairy products or for heavy labor.
The sum of the weight of all the atoms in a molecule.
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
Abstaining from all food.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Cell surface proteins that bind VASOACTIVE INTESTINAL PEPTIDE; (VIP); with high affinity and trigger intracellular changes which influence the behavior of cells.
Proteins and peptides that are involved in SIGNAL TRANSDUCTION within the cell. Included here are peptides and proteins that regulate the activity of TRANSCRIPTION FACTORS and cellular processes in response to signals from CELL SURFACE RECEPTORS. Intracellular signaling peptide and proteins may be part of an enzymatic signaling cascade or act through binding to and modifying the action of other signaling factors.
The middle segment of proinsulin that is between the N-terminal B-chain and the C-terminal A-chain. It is a pancreatic peptide of about 31 residues, depending on the species. Upon proteolytic cleavage of proinsulin, equimolar INSULIN and C-peptide are released. C-peptide immunoassay has been used to assess pancreatic beta cell function in diabetic patients with circulating insulin antibodies or exogenous insulin. Half-life of C-peptide is 30 min, almost 8 times that of insulin.
The endogenous peptides with opiate-like activity. The three major classes currently recognized are the ENKEPHALINS, the DYNORPHINS, and the ENDORPHINS. Each of these families derives from different precursors, proenkephalin, prodynorphin, and PRO-OPIOMELANOCORTIN, respectively. There are also at least three classes of OPIOID RECEPTORS, but the peptide families do not map to the receptors in a simple way.
A 37-amino acid peptide derived from the C-terminal of GLICENTIN. It is mainly produced by the INTESTINAL L CELLS. Oxyntomodulin can reduce digestive secretions, delay gastric emptying, and reduced food intake.
Electrophoresis in which a polyacrylamide gel is used as the diffusion medium.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
A mass spectrometric technique that is used for the analysis of large biomolecules. Analyte molecules are embedded in an excess matrix of small organic molecules that show a high resonant absorption at the laser wavelength used. The matrix absorbs the laser energy, thus inducing a soft disintegration of the sample-matrix mixture into free (gas phase) matrix and analyte molecules and molecular ions. In general, only molecular ions of the analyte molecules are produced, and almost no fragmentation occurs. This makes the method well suited for molecular weight determinations and mixture analysis.
The structure of one molecule that imitates or simulates the structure of a different molecule.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
A basic element found in nearly all organized tissues. It is a member of the alkaline earth family of metals with the atomic symbol Ca, atomic number 20, and atomic weight 40. Calcium is the most abundant mineral in the body and combines with phosphorus to form calcium phosphate in the bones and teeth. It is essential for the normal functioning of nerves and muscles and plays a role in blood coagulation (as factor IV) and in many enzymatic processes.
A gastrointestinal peptide hormone of about 43-amino acids. It is found to be a potent stimulator of INSULIN secretion and a relatively poor inhibitor of GASTRIC ACID secretion.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
A benign tumor of the pancreatic ISLET CELLS. Usually it involves the INSULIN-producing PANCREATIC BETA CELLS, as in INSULINOMA, resulting in HYPERINSULINISM.
A cyclic nucleotide derivative that mimics the action of endogenous CYCLIC AMP and is capable of permeating the cell membrane. It has vasodilator properties and is used as a cardiac stimulant. (From Merck Index, 11th ed)
Inbred C57BL mice are a strain of laboratory mice that have been produced by many generations of brother-sister matings, resulting in a high degree of genetic uniformity and homozygosity, making them widely used for biomedical research, including studies on genetics, immunology, cancer, and neuroscience.
The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.
Spectroscopic method of measuring the magnetic moment of elementary particles such as atomic nuclei, protons or electrons. It is employed in clinical applications such as NMR Tomography (MAGNETIC RESONANCE IMAGING).
A 33-amino acid peptide derived from the C-terminal of PROGLUCAGON and mainly produced by the INTESTINAL L CELLS. It stimulates intestinal mucosal growth and decreased apoptosis of ENTEROCYTES. GLP-2 enhances gastrointestinal function and plays an important role in nutrient homeostasis.
Abnormally high BLOOD GLUCOSE level.
Treatment process involving the injection of fluid into an organ or tissue.
Antidiuretic hormones released by the NEUROHYPOPHYSIS of all vertebrates (structure varies with species) to regulate water balance and OSMOLARITY. In general, vasopressin is a nonapeptide consisting of a six-amino-acid ring with a cysteine 1 to cysteine 6 disulfide bridge or an octapeptide containing a CYSTINE. All mammals have arginine vasopressin except the pig with a lysine at position 8. Vasopressin, a vasoconstrictor, acts on the KIDNEY COLLECTING DUCTS to increase water reabsorption, increase blood volume and blood pressure.
A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.
Any of various enzymatically catalyzed post-translational modifications of PEPTIDES or PROTEINS in the cell of origin. These modifications include carboxylation; HYDROXYLATION; ACETYLATION; PHOSPHORYLATION; METHYLATION; GLYCOSYLATION; ubiquitination; oxidation; proteolysis; and crosslinking and result in changes in molecular weight and electrophoretic motility.
An almost always malignant GLUCAGON-secreting tumor derived from the PANCREATIC ALPHA CELLS. It is characterized by a distinctive migratory ERYTHEMA; WEIGHT LOSS; STOMATITIS; GLOSSITIS; DIABETES MELLITUS; hypoaminoacidemia; and normochromic normocytic ANEMIA.
Conversion of an inactive form of an enzyme to one possessing metabolic activity. It includes 1, activation by ions (activators); 2, activation by cofactors (coenzymes); and 3, conversion of an enzyme precursor (proenzyme or zymogen) to an active enzyme.
Salts or esters of LACTIC ACID containing the general formula CH3CHOHCOOR.
A strain of albino rat used widely for experimental purposes because of its calmness and ease of handling. It was developed by the Sprague-Dawley Animal Company.
The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Endocrine cells found throughout the GASTROINTESTINAL TRACT and in islets of the PANCREAS. D cells secrete SOMATOSTATIN that acts in both an endocrine and paracrine manner. Somatostatin acts on a variety of tissues including the PITUITARY GLAND; gastrointestinal tract; pancreas; and KIDNEY by inhibiting the release of hormones, such as GROWTH HORMONE; GASTRIN; INSULIN; and RENIN.
Cell surface proteins that bind signalling molecules external to the cell with high affinity and convert this extracellular event into one or more intracellular signals that alter the behavior of the target cell (From Alberts, Molecular Biology of the Cell, 2nd ed, pp693-5). Cell surface receptors, unlike enzymes, do not chemically alter their ligands.
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
Peptide sequences, generated by iterative rounds of SELEX APTAMER TECHNIQUE, that bind to a target molecule specifically and with high affinity.
Chromatography on non-ionic gels without regard to the mechanism of solute discrimination.
The amount of a substance secreted by cells or by a specific organ or organism over a given period of time; usually applies to those substances which are formed by glandular tissues and are released by them into biological fluids, e.g., secretory rate of corticosteroids by the adrenal cortex, secretory rate of gastric acid by the gastric mucosa.
The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.
A strain of albino rat developed at the Wistar Institute that has spread widely at other institutions. This has markedly diluted the original strain.
FATTY ACIDS found in the plasma that are complexed with SERUM ALBUMIN for transport. These fatty acids are not in glycerol ester form.
A peptide, of about 33 amino acids, secreted by the upper INTESTINAL MUCOSA and also found in the central nervous system. It causes gallbladder contraction, release of pancreatic exocrine (or digestive) enzymes, and affects other gastrointestinal functions. Cholecystokinin may be the mediator of satiety.
Proteins obtained from species in the class of AMPHIBIANS.
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
Antigenic determinants recognized and bound by the T-cell receptor. Epitopes recognized by the T-cell receptor are often located in the inner, unexposed side of the antigen, and become accessible to the T-cell receptors after proteolytic processing of the antigen.
Proteins found in any species of bacterium.
Cell surface proteins that bind ATRIAL NATRIURETIC FACTOR with high affinity and trigger intracellular changes influencing the behavior of cells. They contain intrinsic guanylyl cyclase activity.
Peptides generated from AMYLOID BETA-PEPTIDES PRECURSOR. An amyloid fibrillar form of these peptides is the major component of amyloid plaques found in individuals with Alzheimer's disease and in aged individuals with trisomy 21 (DOWN SYNDROME). The peptide is found predominantly in the nervous system, but there have been reports of its presence in non-neural tissue.
Proteins and peptides found in SALIVA and the SALIVARY GLANDS. Some salivary proteins such as ALPHA-AMYLASES are enzymes, but their composition varies in different individuals.
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
The process of cleaving a chemical compound by the addition of a molecule of water.
Transport proteins that carry specific substances in the blood or across cell membranes.
Any of various animals that constitute the family Suidae and comprise stout-bodied, short-legged omnivorous mammals with thick skin, usually covered with coarse bristles, a rather long mobile snout, and small tail. Included are the genera Babyrousa, Phacochoerus (wart hogs), and Sus, the latter containing the domestic pig (see SUS SCROFA).
The process by which antigen is presented to lymphocytes in a form they can recognize. This is performed by antigen presenting cells (APCs). Some antigens require processing before they can be recognized. Antigen processing consists of ingestion and partial digestion of the antigen by the APC, followed by presentation of fragments on the cell surface. (From Rosen et al., Dictionary of Immunology, 1989)
A class of glucosyltransferases that catalyzes the degradation of storage polysaccharides, such as glucose polymers, by phosphorolysis in animals (GLYCOGEN PHOSPHORYLASE) and in plants (STARCH PHOSPHORYLASE).
Peptides composed of two amino acid units.
Diabetes mellitus induced experimentally by administration of various diabetogenic agents or by PANCREATECTOMY.
BUTYRIC ACID substituted in the beta or 3 position. It is one of the ketone bodies produced in the liver.
Commonly observed structural components of proteins formed by simple combinations of adjacent secondary structures. A commonly observed structure may be composed of a CONSERVED SEQUENCE which can be represented by a CONSENSUS SEQUENCE.
Basic polypeptide from the venom of the honey bee (Apis mellifera). It contains 26 amino acids, has cytolytic properties, causes contracture of muscle, releases histamine, and disrupts surface tension, probably due to lysis of cell and mitochondrial membranes.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.
The metabolic substances ACETONE; 3-HYDROXYBUTYRIC ACID; and acetoacetic acid (ACETOACETATES). They are produced in the liver and kidney during FATTY ACIDS oxidation and used as a source of energy by the heart, muscle and brain.
The thermodynamic interaction between a substance and WATER.
A subclass of PEPTIDE HYDROLASES that catalyze the internal cleavage of PEPTIDES or PROTEINS.
Methods used for studying the interactions of antibodies with specific regions of protein antigens. Important applications of epitope mapping are found within the area of immunochemistry.
Single-stranded complementary DNA synthesized from an RNA template by the action of RNA-dependent DNA polymerase. cDNA (i.e., complementary DNA, not circular DNA, not C-DNA) is used in a variety of molecular cloning experiments as well as serving as a specific hybridization probe.
A type of pancreatic cell representing about 50-80% of the islet cells. Beta cells secrete INSULIN.
Family of antimicrobial peptides that have been identified in humans, animals, and plants. They are thought to play a role in host defenses against infections, inflammation, wound repair, and acquired immunity.
A serine endopeptidase that has specificity for cleavage at ARGININE. It cleaves a variety of prohormones including PRO-OPIOMELANOCORTIN, proluteinizing-hormone-releasing hormone, proenkephalins, prodynorphin, and PROINSULIN.
A deoxyribonucleotide polymer that is the primary genetic material of all cells. Eukaryotic and prokaryotic organisms normally contain DNA in a double-stranded state, yet several important biological processes transiently involve single-stranded regions. DNA, which consists of a polysugar-phosphate backbone possessing projections of purines (adenine and guanine) and pyrimidines (thymine and cytosine), forms a double helix that is held together by hydrogen bonds between these purines and pyrimidines (adenine to thymine and guanine to cytosine).
The main glucocorticoid secreted by the ADRENAL CORTEX. Its synthetic counterpart is used, either as an injection or topically, in the treatment of inflammation, allergy, collagen diseases, asthma, adrenocortical deficiency, shock, and some neoplastic conditions.
Cyanogen bromide (CNBr). A compound used in molecular biology to digest some proteins and as a coupling reagent for phosphoroamidate or pyrophosphate internucleotide bonds in DNA duplexes.
The phenotypic manifestation of a gene or genes by the processes of GENETIC TRANSCRIPTION and GENETIC TRANSLATION.
An immunoassay utilizing an antibody labeled with an enzyme marker such as horseradish peroxidase. While either the enzyme or the antibody is bound to an immunosorbent substrate, they both retain their biologic activity; the change in enzyme activity as a result of the enzyme-antibody-antigen reaction is proportional to the concentration of the antigen and can be measured spectrophotometrically or with the naked eye. Many variations of the method have been developed.
Immunized T-lymphocytes which can directly destroy appropriate target cells. These cytotoxic lymphocytes may be generated in vitro in mixed lymphocyte cultures (MLC), in vivo during a graft-versus-host (GVH) reaction, or after immunization with an allograft, tumor cell or virally transformed or chemically modified target cell. The lytic phenomenon is sometimes referred to as cell-mediated lympholysis (CML). These CD8-positive cells are distinct from NATURAL KILLER CELLS and NATURAL KILLER T-CELLS. There are two effector phenotypes: TC1 and TC2.
The movement of materials (including biochemical substances and drugs) through a biological system at the cellular level. The transport can be across cell membranes and epithelial layers. It also can occur within intracellular compartments and extracellular compartments.
The increase in a measurable parameter of a PHYSIOLOGICAL PROCESS, including cellular, microbial, and plant; immunological, cardiovascular, respiratory, reproductive, urinary, digestive, neural, musculoskeletal, ocular, and skin physiological processes; or METABOLIC PROCESS, including enzymatic and other pharmacological processes, by a drug or other chemical.
Salts and esters of hydroxybutyric acid.
Antibodies produced by a single clone of cells.
A class of antimicrobial peptides discovered in the skin of XENOPUS LAEVIS. They kill bacteria by permeabilizing cell membranes without exhibiting significant toxicity against mammalian cells.
Serum that contains antibodies. It is obtained from an animal that has been immunized either by ANTIGEN injection or infection with microorganisms containing the antigen.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
A specific HLA-A surface antigen subtype. Members of this subtype contain alpha chains that are encoded by the HLA-A*02 allele family.
Layers of lipid molecules which are two molecules thick. Bilayer systems are frequently studied as models of biological membranes.
Compounds which inhibit or antagonize the biosynthesis or action of insulin.
A fibrous protein complex that consists of proteins folded into a specific cross beta-pleated sheet structure. This fibrillar structure has been found as an alternative folding pattern for a variety of functional proteins. Deposits of amyloid in the form of AMYLOID PLAQUES are associated with a variety of degenerative diseases. The amyloid structure has also been found in a number of functional proteins that are unrelated to disease.
The release of GLUCOSE from GLYCOGEN by GLYCOGEN PHOSPHORYLASE (phosphorolysis). The released glucose-1-phosphate is then converted to GLUCOSE-6-PHOSPHATE by PHOSPHOGLUCOMUTASE before entering GLYCOLYSIS. Glycogenolysis is stimulated by GLUCAGON or EPINEPHRINE via the activation of PHOSPHORYLASE KINASE.
Serological reactions in which an antiserum against one antigen reacts with a non-identical but closely related antigen.
Cell surface proteins that bind CALCITONIN GENE-RELATED PEPTIDE with high affinity and trigger intracellular changes which influence the behavior of cells. CGRP receptors are present in both the CENTRAL NERVOUS SYSTEM and the periphery. They are formed via the heterodimerization of the CALCITONIN RECEPTOR-LIKE PROTEIN and RECEPTOR ACTIVITY-MODIFYING PROTEIN 1.
Antimicrobial cationic peptides with a highly conserved amino terminal cathelin-like domain and a more variable carboxy terminal domain. They are initially synthesized as preproproteins and then cleaved. They are expressed in many tissues of humans and localized to EPITHELIAL CELLS. They kill nonviral pathogens by forming pores in membranes.
A trihydroxy sugar alcohol that is an intermediate in carbohydrate and lipid metabolism. It is used as a solvent, emollient, pharmaceutical agent, and sweetening agent.
A subtype of DIABETES MELLITUS that is characterized by INSULIN deficiency. It is manifested by the sudden onset of severe HYPERGLYCEMIA, rapid progression to DIABETIC KETOACIDOSIS, and DEATH unless treated with insulin. The disease may occur at any age, but is most common in childhood or adolescence.
ATP:pyruvate 2-O-phosphotransferase. A phosphotransferase that catalyzes reversibly the phosphorylation of pyruvate to phosphoenolpyruvate in the presence of ATP. It has four isozymes (L, R, M1, and M2). Deficiency of the enzyme results in hemolytic anemia. EC 2.7.1.40.
Theoretical representations that simulate the behavior or activity of biological processes or diseases. For disease models in living animals, DISEASE MODELS, ANIMAL is available. Biological models include the use of mathematical equations, computers, and other electronic equipment.
The molecular designing of drugs for specific purposes (such as DNA-binding, enzyme inhibition, anti-cancer efficacy, etc.) based on knowledge of molecular properties such as activity of functional groups, molecular geometry, and electronic structure, and also on information cataloged on analogous molecules. Drug design is generally computer-assisted molecular modeling and does not include pharmacokinetics, dosage analysis, or drug administration analysis.
Inbred BALB/c mice are a strain of laboratory mice that have been selectively bred to be genetically identical to each other, making them useful for scientific research and experiments due to their consistent genetic background and predictable responses to various stimuli or treatments.
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
A family of gastrointestinal peptide hormones that excite the secretion of GASTRIC JUICE. They may also occur in the central nervous system where they are presumed to be neurotransmitters.
Mitochondria in hepatocytes. As in all mitochondria, there are an outer membrane and an inner membrane, together creating two separate mitochondrial compartments: the internal matrix space and a much narrower intermembrane space. In the liver mitochondrion, an estimated 67% of the total mitochondrial proteins is located in the matrix. (From Alberts et al., Molecular Biology of the Cell, 2d ed, p343-4)
A mass spectrometry technique using two (MS/MS) or more mass analyzers. With two in tandem, the precursor ions are mass-selected by a first mass analyzer, and focused into a collision region where they are then fragmented into product ions which are then characterized by a second mass analyzer. A variety of techniques are used to separate the compounds, ionize them, and introduce them to the first mass analyzer. For example, for in GC-MS/MS, GAS CHROMATOGRAPHY-MASS SPECTROMETRY is involved in separating relatively small compounds by GAS CHROMATOGRAPHY prior to injecting them into an ionization chamber for the mass selection.
Histochemical localization of immunoreactive substances using labeled antibodies as reagents.
A process that includes the determination of AMINO ACID SEQUENCE of a protein (or peptide, oligopeptide or peptide fragment) and the information analysis of the sequence.
The biosynthesis of RNA carried out on a template of DNA. The biosynthesis of DNA from an RNA template is called REVERSE TRANSCRIPTION.

Impaired meal stimulated glucagon-like peptide 2 response in ileal resected short bowel patients with intestinal failure. (1/137)

BACKGROUND: Glucagon-like peptide 2 (GLP-2) is a growth factor for the intestinal epithelium in rodents and may affect intestinal transit. AIMS: To study the GLP-2 response to nutrient ingestion in seven short bowel patients with intestinal failure and seven controls. METHODS: The patients and controls were admitted twice for two test meals after a night of fasting. Meal A was liquid (300 ml, 1.88 MJ); meal B was a regular breakfast (755 g, 3.92 MJ). Plasma samples were collected for 180 minutes; GLP-2 immunoreactivity was measured with an NH(2) terminal specific radioimmunoassay. RESULTS: Both meals elicited significant increases in plasma GLP-2 in controls. The magnitude and duration of the responses were dependent on the meal size: the maximum median (25-75%) increases after meal A and B were 24 (3-28) and 48 (33-56) pmol/l. Plasma GLP-2 returned to basal concentrations 180 minutes after meal A, but remained at 50% of peak values after meal B. In the patients neither meal significantly changed the GLP-2 concentration; the maximum median elevation after meal B was 5 (2-8) pmol/l. There were significant differences between patients and controls with respect to the GLP-2 responses to meals A and B. CONCLUSION: Identification of GLP-2 as a tissue specific intestinal growth factor and demonstration of an impaired meal stimulated GLP-2 response in short bowel patients raises the possibility that GLP-2 administration may constitute a new therapeutic strategy, enhancing jejunal adaptation in ileum resected short bowel patients with intestinal failure.  (+info)

Diabetic intestinal growth adaptation and glucagon-like peptide 2 in the rat: effects of dietary fibre. (2/137)

BACKGROUND/AIMS: Dietary fibre influence growth and function of the upper gastrointestinal tract. This study investigates the importance of dietary fibre in intestinal growth in experimental diabetes, and correlates intestinal growth with plasma levels of the intestinotrophic factor, glucagon-like peptide 2 (GLP-2). METHODS: Male Wistar rats were randomised to the following groups: two streptozotocin-diabetic and two control groups fed either a fibre-containing or a fibre-free diet for three weeks. Intestinal weight, length, and morphometric data (villus height, villus area, crypt depth) were measured. Blood samples were obtained after two weeks for measurement of GLP-2 and enteroglucagon (glicentin, oxyntomodulin). RESULTS: The mean daily consumption of food in the two diabetic groups was 40% higher than in controls. In diabetic rats fed fibre, the increase in intestinal weight from day 0 to 20 was sixfold greater than that of the controls and small intestine weight per cm length was increased by 50%. In the diabetic rats fed a fibre-free diet, intestinal growth was 30% less than in diabetic rats fed fibre, and intestinal weight increased only threefold compared with controls. Morphometric data showed that the intestinal increase in diabetic rats fed fibre was due primarily to growth of the mucosal layer. Villus height and crypt depth increased 60% and 40% respectively, but by only 20% in fibre-free diabetic rats. The plasma levels of GLP-2 parallelled diabetic intestinal growth, whereas plasma levels of enteroglucagon increased regardless of the extent of intestinal growth. CONCLUSIONS: Intestinal growth in experimental diabetes is strongly influenced by the presence of dietary fibre. The effect may be mediated by GLP-2.  (+info)

Identification of glucagon-like peptide-2 (GLP-2)-activated signaling pathways in baby hamster kidney fibroblasts expressing the rat GLP-2 receptor. (3/137)

Glucagon-like peptide-2 (GLP-2) promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a recently identified member of the glucagon-secretin G protein-coupled receptor superfamily. Although activation of G protein-coupled receptors may lead to stimulation of cell growth, the mechanisms transducing the GLP-2 signal to mitogenic proliferation remain unknown. We now report studies of GLP-2R signaling in baby hamster kidney (BHK) cells expressing a transfected rat GLP-2 receptor (BHK-GLP-2R cells). GLP-2, but not glucagon or GLP-1, increased the levels of cAMP and activated both cAMP-response element- and AP-1-dependent transcriptional activity in a dose-dependent manner. The activation of AP-1-luciferase activity was protein kinase A (PKA) -dependent and markedly diminished in the presence of a dominant negative inhibitor of PKA. Although GLP-2 stimulated the expression of c-fos, c-jun, junB, and zif268, and transiently increased p70 S6 kinase in quiescent BHK-GLP-2R cells, GLP-2 also inhibited extracellular signal-regulated kinase 1/2 and reduced serum-stimulated Elk-1 activity. Furthermore, no rise in intracellular calcium was observed following GLP-2 exposure in BHK-GLP-2R cells. Although GLP-2 stimulated both cAMP accumulation and cell proliferation, 8-bromo-cyclic AMP alone did not promote cell proliferation. These findings suggest that the GLP-2R may be coupled to activation of mitogenic signaling in heterologous cell types independent of PKA via as yet unidentified downstream mediators of GLP-2 action in vivo.  (+info)

Lamprey proglucagon and the origin of glucagon-like peptides. (4/137)

We characterized two proglucagon cDNAs from the intestine of the sea lamprey Petromyzon marinus. As in other vertebrates, sea lamprey proglucagon genes encode three glucagon-like sequences, glucagon, and glucagon-like peptides 1 and 2 (GLP-1 and GLP-2). This observation indicates that all three glucagon-like sequences encoded by the proglucagon gene originated prior to the divergence of jawed and jawless vertebrates. Estimates of the rates of evolution for the glucagon-like sequences suggest that glucagon originated first, about 1 billion years ago, while GLP-1 and GLP-2 diverged from each other about 700 MYA. The two sea lamprey intestinal proglucagon cDNAs have differing coding potential. Proglucagon I cDNA encodes the previously characterized glucagon and the glucagon-like peptide GLP-1, while proglucagon II cDNA encodes a predicted GLP-2 and, possibly, a glucagon. The existence of two proglucagon cDNAs which differ with regard to their potential to encode glucagon-like peptides suggests that the lamprey may use differential gene expression as a third mechanism, in addition to alternative proteolytic processing and mRNA splicing, to regulate the production of proglucagon-derived peptides.  (+info)

Enzymatic- and renal-dependent catabolism of the intestinotropic hormone glucagon-like peptide-2 in rats. (5/137)

The intestinotropic hormone glucagon-like peptide (GLP)-2-(1-33) is cleaved in vitro to GLP-2-(3-33) by dipeptidyl peptidase IV (DP IV). To determine the importance of DP IV versus renal clearance in the regulation of circulating GLP-2-(1-33) levels in vivo, GLP-2-(1-33) or the DP IV-resistant analog [Gly(2)]GLP-2 was injected in normal or DP IV-negative rats and assayed by HPLC and RIA. Normal rats showed a steady degradation of GLP-2-(1-33) to GLP-2-(3-33) over time, whereas little or no conversion was detected for GLP-2-(1-33) in DP IV-negative rats and for [Gly(2)]GLP-2 in normal rats. To determine the role of the kidney in clearance of GLP-2-(1-33) from the circulation, normal rats were bilaterally nephrectomized, and plasma immunoreactive GLP-2 levels were measured. The slope of the disappearance curves for both GLP-2-(1-33) and [Gly(2)]GLP-2 were significantly reduced in nephrectomized compared with non-nephrectomized rats (P < 0.01). In contrast to both GLP-2-(1-33) and [Gly(2)]GLP-2, GLP-2-(3-33) did not stimulate intestinal growth in a murine assay in vivo. Thus the intestinotropic actions of GLP-2-(1-33) are determined both by the actions of DP IV and by the kidney in vivo in the rat.  (+info)

Glucagon-like peptide-2 increases sucrase-isomaltase but not caudal-related homeobox protein-2 gene expression. (6/137)

To determine the effect of glucagon-like peptide-2 (GLP-2) on sucrase-isomaltase and caudal-related homeobox protein-2 (Cdx-2) gene expression, male Wistar rats were divided into total parenteral nutrition (TPN)-fed and GLP-2-treated, TPN-fed groups. TPN was given via a jugular line, inserted under anesthesia, for 7 days. The treatment group received 40 microg/day of GLP-2 intravenously with the TPN diet. The small intestine and colon were weighed and measured. Tissue was obtained from the jejunum, terminal ileum, and midcolon. RNA analysis, morphometry, and microdissection were performed. The weight of the small intestine of GLP-2-treated rats was greater than that of TPN-fed rats (P < 0.001). GLP-2 increased the mean metaphase arrests/crypt in both the jejunum and ileum (P < 0.001). Ileal expression of sucrase-isomaltase was increased by 1. 6-fold (P < 0.05). Jejunal expression was increased by a similar amount, although not significantly (P = 0.08). There was no change in Cdx-2 gene expression. Thus GLP-2 can maintain small intestinal morphology and function, but effects on gene expression are not mediated by gross changes in the level of the mRNA for the homeobox protein Cdx-2.  (+info)

Somatostatin restrains the secretion of glucagon-like peptide-1 and -2 from isolated perfused porcine ileum. (7/137)

Suspecting that paracrine inhibition might influence neuronal regulation of the endocrine L cells, we studied the role of somatostatin (SS) in the regulation of the secretion of the proglucagon-derived hormones glucagon-like peptide-1 and -2 (GLP-1 and GLP-2). This was examined using the isolated perfused porcine ileum stimulated with acetylcholine (ACh, 10(-6) M), neuromedin C (NC, 10(-8) M), and electrical nerve stimulation (NS) with or without alpha-adrenergic blockade (phentolamine 10(-5) M), and perfusion with a high-affinity monoclonal antibody against SS. ACh and NC significantly increased GLP secretion, whereas NS had little effect. SS immunoneutralization increased GLP secretion eight- to ninefold but had little influence on the GLP responses to ACh, NC, and NS. Basal SS secretion (mainly SS28) was unaffected by NS alone. Phentolamine + NS and NC abstract strongly stimulated release mainly of SS14, whereas ACh had little effect. Infused intravascularly, SS14 weakly and SS28 strongly inhibited GLP secretion. We conclude that GLP secretion is tonically inhibited by a local release of SS28 from epithelial paracrine cells, whereas SS14, supposedly derived from enteric neurons, only weakly influences GLP secretion.  (+info)

Minimal enteral nutrient requirements for intestinal growth in neonatal piglets: how much is enough? (8/137)

BACKGROUND: Parenterally nourished preterm infants commonly receive minimal enteral feedings, the aim being to enhance intestinal function. Whether this regimen increases intestinal growth has not been established. OBJECTIVE: Our objective was to determine the minimal enteral nutrient intakes necessary to stimulate and to normalize neonatal intestinal growth. METHODS: Intestinal growth and cell proliferation were quantified in neonatal pigs given equal amounts of an elemental nutrient solution for 7 d. Different groups (n = 5-7 per group) received 0%, 10%, 20%, 40%, 60%, 80%, or 100% of total nutrient intake enterally, with the remainder given parenterally. RESULTS: In the jejunum, wet weight, protein mass, and villus height were significantly greater at enteral intakes >40%. Stimulation of ileal protein mass required a higher enteral intake (60%). In both segments, abrupt increases in DNA mass, crypt depth, ornithine decarboxylase activity, and crypt cells in S-phase occurred between enteral intakes of 40% and 60%. Circulating concentrations of glucagon-like peptide-2 and peptide YY, but not gastrin, increased significantly between enteral intakes of 40% and 60% and closely paralleled indexes of cell proliferation. CONCLUSIONS: The minimal enteral nutrient intake necessary to increase mucosal mass was 40% of total nutrient intake, whereas 60% enteral nutrition was necessary to sustain normal mucosal proliferation and growth. Our results imply that providing <40% of the total nutrient intake enterally does not have significant intestinal trophic effects.  (+info)

Glucagon is a hormone produced by the alpha cells of the pancreas. Its main function is to regulate glucose levels in the blood by stimulating the liver to convert stored glycogen into glucose, which can then be released into the bloodstream. This process helps to raise blood sugar levels when they are too low, such as during hypoglycemia.

Glucagon is a 29-amino acid polypeptide that is derived from the preproglucagon protein. It works by binding to glucagon receptors on liver cells, which triggers a series of intracellular signaling events that lead to the activation of enzymes involved in glycogen breakdown.

In addition to its role in glucose regulation, glucagon has also been shown to have other physiological effects, such as promoting lipolysis (the breakdown of fat) and inhibiting gastric acid secretion. Glucagon is often used clinically in the treatment of hypoglycemia, as well as in diagnostic tests to assess pancreatic function.

Glucagon-like peptide 1 (GLP-1) is a hormone that is secreted by the intestines in response to food intake. It plays a crucial role in regulating blood sugar levels through several mechanisms, including stimulation of insulin secretion from the pancreas, inhibition of glucagon release, slowing gastric emptying, and promoting satiety. GLP-1 is an important target for the treatment of type 2 diabetes due to its insulin-secretory and glucose-lowering effects. In addition, GLP-1 receptor agonists are used in the management of obesity due to their ability to promote weight loss by reducing appetite and increasing feelings of fullness.

Glucagon receptors are a type of G protein-coupled receptor found on the surface of cells in the body, particularly in the liver, fat, and muscle tissues. These receptors bind to the hormone glucagon, which is produced and released by the alpha cells of the pancreas in response to low blood sugar levels (hypoglycemia).

When glucagon binds to its receptor, it triggers a series of intracellular signaling events that lead to the breakdown of glycogen (a stored form of glucose) in the liver and the release of glucose into the bloodstream. This helps to raise blood sugar levels back to normal.

Glucagon receptors also play a role in regulating fat metabolism, as activation of these receptors in adipose tissue can stimulate the breakdown of triglycerides (a type of fat) into free fatty acids and glycerol, which can then be used as energy sources.

Abnormalities in glucagon receptor function or expression have been implicated in various metabolic disorders, including diabetes and obesity.

I'm sorry for the confusion, but "Peptide PHI" is not a widely recognized or established medical term. It seems that there might be some misunderstanding or miscommunication related to this term.

If you are referring to a specific type of peptide or a research study, could you please provide more context or clarify the source of the term? I would be happy to help you with accurate and reliable information once I have a better understanding of what you are asking about.

Venom is a complex mixture of toxic compounds produced by certain animals, such as snakes, spiders, scorpions, and marine creatures like cone snails and stonefish. These toxic substances are specifically designed to cause damage to the tissues or interfere with the normal physiological processes of other organisms, which can lead to harmful or even lethal effects.

Venoms typically contain a variety of components, including enzymes, peptides, proteins, and small molecules, each with specific functions that contribute to the overall toxicity of the mixture. Some of these components may cause localized damage, such as tissue necrosis or inflammation, while others can have systemic effects, impacting various organs and bodily functions.

The study of venoms, known as toxinology, has important implications for understanding the evolution of animal behavior, developing new therapeutics, and advancing medical treatments for envenomation (the process of being poisoned by venom). Additionally, venoms have been used in traditional medicine for centuries, and ongoing research continues to uncover novel compounds with potential applications in modern pharmacology.

Peptides are short chains of amino acid residues linked by covalent bonds, known as peptide bonds. They are formed when two or more amino acids are joined together through a condensation reaction, which results in the elimination of a water molecule and the formation of an amide bond between the carboxyl group of one amino acid and the amino group of another.

Peptides can vary in length from two to about fifty amino acids, and they are often classified based on their size. For example, dipeptides contain two amino acids, tripeptides contain three, and so on. Oligopeptides typically contain up to ten amino acids, while polypeptides can contain dozens or even hundreds of amino acids.

Peptides play many important roles in the body, including serving as hormones, neurotransmitters, enzymes, and antibiotics. They are also used in medical research and therapeutic applications, such as drug delivery and tissue engineering.

Bombesin is a type of peptide that occurs naturally in the body. It is a small protein-like molecule made up of amino acids, and it is involved in various physiological processes, including regulating appetite and digestion. Bombesin was first discovered in the skin of a frog species called Bombina bombina, hence its name. In the human body, bombesin-like peptides are produced by various tissues, including the stomach and brain. They bind to specific receptors in the body, triggering a range of responses, such as stimulating the release of hormones and increasing gut motility. Bombesin has been studied for its potential role in treating certain medical conditions, including cancer, although more research is needed to establish its safety and efficacy.

An amino acid sequence is the specific order of amino acids in a protein or peptide molecule, formed by the linking of the amino group (-NH2) of one amino acid to the carboxyl group (-COOH) of another amino acid through a peptide bond. The sequence is determined by the genetic code and is unique to each type of protein or peptide. It plays a crucial role in determining the three-dimensional structure and function of proteins.

A peptide fragment is a short chain of amino acids that is derived from a larger peptide or protein through various biological or chemical processes. These fragments can result from the natural breakdown of proteins in the body during regular physiological processes, such as digestion, or they can be produced experimentally in a laboratory setting for research or therapeutic purposes.

Peptide fragments are often used in research to map the structure and function of larger peptides and proteins, as well as to study their interactions with other molecules. In some cases, peptide fragments may also have biological activity of their own and can be developed into drugs or diagnostic tools. For example, certain peptide fragments derived from hormones or neurotransmitters may bind to receptors in the body and mimic or block the effects of the full-length molecule.

A peptide library is a collection of a large number of peptides, which are short chains of amino acids. Each peptide in the library is typically composed of a defined length and sequence, and may contain a variety of different amino acids. Peptide libraries can be synthesized using automated techniques and are often used in scientific research to identify potential ligands (molecules that bind to specific targets) or to study the interactions between peptides and other molecules.

In a peptide library, each peptide is usually attached to a solid support, such as a resin bead, and the entire library can be created using split-and-pool synthesis techniques. This allows for the rapid and efficient synthesis of a large number of unique peptides, which can then be screened for specific activities or properties.

Peptide libraries are used in various fields such as drug discovery, proteomics, and molecular biology to identify potential therapeutic targets, understand protein-protein interactions, and develop new diagnostic tools.

Glucagon-secreting cells, also known as alpha (α) cells, are a type of cell located in the pancreatic islets of Langerhans. These cells are responsible for producing and secreting the hormone glucagon, which plays a crucial role in regulating blood glucose levels.

Glucagon works in opposition to insulin, another hormone produced by different cells in the pancreas called beta (β) cells. When blood glucose levels are low, such as during fasting or exercise, glucagon is released into the bloodstream and travels to the liver, where it stimulates the breakdown of glycogen (stored glucose) into glucose, which is then released into the bloodstream to raise blood glucose levels.

Abnormalities in glucagon-secreting cells can contribute to various endocrine disorders, such as diabetes and hypoglycemia.

Antimicrobial cationic peptides (ACPs) are a group of small, naturally occurring peptides that possess broad-spectrum antimicrobial activity against various microorganisms, including bacteria, fungi, viruses, and parasites. They are called "cationic" because they contain positively charged amino acid residues (such as lysine and arginine), which allow them to interact with and disrupt the negatively charged membranes of microbial cells.

ACPs are produced by a wide range of organisms, including humans, animals, and plants, as part of their innate immune response to infection. They play an important role in protecting the host from invading pathogens by directly killing them or inhibiting their growth.

The antimicrobial activity of ACPs is thought to be mediated by their ability to disrupt the membranes of microbial cells, leading to leakage of cellular contents and death. Some ACPs may also have intracellular targets, such as DNA or protein synthesis, that contribute to their antimicrobial activity.

ACPs are being studied for their potential use as therapeutic agents to treat infectious diseases, particularly those caused by drug-resistant bacteria. However, their clinical application is still in the early stages of development due to concerns about their potential toxicity to host cells and the emergence of resistance mechanisms in microbial pathogens.

Insulin is a hormone produced by the beta cells of the pancreatic islets, primarily in response to elevated levels of glucose in the circulating blood. It plays a crucial role in regulating blood glucose levels and facilitating the uptake and utilization of glucose by peripheral tissues, such as muscle and adipose tissue, for energy production and storage. Insulin also inhibits glucose production in the liver and promotes the storage of excess glucose as glycogen or triglycerides.

Deficiency in insulin secretion or action leads to impaired glucose regulation and can result in conditions such as diabetes mellitus, characterized by chronic hyperglycemia and associated complications. Exogenous insulin is used as a replacement therapy in individuals with diabetes to help manage their blood glucose levels and prevent long-term complications.

Cyclic peptides are a type of peptides in which the N-terminus and C-terminus of the peptide chain are linked to form a circular structure. This is in contrast to linear peptides, which have a straight peptide backbone with a free N-terminus and C-terminus. The cyclization of peptides can occur through various mechanisms, including the formation of an amide bond between the N-terminal amino group and the C-terminal carboxylic acid group (head-to-tail cyclization), or through the formation of a bond between side chain functional groups.

Cyclic peptides have unique structural and chemical properties that make them valuable in medical and therapeutic applications. For example, they are more resistant to degradation by enzymes compared to linear peptides, which can increase their stability and half-life in the body. Additionally, the cyclic structure allows for greater conformational rigidity, which can enhance their binding affinity and specificity to target molecules.

Cyclic peptides have been explored as potential therapeutics for a variety of diseases, including cancer, infectious diseases, and neurological disorders. They have also been used as tools in basic research to study protein-protein interactions and cell signaling pathways.

Peptide mapping is a technique used in proteomics and analytical chemistry to analyze and identify the sequence and structure of peptides or proteins. This method involves breaking down a protein into smaller peptide fragments using enzymatic or chemical digestion, followed by separation and identification of these fragments through various analytical techniques such as liquid chromatography (LC) and mass spectrometry (MS).

The resulting peptide map serves as a "fingerprint" of the protein, providing information about its sequence, modifications, and structure. Peptide mapping can be used for a variety of applications, including protein identification, characterization of post-translational modifications, and monitoring of protein degradation or cleavage.

In summary, peptide mapping is a powerful tool in proteomics that enables the analysis and identification of proteins and their modifications at the peptide level.

Oligopeptides are defined in medicine and biochemistry as short chains of amino acids, typically containing fewer than 20 amino acid residues. These small peptides are important components in various biological processes, such as serving as signaling molecules, enzyme inhibitors, or structural elements in some proteins. They can be found naturally in foods and may also be synthesized for use in medical research and therapeutic applications.

The liver is a large, solid organ located in the upper right portion of the abdomen, beneath the diaphragm and above the stomach. It plays a vital role in several bodily functions, including:

1. Metabolism: The liver helps to metabolize carbohydrates, fats, and proteins from the food we eat into energy and nutrients that our bodies can use.
2. Detoxification: The liver detoxifies harmful substances in the body by breaking them down into less toxic forms or excreting them through bile.
3. Synthesis: The liver synthesizes important proteins, such as albumin and clotting factors, that are necessary for proper bodily function.
4. Storage: The liver stores glucose, vitamins, and minerals that can be released when the body needs them.
5. Bile production: The liver produces bile, a digestive juice that helps to break down fats in the small intestine.
6. Immune function: The liver plays a role in the immune system by filtering out bacteria and other harmful substances from the blood.

Overall, the liver is an essential organ that plays a critical role in maintaining overall health and well-being.

Somatostatin is a hormone that inhibits the release of several hormones and also has a role in slowing down digestion. It is produced by the body in various parts of the body, including the hypothalamus (a part of the brain), the pancreas, and the gastrointestinal tract.

Somatostatin exists in two forms: somatostatin-14 and somatostatin-28, which differ in their length. Somatostatin-14 is the predominant form found in the brain, while somatostatin-28 is the major form found in the gastrointestinal tract.

Somatostatin has a wide range of effects on various physiological processes, including:

* Inhibiting the release of several hormones such as growth hormone, insulin, glucagon, and gastrin
* Slowing down digestion by inhibiting the release of digestive enzymes from the pancreas and reducing blood flow to the gastrointestinal tract
* Regulating neurotransmission in the brain

Somatostatin is used clinically as a diagnostic tool for detecting certain types of tumors that overproduce growth hormone or other hormones, and it is also used as a treatment for some conditions such as acromegaly (a condition characterized by excessive growth hormone production) and gastrointestinal disorders.

Glucagon-like peptides (GLPs) are hormones that are produced in the intestines in response to food consumption. They belong to a class of hormones known as incretins, which play a role in regulating blood sugar levels by stimulating the pancreas to produce insulin and inhibiting the release of glucagon.

There are two main types of GLPs: GLP-1 and GLP-2. GLP-1 is secreted in response to meals and stimulates the pancreas to produce insulin, suppresses glucagon production, slows gastric emptying, and promotes satiety. GLP-2, on the other hand, promotes intestinal growth and improves nutrient absorption.

GLP-1 receptor agonists are a class of medications used to treat type 2 diabetes. They mimic the effects of natural GLP-1 by stimulating insulin secretion, suppressing glucagon release, slowing gastric emptying, and promoting satiety. These medications have been shown to improve blood sugar control, reduce body weight, and lower the risk of cardiovascular events in people with type 2 diabetes.

Molecular sequence data refers to the specific arrangement of molecules, most commonly nucleotides in DNA or RNA, or amino acids in proteins, that make up a biological macromolecule. This data is generated through laboratory techniques such as sequencing, and provides information about the exact order of the constituent molecules. This data is crucial in various fields of biology, including genetics, evolution, and molecular biology, allowing for comparisons between different organisms, identification of genetic variations, and studies of gene function and regulation.

The Islets of Langerhans are clusters of specialized cells within the pancreas, an organ located behind the stomach. These islets are named after Paul Langerhans, who first identified them in 1869. They constitute around 1-2% of the total mass of the pancreas and are distributed throughout its substance.

The Islets of Langerhans contain several types of cells, including:

1. Alpha (α) cells: These produce and release glucagon, a hormone that helps to regulate blood sugar levels by promoting the conversion of glycogen to glucose in the liver when blood sugar levels are low.
2. Beta (β) cells: These produce and release insulin, a hormone that promotes the uptake and utilization of glucose by cells throughout the body, thereby lowering blood sugar levels.
3. Delta (δ) cells: These produce and release somatostatin, a hormone that inhibits the release of both insulin and glucagon and helps regulate their secretion in response to changing blood sugar levels.
4. PP cells (gamma or γ cells): These produce and release pancreatic polypeptide, which plays a role in regulating digestive enzyme secretion and gastrointestinal motility.

Dysfunction of the Islets of Langerhans can lead to various endocrine disorders, such as diabetes mellitus, where insulin-producing beta cells are damaged or destroyed, leading to impaired blood sugar regulation.

Blood glucose, also known as blood sugar, is the concentration of glucose in the blood. Glucose is a simple sugar that serves as the main source of energy for the body's cells. It is carried to each cell through the bloodstream and is absorbed into the cells with the help of insulin, a hormone produced by the pancreas.

The normal range for blood glucose levels in humans is typically between 70 and 130 milligrams per deciliter (mg/dL) when fasting, and less than 180 mg/dL after meals. Levels that are consistently higher than this may indicate diabetes or other metabolic disorders.

Blood glucose levels can be measured through a variety of methods, including fingerstick blood tests, continuous glucose monitoring systems, and laboratory tests. Regular monitoring of blood glucose levels is important for people with diabetes to help manage their condition and prevent complications.

Vasoactive Intestinal Peptide (VIP) is a 28-amino acid polypeptide hormone that has potent vasodilatory, secretory, and neurotransmitter effects. It is widely distributed throughout the body, including in the gastrointestinal tract, where it is synthesized and released by nerve cells (neurons) in the intestinal mucosa. VIP plays a crucial role in regulating various physiological functions such as intestinal secretion, motility, and blood flow. It also has immunomodulatory effects and may play a role in neuroprotection. High levels of VIP are found in the brain, where it acts as a neurotransmitter or neuromodulator and is involved in various cognitive functions such as learning, memory, and social behavior.

Proglucagon is a precursor protein that gets cleaved into several hormones, including glucagon, GLP-1 (Glucagon-like peptide-1), and GLP-2 (Glucagon-like peptide-2). These hormones play crucial roles in regulating blood sugar levels, energy balance, and gut function. Proglucagon is primarily produced by the alpha cells of the pancreas and L cells in the intestine. Glucagon helps to raise blood sugar levels during fasting or hypoglycemia, while GLP-1 and GLP-2 contribute to glucose regulation, satiety, and gut motility, among other functions.

In the context of medicine and pharmacology, "kinetics" refers to the study of how a drug moves throughout the body, including its absorption, distribution, metabolism, and excretion (often abbreviated as ADME). This field is called "pharmacokinetics."

1. Absorption: This is the process of a drug moving from its site of administration into the bloodstream. Factors such as the route of administration (e.g., oral, intravenous, etc.), formulation, and individual physiological differences can affect absorption.

2. Distribution: Once a drug is in the bloodstream, it gets distributed throughout the body to various tissues and organs. This process is influenced by factors like blood flow, protein binding, and lipid solubility of the drug.

3. Metabolism: Drugs are often chemically modified in the body, typically in the liver, through processes known as metabolism. These changes can lead to the formation of active or inactive metabolites, which may then be further distributed, excreted, or undergo additional metabolic transformations.

4. Excretion: This is the process by which drugs and their metabolites are eliminated from the body, primarily through the kidneys (urine) and the liver (bile).

Understanding the kinetics of a drug is crucial for determining its optimal dosing regimen, potential interactions with other medications or foods, and any necessary adjustments for special populations like pediatric or geriatric patients, or those with impaired renal or hepatic function.

Brain Natriuretic Peptide (BNP) is a type of natriuretic peptide that is primarily produced in the heart, particularly in the ventricles. Although it was initially identified in the brain, hence its name, it is now known that the cardiac ventricles are the main source of BNP in the body.

BNP is released into the bloodstream in response to increased stretching or distension of the heart muscle cells due to conditions such as heart failure, hypertension, and myocardial infarction (heart attack). Once released, BNP binds to specific receptors in the kidneys, causing an increase in urine production and excretion of sodium, which helps reduce fluid volume and decrease the workload on the heart.

BNP also acts as a hormone that regulates various physiological functions, including blood pressure, cardiac remodeling, and inflammation. Measuring BNP levels in the blood is a useful diagnostic tool for detecting and monitoring heart failure, as higher levels of BNP are associated with more severe heart dysfunction.

Glucose is a simple monosaccharide (or single sugar) that serves as the primary source of energy for living organisms. It's a fundamental molecule in biology, often referred to as "dextrose" or "grape sugar." Glucose has the molecular formula C6H12O6 and is vital to the functioning of cells, especially those in the brain and nervous system.

In the body, glucose is derived from the digestion of carbohydrates in food, and it's transported around the body via the bloodstream to cells where it can be used for energy. Cells convert glucose into a usable form through a process called cellular respiration, which involves a series of metabolic reactions that generate adenosine triphosphate (ATP)—the main currency of energy in cells.

Glucose is also stored in the liver and muscles as glycogen, a polysaccharide (multiple sugar) that can be broken down back into glucose when needed for energy between meals or during physical activity. Maintaining appropriate blood glucose levels is crucial for overall health, and imbalances can lead to conditions such as diabetes mellitus.

Protein binding, in the context of medical and biological sciences, refers to the interaction between a protein and another molecule (known as the ligand) that results in a stable complex. This process is often reversible and can be influenced by various factors such as pH, temperature, and concentration of the involved molecules.

In clinical chemistry, protein binding is particularly important when it comes to drugs, as many of them bind to proteins (especially albumin) in the bloodstream. The degree of protein binding can affect a drug's distribution, metabolism, and excretion, which in turn influence its therapeutic effectiveness and potential side effects.

Protein-bound drugs may be less available for interaction with their target tissues, as only the unbound or "free" fraction of the drug is active. Therefore, understanding protein binding can help optimize dosing regimens and minimize adverse reactions.

Hypoglycemia is a medical condition characterized by an abnormally low level of glucose (sugar) in the blood. Generally, hypoglycemia is defined as a blood glucose level below 70 mg/dL (3.9 mmol/L), although symptoms may not occur until the blood sugar level falls below 55 mg/dL (3.0 mmol/L).

Hypoglycemia can occur in people with diabetes who are taking insulin or medications that increase insulin production, as well as those with certain medical conditions such as hormone deficiencies, severe liver illnesses, or disorders of the adrenal glands. Symptoms of hypoglycemia include sweating, shaking, confusion, rapid heartbeat, and in severe cases, loss of consciousness or seizures.

Hypoglycemia is typically treated by consuming fast-acting carbohydrates such as fruit juice, candy, or glucose tablets to rapidly raise blood sugar levels. If left untreated, hypoglycemia can lead to serious complications, including brain damage and even death.

Gluconeogenesis is a metabolic pathway that occurs in the liver, kidneys, and to a lesser extent in the small intestine. It involves the synthesis of glucose from non-carbohydrate precursors such as lactate, pyruvate, glycerol, and certain amino acids. This process becomes particularly important during periods of fasting or starvation when glucose levels in the body begin to drop, and there is limited carbohydrate intake to replenish them.

Gluconeogenesis helps maintain blood glucose homeostasis by providing an alternative source of glucose for use by various tissues, especially the brain, which relies heavily on glucose as its primary energy source. It is a complex process that involves several enzymatic steps, many of which are regulated to ensure an adequate supply of glucose while preventing excessive production, which could lead to hyperglycemia.

Pancreatic polypeptide (PP) is a hormone that is produced and released by the pancreas, specifically by the F cells located in the islets of Langerhans. It is a small protein consisting of 36 amino acids, and it plays a role in regulating digestive functions, particularly by inhibiting pancreatic enzyme secretion and gastric acid secretion.

PP is released into the bloodstream in response to food intake, especially when nutrients such as proteins and fats are present in the stomach. It acts on the brain to produce a feeling of fullness or satiety, which helps to regulate appetite and eating behavior. Additionally, PP has been shown to have effects on glucose metabolism, insulin secretion, and energy balance.

In recent years, there has been growing interest in the potential therapeutic uses of PP for a variety of conditions, including obesity, diabetes, and gastrointestinal disorders. However, more research is needed to fully understand its mechanisms of action and clinical applications.

The pancreas is a glandular organ located in the abdomen, posterior to the stomach. It has both exocrine and endocrine functions. The exocrine portion of the pancreas consists of acinar cells that produce and secrete digestive enzymes into the duodenum via the pancreatic duct. These enzymes help in the breakdown of proteins, carbohydrates, and fats in food.

The endocrine portion of the pancreas consists of clusters of cells called islets of Langerhans, which include alpha, beta, delta, and F cells. These cells produce and secrete hormones directly into the bloodstream, including insulin, glucagon, somatostatin, and pancreatic polypeptide. Insulin and glucagon are critical regulators of blood sugar levels, with insulin promoting glucose uptake and storage in tissues and glucagon stimulating glycogenolysis and gluconeogenesis to raise blood glucose when it is low.

Pancreatic hormones are chemical messengers produced and released by the pancreas, a gland located in the abdomen. The two main types of pancreatic hormones are insulin and glucagon, which are released by specialized cells called islets of Langerhans.

Insulin is produced by beta cells and helps regulate blood sugar levels by allowing cells in the body to take in sugar (glucose) from the bloodstream. It also helps the body store excess glucose in the liver for later use.

Glucagon is produced by alpha cells and has the opposite effect of insulin. When blood sugar levels are low, glucagon stimulates the release of stored glucose from the liver to raise blood sugar levels.

Together, insulin and glucagon help maintain balanced blood sugar levels and are essential for the proper functioning of the body's metabolism. Other hormones produced by the pancreas include somatostatin, which regulates the release of insulin and glucagon, and gastrin, which stimulates the production of digestive enzymes in the stomach.

Peptide YY (PYY) is a small peptide hormone consisting of 36 amino acids, that is released by the L cells in the intestinal epithelium in response to feeding. It is a member of the neuropeptide Y (NPY) family and plays a crucial role in regulating appetite and energy balance.

After eating, PYY is released into the circulation and acts on specific receptors in the hypothalamus to inhibit food intake. This anorexigenic effect of PYY is mediated by its ability to decrease gastric emptying, reduce intestinal motility, and increase satiety.

PYY has also been shown to have effects on glucose homeostasis, insulin secretion, and inflammation, making it a potential therapeutic target for the treatment of obesity, diabetes, and other metabolic disorders.

Calcitonin gene-related peptide (CGRP) is a neurotransmitter and vasodilator peptide that is widely distributed in the nervous system. It is encoded by the calcitonin gene, which also encodes calcitonin and catestatin. CGRP is produced and released by sensory nerves and plays important roles in pain transmission, modulation of inflammation, and regulation of blood flow.

CGRP exists as two forms, α-CGRP and β-CGRP, which differ slightly in their amino acid sequences but have similar biological activities. α-CGRP is found primarily in the central and peripheral nervous systems, while β-CGRP is expressed mainly in the gastrointestinal tract.

CGRP exerts its effects by binding to specific G protein-coupled receptors, which are widely distributed in various tissues, including blood vessels, smooth muscles, and sensory neurons. Activation of CGRP receptors leads to increased intracellular cyclic AMP levels, activation of protein kinase A, and subsequent relaxation of vascular smooth muscle, resulting in vasodilation.

CGRP has been implicated in several clinical conditions, including migraine, cluster headache, and inflammatory pain. Inhibition of CGRP signaling has emerged as a promising therapeutic strategy for the treatment of these disorders.

Amino acids are organic compounds that serve as the building blocks of proteins. They consist of a central carbon atom, also known as the alpha carbon, which is bonded to an amino group (-NH2), a carboxyl group (-COOH), a hydrogen atom (H), and a variable side chain (R group). The R group can be composed of various combinations of atoms such as hydrogen, oxygen, sulfur, nitrogen, and carbon, which determine the unique properties of each amino acid.

There are 20 standard amino acids that are encoded by the genetic code and incorporated into proteins during translation. These include:

1. Alanine (Ala)
2. Arginine (Arg)
3. Asparagine (Asn)
4. Aspartic acid (Asp)
5. Cysteine (Cys)
6. Glutamine (Gln)
7. Glutamic acid (Glu)
8. Glycine (Gly)
9. Histidine (His)
10. Isoleucine (Ile)
11. Leucine (Leu)
12. Lysine (Lys)
13. Methionine (Met)
14. Phenylalanine (Phe)
15. Proline (Pro)
16. Serine (Ser)
17. Threonine (Thr)
18. Tryptophan (Trp)
19. Tyrosine (Tyr)
20. Valine (Val)

Additionally, there are several non-standard or modified amino acids that can be incorporated into proteins through post-translational modifications, such as hydroxylation, methylation, and phosphorylation. These modifications expand the functional diversity of proteins and play crucial roles in various cellular processes.

Amino acids are essential for numerous biological functions, including protein synthesis, enzyme catalysis, neurotransmitter production, energy metabolism, and immune response regulation. Some amino acids can be synthesized by the human body (non-essential), while others must be obtained through dietary sources (essential).

Protein precursors, also known as proproteins or prohormones, are inactive forms of proteins that undergo post-translational modification to become active. These modifications typically include cleavage of the precursor protein by specific enzymes, resulting in the release of the active protein. This process allows for the regulation and control of protein activity within the body. Protein precursors can be found in various biological processes, including the endocrine system where they serve as inactive hormones that can be converted into their active forms when needed.

Peptide biosynthesis is the process by which cells synthesize peptides, short chains of amino acids. This process is mediated by enzymes called peptide synthetases, which catalyze the formation of peptide bonds between individual amino acids to create a longer chain. Peptide biosynthesis typically occurs through one of two pathways: ribosomal or non-ribosomal.

Ribosomal peptide biosynthesis involves the use of the cell's translational machinery, including the ribosome and transfer RNAs (tRNAs), to synthesize peptides from a messenger RNA (mRNA) template. This process is highly regulated and typically results in the production of small, linear peptides that are further modified by enzymes to create bioactive molecules such as hormones or neurotransmitters.

Non-ribosomal peptide biosynthesis (NRPS), on the other hand, is a more complex process that involves large multifunctional enzyme complexes called non-ribosomal peptide synthetases (NRPSs). These enzymes are capable of synthesizing a wide variety of structurally diverse peptides, including cyclic and branched peptides, as well as those containing non-proteinogenic amino acids. NRPSs typically consist of multiple modules, each responsible for adding a single amino acid to the growing peptide chain. The modular nature of NRPS systems allows for great diversity in the types of peptides that can be synthesized, making them important sources of bioactive molecules with potential therapeutic applications.

Cell-penetrating peptides (CPPs) are short, typically less than 30 amino acids long, biologically active peptides that have the ability to cross cell membranes and deliver various cargoes into cells. They were first discovered in the early 1990s and since then have gained significant attention due to their potential applications in drug delivery, gene therapy, and diagnostics.

CPPs can be classified into three categories based on their origin: (1) protein-derived CPPs, such as Tat from HIV-1 TAT protein and Penetratin from Drosophila Antennapedia protein; (2) chimeric CPPs, which are created by fusing different parts of various peptides; and (3) synthetic CPPs, which are designed and synthesized de novo.

The mechanism of cell penetration by CPPs is not fully understood but is thought to involve several processes, including endocytosis, direct translocation, and membrane disruption. The ability of CPPs to efficiently deliver various cargoes, such as proteins, nucleic acids, and small molecules, into cells has made them attractive tools for use in biomedical research and therapeutic applications. However, their potential cytotoxicity and lack of specificity remain major challenges that need to be addressed before they can be widely used in clinical settings.

"Inbred strains of rats" are genetically identical rodents that have been produced through many generations of brother-sister mating. This results in a high degree of homozygosity, where the genes at any particular locus in the genome are identical in all members of the strain.

Inbred strains of rats are widely used in biomedical research because they provide a consistent and reproducible genetic background for studying various biological phenomena, including the effects of drugs, environmental factors, and genetic mutations on health and disease. Additionally, inbred strains can be used to create genetically modified models of human diseases by introducing specific mutations into their genomes.

Some commonly used inbred strains of rats include the Wistar Kyoto (WKY), Sprague-Dawley (SD), and Fischer 344 (F344) rat strains. Each strain has its own unique genetic characteristics, making them suitable for different types of research.

A base sequence in the context of molecular biology refers to the specific order of nucleotides in a DNA or RNA molecule. In DNA, these nucleotides are adenine (A), guanine (G), cytosine (C), and thymine (T). In RNA, uracil (U) takes the place of thymine. The base sequence contains genetic information that is transcribed into RNA and ultimately translated into proteins. It is the exact order of these bases that determines the genetic code and thus the function of the DNA or RNA molecule.

In the context of medical and biological sciences, a "binding site" refers to a specific location on a protein, molecule, or cell where another molecule can attach or bind. This binding interaction can lead to various functional changes in the original protein or molecule. The other molecule that binds to the binding site is often referred to as a ligand, which can be a small molecule, ion, or even another protein.

The binding between a ligand and its target binding site can be specific and selective, meaning that only certain ligands can bind to particular binding sites with high affinity. This specificity plays a crucial role in various biological processes, such as signal transduction, enzyme catalysis, or drug action.

In the case of drug development, understanding the location and properties of binding sites on target proteins is essential for designing drugs that can selectively bind to these sites and modulate protein function. This knowledge can help create more effective and safer therapeutic options for various diseases.

Protein conformation refers to the specific three-dimensional shape that a protein molecule assumes due to the spatial arrangement of its constituent amino acid residues and their associated chemical groups. This complex structure is determined by several factors, including covalent bonds (disulfide bridges), hydrogen bonds, van der Waals forces, and ionic bonds, which help stabilize the protein's unique conformation.

Protein conformations can be broadly classified into two categories: primary, secondary, tertiary, and quaternary structures. The primary structure represents the linear sequence of amino acids in a polypeptide chain. The secondary structure arises from local interactions between adjacent amino acid residues, leading to the formation of recurring motifs such as α-helices and β-sheets. Tertiary structure refers to the overall three-dimensional folding pattern of a single polypeptide chain, while quaternary structure describes the spatial arrangement of multiple folded polypeptide chains (subunits) that interact to form a functional protein complex.

Understanding protein conformation is crucial for elucidating protein function, as the specific three-dimensional shape of a protein directly influences its ability to interact with other molecules, such as ligands, nucleic acids, or other proteins. Any alterations in protein conformation due to genetic mutations, environmental factors, or chemical modifications can lead to loss of function, misfolding, aggregation, and disease states like neurodegenerative disorders and cancer.

Molecular models are three-dimensional representations of molecular structures that are used in the field of molecular biology and chemistry to visualize and understand the spatial arrangement of atoms and bonds within a molecule. These models can be physical or computer-generated and allow researchers to study the shape, size, and behavior of molecules, which is crucial for understanding their function and interactions with other molecules.

Physical molecular models are often made up of balls (representing atoms) connected by rods or sticks (representing bonds). These models can be constructed manually using materials such as plastic or wooden balls and rods, or they can be created using 3D printing technology.

Computer-generated molecular models, on the other hand, are created using specialized software that allows researchers to visualize and manipulate molecular structures in three dimensions. These models can be used to simulate molecular interactions, predict molecular behavior, and design new drugs or chemicals with specific properties. Overall, molecular models play a critical role in advancing our understanding of molecular structures and their functions.

Cyclic adenosine monophosphate (cAMP) is a key secondary messenger in many biological processes, including the regulation of metabolism, gene expression, and cellular excitability. It is synthesized from adenosine triphosphate (ATP) by the enzyme adenylyl cyclase and is degraded by the enzyme phosphodiesterase.

In the body, cAMP plays a crucial role in mediating the effects of hormones and neurotransmitters on target cells. For example, when a hormone binds to its receptor on the surface of a cell, it can activate a G protein, which in turn activates adenylyl cyclase to produce cAMP. The increased levels of cAMP then activate various effector proteins, such as protein kinases, which go on to regulate various cellular processes.

Overall, the regulation of cAMP levels is critical for maintaining proper cellular function and homeostasis, and abnormalities in cAMP signaling have been implicated in a variety of diseases, including cancer, diabetes, and neurological disorders.

A cell line is a culture of cells that are grown in a laboratory for use in research. These cells are usually taken from a single cell or group of cells, and they are able to divide and grow continuously in the lab. Cell lines can come from many different sources, including animals, plants, and humans. They are often used in scientific research to study cellular processes, disease mechanisms, and to test new drugs or treatments. Some common types of human cell lines include HeLa cells (which come from a cancer patient named Henrietta Lacks), HEK293 cells (which come from embryonic kidney cells), and HUVEC cells (which come from umbilical vein endothelial cells). It is important to note that cell lines are not the same as primary cells, which are cells that are taken directly from a living organism and have not been grown in the lab.

Peptide Nucleic Acids (PNAs) are synthetic, artificially produced molecules that have a structure similar to both peptides (short chains of amino acids) and nucleic acids (DNA and RNA). They consist of repeating units called "monomers" made up of a pseudopeptide backbone with nucleobases attached. The backbone is composed of N-(2-aminoethyl)glycine units, which replace the sugar-phosphate backbone found in natural nucleic acids.

PNAs are known for their high binding affinity and sequence-specific recognition of DNA and RNA molecules. They can form stable complexes with complementary DNA or RNA strands through Watson-Crick base pairing, even under conditions where normal nucleic acid hybridization is poor. This property makes them valuable tools in molecular biology for various applications such as:

1. Gene regulation and silencing
2. Antisense and antigen technologies
3. Diagnostics and biosensors
4. Study of protein-DNA interactions
5. DNA repair and mutation analysis

However, it is important to note that Peptide Nucleic Acids are not naturally occurring molecules; they are entirely synthetic and must be produced in a laboratory setting.

Epinephrine, also known as adrenaline, is a hormone and a neurotransmitter that is produced in the body. It is released by the adrenal glands in response to stress or excitement, and it prepares the body for the "fight or flight" response. Epinephrine works by binding to specific receptors in the body, which causes a variety of physiological effects, including increased heart rate and blood pressure, improved muscle strength and alertness, and narrowing of the blood vessels in the skin and intestines. It is also used as a medication to treat various medical conditions, such as anaphylaxis (a severe allergic reaction), cardiac arrest, and low blood pressure.

High-performance liquid chromatography (HPLC) is a type of chromatography that separates and analyzes compounds based on their interactions with a stationary phase and a mobile phase under high pressure. The mobile phase, which can be a gas or liquid, carries the sample mixture through a column containing the stationary phase.

In HPLC, the mobile phase is a liquid, and it is pumped through the column at high pressures (up to several hundred atmospheres) to achieve faster separation times and better resolution than other types of liquid chromatography. The stationary phase can be a solid or a liquid supported on a solid, and it interacts differently with each component in the sample mixture, causing them to separate as they travel through the column.

HPLC is widely used in analytical chemistry, pharmaceuticals, biotechnology, and other fields to separate, identify, and quantify compounds present in complex mixtures. It can be used to analyze a wide range of substances, including drugs, hormones, vitamins, pigments, flavors, and pollutants. HPLC is also used in the preparation of pure samples for further study or use.

Gastrointestinal (GI) hormone receptors are specialized protein structures found on the surface of cells in the gastrointestinal tract. These receptors recognize and respond to specific hormones that are released by enteroendocrine cells in the GI tract. Examples of GI hormones include gastrin, secretin, cholecystokinin (CCK), motilin, and ghrelin.

When a GI hormone binds to its specific receptor, it triggers a series of intracellular signaling events that ultimately lead to changes in cell function. These changes can include increased or decreased secretion of digestive enzymes, altered motility (movement) of the GI tract, and regulation of appetite and satiety.

Abnormalities in GI hormone receptors have been implicated in a variety of gastrointestinal disorders, including functional dyspepsia, irritable bowel syndrome, and obesity. Therefore, understanding the role of these receptors in GI physiology and pathophysiology is an important area of research.

"Cells, cultured" is a medical term that refers to cells that have been removed from an organism and grown in controlled laboratory conditions outside of the body. This process is called cell culture and it allows scientists to study cells in a more controlled and accessible environment than they would have inside the body. Cultured cells can be derived from a variety of sources, including tissues, organs, or fluids from humans, animals, or cell lines that have been previously established in the laboratory.

Cell culture involves several steps, including isolation of the cells from the tissue, purification and characterization of the cells, and maintenance of the cells in appropriate growth conditions. The cells are typically grown in specialized media that contain nutrients, growth factors, and other components necessary for their survival and proliferation. Cultured cells can be used for a variety of purposes, including basic research, drug development and testing, and production of biological products such as vaccines and gene therapies.

It is important to note that cultured cells may behave differently than they do in the body, and results obtained from cell culture studies may not always translate directly to human physiology or disease. Therefore, it is essential to validate findings from cell culture experiments using additional models and ultimately in clinical trials involving human subjects.

C-type Natriuretic Peptide (CNP) is a member of the natriuretic peptide family, which are hormones that play crucial roles in cardiovascular homeostasis and renal function. The natriuretic peptides include atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and C-type natriuretic peptide (CNP).

C-type Natriuretic Peptide is primarily produced and secreted by the endothelial cells, and to a lesser extent by the central nervous system, chondrocytes, and vascular smooth muscle cells. CNP has a relatively short half-life of approximately 2 minutes due to its rapid clearance by the natriuretic peptide receptor-C (NPR-C) and neutral endopeptidase (NEP).

The primary physiological function of C-type Natriuretic Peptide is to regulate vascular tone, endothelial cell growth, differentiation, and survival. It also plays a role in bone development and maintenance by promoting chondrocyte proliferation and differentiation. In the kidney, CNP influences renal function through its effects on natriuresis (sodium excretion), diuresis (water excretion), and vasodilation of the afferent arteriole.

CNP binds to the NPR-B receptor, which is widely expressed in various tissues, including vascular endothelial cells, cardiomyocytes, osteoblasts, chondrocytes, and neurons. The activation of NPR-B leads to increased intracellular cyclic guanosine monophosphate (cGMP) levels, which in turn activates protein kinase G (PKG), resulting in vasodilation, anti-proliferative, and natriuretic effects.

Dysregulation of C-type Natriuretic Peptide has been implicated in several pathological conditions, such as cardiovascular diseases, bone disorders, and cancer. Therefore, understanding the role of CNP in these processes may provide novel therapeutic targets for treating these diseases.

Secondary protein structure refers to the local spatial arrangement of amino acid chains in a protein, typically described as regular repeating patterns held together by hydrogen bonds. The two most common types of secondary structures are the alpha-helix (α-helix) and the beta-pleated sheet (β-sheet). In an α-helix, the polypeptide chain twists around itself in a helical shape, with each backbone atom forming a hydrogen bond with the fourth amino acid residue along the chain. This forms a rigid rod-like structure that is resistant to bending or twisting forces. In β-sheets, adjacent segments of the polypeptide chain run parallel or antiparallel to each other and are connected by hydrogen bonds, forming a pleated sheet-like arrangement. These secondary structures provide the foundation for the formation of tertiary and quaternary protein structures, which determine the overall three-dimensional shape and function of the protein.

A Structure-Activity Relationship (SAR) in the context of medicinal chemistry and pharmacology refers to the relationship between the chemical structure of a drug or molecule and its biological activity or effect on a target protein, cell, or organism. SAR studies aim to identify patterns and correlations between structural features of a compound and its ability to interact with a specific biological target, leading to a desired therapeutic response or undesired side effects.

By analyzing the SAR, researchers can optimize the chemical structure of lead compounds to enhance their potency, selectivity, safety, and pharmacokinetic properties, ultimately guiding the design and development of novel drugs with improved efficacy and reduced toxicity.

Natriuretic peptides are a group of hormones that help regulate the balance of sodium and water in the body, as well as blood volume and blood pressure. They are produced by the heart and other tissues in response to stretching or distension of the cells due to increased fluid volume.

There are several types of natriuretic peptides, including:

1. Atrial natriuretic peptide (ANP): This hormone is produced by the atria of the heart in response to stretching of the atrial walls caused by increased blood volume. ANP promotes sodium and water excretion by the kidneys, which helps lower blood pressure and reduce fluid volume.
2. Brain natriuretic peptide (BNP): This hormone is produced by the ventricles of the heart in response to stretching of the ventricular walls caused by increased blood volume or pressure. BNP also promotes sodium and water excretion by the kidneys, as well as dilating blood vessels and reducing the force of heart contractions.
3. C-type natriuretic peptide (CNP): This hormone is produced by endothelial cells lining the blood vessels and has similar effects to ANP and BNP, but its main role is to regulate bone growth and development.

Natriuretic peptides have important diagnostic and therapeutic implications in various medical conditions, such as heart failure, hypertension, and kidney disease. Elevated levels of natriuretic peptides may indicate the presence of cardiac dysfunction or damage, while administering synthetic forms of these hormones has been shown to have beneficial effects on blood pressure, fluid balance, and cardiovascular function.

Sequence homology, amino acid, refers to the similarity in the order of amino acids in a protein or a portion of a protein between two or more species. This similarity can be used to infer evolutionary relationships and functional similarities between proteins. The higher the degree of sequence homology, the more likely it is that the proteins are related and have similar functions. Sequence homology can be determined through various methods such as pairwise alignment or multiple sequence alignment, which compare the sequences and calculate a score based on the number and type of matching amino acids.

Peptide hydrolases, also known as proteases or peptidases, are a group of enzymes that catalyze the hydrolysis of peptide bonds in proteins and peptides. They play a crucial role in various biological processes such as protein degradation, digestion, cell signaling, and regulation of various physiological functions. Based on their catalytic mechanism and the specificity for the peptide bond, they are classified into several types, including serine proteases, cysteine proteases, aspartic proteases, and metalloproteases. These enzymes have important clinical applications in the diagnosis and treatment of various diseases, such as cancer, viral infections, and inflammatory disorders.

Gastrin-Releasing Peptide (GRP) is defined as a 27-amino acid peptide that shares structural and functional similarities with the C-terminal part of gastrin. It is widely distributed in the central and peripheral nervous systems, where it functions as a neurotransmitter or neuromodulator. GRP plays a crucial role in various physiological processes such as regulation of gastrointestinal motility, smooth muscle relaxation, and mucous secretion. Additionally, GRP has been implicated in several pathophysiological conditions, including cancer, where it can act as a growth factor for certain types of tumors, such as small cell lung carcinoma.

An epitope is a specific region on the surface of an antigen (a molecule that can trigger an immune response) that is recognized by an antibody, B-cell receptor, or T-cell receptor. It is also commonly referred to as an antigenic determinant. Epitopes are typically composed of linear amino acid sequences or conformational structures made up of discontinuous amino acids in the antigen. They play a crucial role in the immune system's ability to differentiate between self and non-self molecules, leading to the targeted destruction of foreign substances like viruses and bacteria. Understanding epitopes is essential for developing vaccines, diagnostic tests, and immunotherapies.

Adenylate cyclase is an enzyme that catalyzes the conversion of adenosine triphosphate (ATP) to cyclic adenosine monophosphate (cAMP). It plays a crucial role in various cellular processes, including signal transduction and metabolism. Adenylate cyclase is activated by hormones and neurotransmitters that bind to G-protein-coupled receptors on the cell membrane, leading to the production of cAMP, which then acts as a second messenger to regulate various intracellular responses. There are several isoforms of adenylate cyclase, each with distinct regulatory properties and subcellular localization.

Formyl peptide receptors (FPRs) are a type of G protein-coupled receptors that play a crucial role in the innate immune system. They are expressed on various cells including neutrophils, monocytes, and macrophages. FPRs recognize and respond to formylated peptides derived from bacteria, mitochondria, and host proteins during cell damage or stress. Activation of FPRs triggers a variety of cellular responses, such as chemotaxis, phagocytosis, and release of inflammatory mediators, which help to eliminate invading pathogens and promote tissue repair. There are three subtypes of human FPRs (FPR1, FPR2, and FPR3) that have distinct ligand specificities and functions in the immune response.

A cell membrane, also known as the plasma membrane, is a thin semi-permeable phospholipid bilayer that surrounds all cells in animals, plants, and microorganisms. It functions as a barrier to control the movement of substances in and out of the cell, allowing necessary molecules such as nutrients, oxygen, and signaling molecules to enter while keeping out harmful substances and waste products. The cell membrane is composed mainly of phospholipids, which have hydrophilic (water-loving) heads and hydrophobic (water-fearing) tails. This unique structure allows the membrane to be flexible and fluid, yet selectively permeable. Additionally, various proteins are embedded in the membrane that serve as channels, pumps, receptors, and enzymes, contributing to the cell's overall functionality and communication with its environment.

I believe there might be a misunderstanding in your question. "Dogs" is not a medical term or condition. It is the common name for a domesticated carnivore of the family Canidae, specifically the genus Canis, which includes wolves, foxes, and other extant and extinct species of mammals. Dogs are often kept as pets and companions, and they have been bred in a wide variety of forms and sizes for different purposes, such as hunting, herding, guarding, assisting police and military forces, and providing companionship and emotional support.

If you meant to ask about a specific medical condition or term related to dogs, please provide more context so I can give you an accurate answer.

Gastrointestinal (GI) hormones are a group of hormones that are secreted by cells in the gastrointestinal tract in response to food intake and digestion. They play crucial roles in regulating various physiological processes, including appetite regulation, gastric acid secretion, motility of the gastrointestinal tract, insulin secretion, and pancreatic enzyme release.

Examples of GI hormones include:

* Gastrin: Secreted by G cells in the stomach, gastrin stimulates the release of hydrochloric acid from parietal cells in the stomach lining.
* Ghrelin: Produced by the stomach, ghrelin is often referred to as the "hunger hormone" because it stimulates appetite and food intake.
* Cholecystokinin (CCK): Secreted by I cells in the small intestine, CCK promotes digestion by stimulating the release of pancreatic enzymes and bile from the liver. It also inhibits gastric emptying and reduces appetite.
* Gastric inhibitory peptide (GIP): Produced by K cells in the small intestine, GIP promotes insulin secretion and inhibits glucagon release.
* Secretin: Released by S cells in the small intestine, secretin stimulates the pancreas to produce bicarbonate-rich fluid that neutralizes stomach acid in the duodenum.
* Motilin: Secreted by MO cells in the small intestine, motilin promotes gastrointestinal motility and regulates the migrating motor complex (MMC), which is responsible for cleaning out the small intestine between meals.

These hormones work together to regulate digestion and maintain homeostasis in the body. Dysregulation of GI hormones can contribute to various gastrointestinal disorders, such as gastroparesis, irritable bowel syndrome (IBS), and diabetes.

Peptide synthases are a group of enzymes that catalyze the formation of peptide bonds between specific amino acids to produce peptides or proteins. They are responsible for the biosynthesis of many natural products, including antibiotics, bacterial toxins, and immunomodulatory peptides.

Peptide synthases are large, complex enzymes that consist of multiple domains and modules, each of which is responsible for activating and condensing specific amino acids. The activation of amino acids involves the formation of an aminoacyl-adenylate intermediate, followed by transfer of the activated amino acid to a thiol group on the enzyme. The condensation of two activated amino acids results in the formation of a peptide bond and release of adenosine monophosphate (AMP) and pyrophosphate.

Peptide synthases are found in all three domains of life, but are most commonly associated with bacteria and fungi. They play important roles in the biosynthesis of many natural products that have therapeutic potential, making them targets for drug discovery and development.

Peptide receptors are a type of cell surface receptor that bind to peptide hormones and neurotransmitters. These receptors play crucial roles in various physiological processes, including regulation of appetite, pain perception, immune function, and cardiovascular homeostasis. Peptide receptors belong to the G protein-coupled receptor (GPCR) superfamily or the tyrosine kinase receptor family. Upon binding of a peptide ligand, these receptors activate intracellular signaling cascades that ultimately lead to changes in cell behavior and communication with other cells.

Peptide receptors can be classified into two main categories: metabotropic and ionotropic. Metabotropic peptide receptors are GPCRs, which activate intracellular signaling pathways through coupling with heterotrimeric G proteins. These receptors typically have seven transmembrane domains and undergo conformational changes upon ligand binding, leading to the activation of downstream effectors such as adenylyl cyclase, phospholipase C, or ion channels.

Ionotropic peptide receptors are ligand-gated ion channels that directly modulate ion fluxes across the cell membrane upon ligand binding. These receptors contain four or five subunits arranged around a central pore and undergo conformational changes to allow ion flow through the channel.

Examples of peptide receptors include:

1. Opioid receptors (μ, δ, κ) - bind endogenous opioid peptides such as enkephalins, endorphins, and dynorphins to modulate pain perception and reward processing.
2. Somatostatin receptors (SSTR1-5) - bind somatostatin and cortistatin to regulate hormone secretion, cell proliferation, and angiogenesis.
3. Neuropeptide Y receptors (Y1-Y5) - bind neuropeptide Y to modulate feeding behavior, energy metabolism, and cardiovascular function.
4. Calcitonin gene-related peptide receptor (CGRP-R) - binds calcitonin gene-related peptide to mediate vasodilation and neurogenic inflammation.
5. Bradykinin B2 receptor (B2R) - binds bradykinin to induce pain, inflammation, and vasodilation.
6. Vasoactive intestinal polypeptide receptors (VPAC1, VPAC2) - bind vasoactive intestinal peptide to regulate neurotransmission, hormone secretion, and smooth muscle contraction.
7. Oxytocin receptor (OXTR) - binds oxytocin to mediate social bonding, maternal behavior, and uterine contractions during childbirth.
8. Angiotensin II type 1 receptor (AT1R) - binds angiotensin II to regulate blood pressure, fluid balance, and cell growth.

Mass spectrometry (MS) is an analytical technique used to identify and quantify the chemical components of a mixture or compound. It works by ionizing the sample, generating charged molecules or fragments, and then measuring their mass-to-charge ratio in a vacuum. The resulting mass spectrum provides information about the molecular weight and structure of the analytes, allowing for identification and characterization.

In simpler terms, mass spectrometry is a method used to determine what chemicals are present in a sample and in what quantities, by converting the chemicals into ions, measuring their masses, and generating a spectrum that shows the relative abundances of each ion type.

Liver glycogen is the reserve form of glucose stored in hepatocytes (liver cells) for the maintenance of normal blood sugar levels. It is a polysaccharide, a complex carbohydrate, that is broken down into glucose molecules when blood glucose levels are low. This process helps to maintain the body's energy needs between meals and during periods of fasting or exercise. The amount of glycogen stored in the liver can vary depending on factors such as meal consumption, activity level, and insulin regulation.

Trypsin is a proteolytic enzyme, specifically a serine protease, that is secreted by the pancreas as an inactive precursor, trypsinogen. Trypsinogen is converted into its active form, trypsin, in the small intestine by enterokinase, which is produced by the intestinal mucosa.

Trypsin plays a crucial role in digestion by cleaving proteins into smaller peptides at specific arginine and lysine residues. This enzyme helps to break down dietary proteins into amino acids, allowing for their absorption and utilization by the body. Additionally, trypsin can activate other zymogenic pancreatic enzymes, such as chymotrypsinogen and procarboxypeptidases, thereby contributing to overall protein digestion.

Atrial natriuretic factor (ANF), also known as atrial natriuretic peptide (ANP), is a hormone that is primarily produced and secreted by the atria of the heart in response to stretching of the cardiac muscle cells due to increased blood volume. ANF plays a crucial role in regulating body fluid homeostasis, blood pressure, and cardiovascular function.

The main physiological action of ANF is to promote sodium and water excretion by the kidneys, which helps lower blood volume and reduce blood pressure. ANF also relaxes vascular smooth muscle, dilates blood vessels, and inhibits the renin-angiotensin-aldosterone system (RAAS), further contributing to its blood pressure-lowering effects.

Defects in ANF production or action have been implicated in several cardiovascular disorders, including heart failure, hypertension, and kidney disease. Therefore, ANF and its analogs are being investigated as potential therapeutic agents for the treatment of these conditions.

A dose-response relationship in the context of drugs refers to the changes in the effects or symptoms that occur as the dose of a drug is increased or decreased. Generally, as the dose of a drug is increased, the severity or intensity of its effects also increases. Conversely, as the dose is decreased, the effects of the drug become less severe or may disappear altogether.

The dose-response relationship is an important concept in pharmacology and toxicology because it helps to establish the safe and effective dosage range for a drug. By understanding how changes in the dose of a drug affect its therapeutic and adverse effects, healthcare providers can optimize treatment plans for their patients while minimizing the risk of harm.

The dose-response relationship is typically depicted as a curve that shows the relationship between the dose of a drug and its effect. The shape of the curve may vary depending on the drug and the specific effect being measured. Some drugs may have a steep dose-response curve, meaning that small changes in the dose can result in large differences in the effect. Other drugs may have a more gradual dose-response curve, where larger changes in the dose are needed to produce significant effects.

In addition to helping establish safe and effective dosages, the dose-response relationship is also used to evaluate the potential therapeutic benefits and risks of new drugs during clinical trials. By systematically testing different doses of a drug in controlled studies, researchers can identify the optimal dosage range for the drug and assess its safety and efficacy.

Tertiary protein structure refers to the three-dimensional arrangement of all the elements (polypeptide chains) of a single protein molecule. It is the highest level of structural organization and results from interactions between various side chains (R groups) of the amino acids that make up the protein. These interactions, which include hydrogen bonds, ionic bonds, van der Waals forces, and disulfide bridges, give the protein its unique shape and stability, which in turn determines its function. The tertiary structure of a protein can be stabilized by various factors such as temperature, pH, and the presence of certain ions. Any changes in these factors can lead to denaturation, where the protein loses its tertiary structure and thus its function.

Recombinant proteins are artificially created proteins produced through the use of recombinant DNA technology. This process involves combining DNA molecules from different sources to create a new set of genes that encode for a specific protein. The resulting recombinant protein can then be expressed, purified, and used for various applications in research, medicine, and industry.

Recombinant proteins are widely used in biomedical research to study protein function, structure, and interactions. They are also used in the development of diagnostic tests, vaccines, and therapeutic drugs. For example, recombinant insulin is a common treatment for diabetes, while recombinant human growth hormone is used to treat growth disorders.

The production of recombinant proteins typically involves the use of host cells, such as bacteria, yeast, or mammalian cells, which are engineered to express the desired protein. The host cells are transformed with a plasmid vector containing the gene of interest, along with regulatory elements that control its expression. Once the host cells are cultured and the protein is expressed, it can be purified using various chromatography techniques.

Overall, recombinant proteins have revolutionized many areas of biology and medicine, enabling researchers to study and manipulate proteins in ways that were previously impossible.

Arginine is an α-amino acid that is classified as a semi-essential or conditionally essential amino acid, depending on the developmental stage and health status of the individual. The adult human body can normally synthesize sufficient amounts of arginine to meet its needs, but there are certain circumstances, such as periods of rapid growth or injury, where the dietary intake of arginine may become necessary.

The chemical formula for arginine is C6H14N4O2. It has a molecular weight of 174.20 g/mol and a pKa value of 12.48. Arginine is a basic amino acid, which means that it contains a side chain with a positive charge at physiological pH levels. The side chain of arginine is composed of a guanidino group, which is a functional group consisting of a nitrogen atom bonded to three methyl groups.

In the body, arginine plays several important roles. It is a precursor for the synthesis of nitric oxide, a molecule that helps regulate blood flow and immune function. Arginine is also involved in the detoxification of ammonia, a waste product produced by the breakdown of proteins. Additionally, arginine can be converted into other amino acids, such as ornithine and citrulline, which are involved in various metabolic processes.

Foods that are good sources of arginine include meat, poultry, fish, dairy products, nuts, seeds, and legumes. Arginine supplements are available and may be used for a variety of purposes, such as improving exercise performance, enhancing wound healing, and boosting immune function. However, it is important to consult with a healthcare provider before taking arginine supplements, as they can interact with certain medications and have potential side effects.

Molecular cloning is a laboratory technique used to create multiple copies of a specific DNA sequence. This process involves several steps:

1. Isolation: The first step in molecular cloning is to isolate the DNA sequence of interest from the rest of the genomic DNA. This can be done using various methods such as PCR (polymerase chain reaction), restriction enzymes, or hybridization.
2. Vector construction: Once the DNA sequence of interest has been isolated, it must be inserted into a vector, which is a small circular DNA molecule that can replicate independently in a host cell. Common vectors used in molecular cloning include plasmids and phages.
3. Transformation: The constructed vector is then introduced into a host cell, usually a bacterial or yeast cell, through a process called transformation. This can be done using various methods such as electroporation or chemical transformation.
4. Selection: After transformation, the host cells are grown in selective media that allow only those cells containing the vector to grow. This ensures that the DNA sequence of interest has been successfully cloned into the vector.
5. Amplification: Once the host cells have been selected, they can be grown in large quantities to amplify the number of copies of the cloned DNA sequence.

Molecular cloning is a powerful tool in molecular biology and has numerous applications, including the production of recombinant proteins, gene therapy, functional analysis of genes, and genetic engineering.

Peptide hormones are a type of hormone consisting of short chains of amino acids known as peptides. They are produced and released by various endocrine glands and play crucial roles in regulating many physiological processes in the body, including growth and development, metabolism, stress response, and reproductive functions.

Peptide hormones exert their effects by binding to specific receptors on the surface of target cells, which triggers a series of intracellular signaling events that ultimately lead to changes in cell behavior or function. Some examples of peptide hormones include insulin, glucagon, growth hormone, prolactin, oxytocin, and vasopressin.

Peptide hormones are synthesized as larger precursor proteins called prohormones, which are cleaved by enzymes to release the active peptide hormone. They are water-soluble and cannot pass through the cell membrane, so they exert their effects through autocrine, paracrine, or endocrine mechanisms. Autocrine signaling occurs when a cell releases a hormone that binds to receptors on the same cell, while paracrine signaling involves the release of a hormone that acts on nearby cells. Endocrine signaling, on the other hand, involves the release of a hormone into the bloodstream, which then travels to distant target cells to exert its effects.

"Competitive binding" is a term used in pharmacology and biochemistry to describe the behavior of two or more molecules (ligands) competing for the same binding site on a target protein or receptor. In this context, "binding" refers to the physical interaction between a ligand and its target.

When a ligand binds to a receptor, it can alter the receptor's function, either activating or inhibiting it. If multiple ligands compete for the same binding site, they will compete to bind to the receptor. The ability of each ligand to bind to the receptor is influenced by its affinity for the receptor, which is a measure of how strongly and specifically the ligand binds to the receptor.

In competitive binding, if one ligand is present in high concentrations, it can prevent other ligands with lower affinity from binding to the receptor. This is because the higher-affinity ligand will have a greater probability of occupying the binding site and blocking access to the other ligands. The competition between ligands can be described mathematically using equations such as the Langmuir isotherm, which describes the relationship between the concentration of ligand and the fraction of receptors that are occupied by the ligand.

Competitive binding is an important concept in drug development, as it can be used to predict how different drugs will interact with their targets and how they may affect each other's activity. By understanding the competitive binding properties of a drug, researchers can optimize its dosage and delivery to maximize its therapeutic effect while minimizing unwanted side effects.

Hormones are defined as chemical messengers that are produced by endocrine glands or specialized cells and are transported through the bloodstream to tissues and organs, where they elicit specific responses. They play crucial roles in regulating various physiological processes such as growth, development, metabolism, reproduction, and mood. Examples of hormones include insulin, estrogen, testosterone, adrenaline, and thyroxine.

Radioimmunoassay (RIA) is a highly sensitive analytical technique used in clinical and research laboratories to measure concentrations of various substances, such as hormones, vitamins, drugs, or tumor markers, in biological samples like blood, urine, or tissues. The method relies on the specific interaction between an antibody and its corresponding antigen, combined with the use of radioisotopes to quantify the amount of bound antigen.

In a typical RIA procedure, a known quantity of a radiolabeled antigen (also called tracer) is added to a sample containing an unknown concentration of the same unlabeled antigen. The mixture is then incubated with a specific antibody that binds to the antigen. During the incubation period, the antibody forms complexes with both the radiolabeled and unlabeled antigens.

After the incubation, the unbound (free) radiolabeled antigen is separated from the antibody-antigen complexes, usually through a precipitation or separation step involving centrifugation, filtration, or chromatography. The amount of radioactivity in the pellet (containing the antibody-antigen complexes) is then measured using a gamma counter or other suitable radiation detection device.

The concentration of the unlabeled antigen in the sample can be determined by comparing the ratio of bound to free radiolabeled antigen in the sample to a standard curve generated from known concentrations of unlabeled antigen and their corresponding bound/free ratios. The higher the concentration of unlabeled antigen in the sample, the lower the amount of radiolabeled antigen that will bind to the antibody, resulting in a lower bound/free ratio.

Radioimmunoassays offer high sensitivity, specificity, and accuracy, making them valuable tools for detecting and quantifying low levels of various substances in biological samples. However, due to concerns about radiation safety and waste disposal, alternative non-isotopic immunoassay techniques like enzyme-linked immunosorbent assays (ELISAs) have become more popular in recent years.

Secretin is a hormone that is produced and released by the S cells in the duodenum, which is the first part of the small intestine. It is released in response to the presence of acidic chyme (partially digested food) entering the duodenum from the stomach. Secretin stimulates the pancreas to produce bicarbonate-rich alkaline secretions, which help neutralize the acidity of the chyme and create an optimal environment for enzymatic digestion in the small intestine.

Additionally, secretin also promotes the production of watery fluids from the liver, which aids in the digestion process. Overall, secretin plays a crucial role in maintaining the pH balance and facilitating proper nutrient absorption in the gastrointestinal tract.

In the field of medicine, "time factors" refer to the duration of symptoms or time elapsed since the onset of a medical condition, which can have significant implications for diagnosis and treatment. Understanding time factors is crucial in determining the progression of a disease, evaluating the effectiveness of treatments, and making critical decisions regarding patient care.

For example, in stroke management, "time is brain," meaning that rapid intervention within a specific time frame (usually within 4.5 hours) is essential to administering tissue plasminogen activator (tPA), a clot-busting drug that can minimize brain damage and improve patient outcomes. Similarly, in trauma care, the "golden hour" concept emphasizes the importance of providing definitive care within the first 60 minutes after injury to increase survival rates and reduce morbidity.

Time factors also play a role in monitoring the progression of chronic conditions like diabetes or heart disease, where regular follow-ups and assessments help determine appropriate treatment adjustments and prevent complications. In infectious diseases, time factors are crucial for initiating antibiotic therapy and identifying potential outbreaks to control their spread.

Overall, "time factors" encompass the significance of recognizing and acting promptly in various medical scenarios to optimize patient outcomes and provide effective care.

"Cattle" is a term used in the agricultural and veterinary fields to refer to domesticated animals of the genus *Bos*, primarily *Bos taurus* (European cattle) and *Bos indicus* (Zebu). These animals are often raised for meat, milk, leather, and labor. They are also known as bovines or cows (for females), bulls (intact males), and steers/bullocks (castrated males). However, in a strict medical definition, "cattle" does not apply to humans or other animals.

Molecular weight, also known as molecular mass, is the mass of a molecule. It is expressed in units of atomic mass units (amu) or daltons (Da). Molecular weight is calculated by adding up the atomic weights of each atom in a molecule. It is a useful property in chemistry and biology, as it can be used to determine the concentration of a substance in a solution, or to calculate the amount of a substance that will react with another in a chemical reaction.

Proteins are complex, large molecules that play critical roles in the body's functions. They are made up of amino acids, which are organic compounds that are the building blocks of proteins. Proteins are required for the structure, function, and regulation of the body's tissues and organs. They are essential for the growth, repair, and maintenance of body tissues, and they play a crucial role in many biological processes, including metabolism, immune response, and cellular signaling. Proteins can be classified into different types based on their structure and function, such as enzymes, hormones, antibodies, and structural proteins. They are found in various foods, especially animal-derived products like meat, dairy, and eggs, as well as plant-based sources like beans, nuts, and grains.

Fasting is defined in medical terms as the abstinence from food or drink for a period of time. This practice is often recommended before certain medical tests or procedures, as it helps to ensure that the results are not affected by recent eating or drinking.

In some cases, fasting may also be used as a therapeutic intervention, such as in the management of seizures or other neurological conditions. Fasting can help to lower blood sugar and insulin levels, which can have a variety of health benefits. However, it is important to note that prolonged fasting can also have negative effects on the body, including malnutrition, dehydration, and electrolyte imbalances.

Fasting is also a spiritual practice in many religions, including Christianity, Islam, Buddhism, and Hinduism. In these contexts, fasting is often seen as a way to purify the mind and body, to focus on spiritual practices, or to express devotion or mourning.

Substrate specificity in the context of medical biochemistry and enzymology refers to the ability of an enzyme to selectively bind and catalyze a chemical reaction with a particular substrate (or a group of similar substrates) while discriminating against other molecules that are not substrates. This specificity arises from the three-dimensional structure of the enzyme, which has evolved to match the shape, charge distribution, and functional groups of its physiological substrate(s).

Substrate specificity is a fundamental property of enzymes that enables them to carry out highly selective chemical transformations in the complex cellular environment. The active site of an enzyme, where the catalysis takes place, has a unique conformation that complements the shape and charge distribution of its substrate(s). This ensures efficient recognition, binding, and conversion of the substrate into the desired product while minimizing unwanted side reactions with other molecules.

Substrate specificity can be categorized as:

1. Absolute specificity: An enzyme that can only act on a single substrate or a very narrow group of structurally related substrates, showing no activity towards any other molecule.
2. Group specificity: An enzyme that prefers to act on a particular functional group or class of compounds but can still accommodate minor structural variations within the substrate.
3. Broad or promiscuous specificity: An enzyme that can act on a wide range of structurally diverse substrates, albeit with varying catalytic efficiencies.

Understanding substrate specificity is crucial for elucidating enzymatic mechanisms, designing drugs that target specific enzymes or pathways, and developing biotechnological applications that rely on the controlled manipulation of enzyme activities.

Vasoactive Intestinal Peptide (VIP) receptors are a type of G-protein coupled receptor found in various tissues and organs throughout the body, including the heart, blood vessels, lungs, gastrointestinal tract, and nervous system. These receptors bind to VIP, a neuropeptide that acts as a potent vasodilator, increasing blood flow and reducing vascular resistance.

There are two main types of VIP receptors: VPAC1 and VPAC2. Both receptor subtypes have similar structures and functions, but they differ in their distribution throughout the body and their sensitivity to different ligands. For example, VPAC1 is more abundant in the heart, lungs, and gastrointestinal tract, while VPAC2 is more prevalent in the nervous system and endocrine organs.

VIP receptors play important roles in regulating various physiological processes, including cardiovascular function, smooth muscle relaxation, neurotransmission, and immune response. Abnormalities in VIP signaling have been implicated in a variety of diseases, including inflammatory disorders, neurological conditions, and cancer.

In summary, Vasoactive Intestinal Peptide (VIP) receptors are a type of G-protein coupled receptor that bind to the neuropeptide VIP and play important roles in regulating various physiological processes throughout the body.

Intracellular signaling peptides and proteins are molecules that play a crucial role in transmitting signals within cells, which ultimately lead to changes in cell behavior or function. These signals can originate from outside the cell (extracellular) or within the cell itself. Intracellular signaling molecules include various types of peptides and proteins, such as:

1. G-protein coupled receptors (GPCRs): These are seven-transmembrane domain receptors that bind to extracellular signaling molecules like hormones, neurotransmitters, or chemokines. Upon activation, they initiate a cascade of intracellular signals through G proteins and secondary messengers.
2. Receptor tyrosine kinases (RTKs): These are transmembrane receptors that bind to growth factors, cytokines, or hormones. Activation of RTKs leads to autophosphorylation of specific tyrosine residues, creating binding sites for intracellular signaling proteins such as adapter proteins, phosphatases, and enzymes like Ras, PI3K, and Src family kinases.
3. Second messenger systems: Intracellular second messengers are small molecules that amplify and propagate signals within the cell. Examples include cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), diacylglycerol (DAG), inositol triphosphate (IP3), calcium ions (Ca2+), and nitric oxide (NO). These second messengers activate or inhibit various downstream effectors, leading to changes in cellular responses.
4. Signal transduction cascades: Intracellular signaling proteins often form complex networks of interacting molecules that relay signals from the plasma membrane to the nucleus. These cascades involve kinases (protein kinases A, B, C, etc.), phosphatases, and adapter proteins, which ultimately regulate gene expression, cell cycle progression, metabolism, and other cellular processes.
5. Ubiquitination and proteasome degradation: Intracellular signaling pathways can also control protein stability by modulating ubiquitin-proteasome degradation. E3 ubiquitin ligases recognize specific substrates and conjugate them with ubiquitin molecules, targeting them for proteasomal degradation. This process regulates the abundance of key signaling proteins and contributes to signal termination or amplification.

In summary, intracellular signaling pathways involve a complex network of interacting proteins that relay signals from the plasma membrane to various cellular compartments, ultimately regulating gene expression, metabolism, and other cellular processes. Dysregulation of these pathways can contribute to disease development and progression, making them attractive targets for therapeutic intervention.

C-peptide is a byproduct that is produced when the hormone insulin is generated in the body. Insulin is a hormone that helps regulate blood sugar levels, and it is produced in the pancreas by specialized cells called beta cells. When these cells produce insulin, they also generate C-peptide as a part of the same process.

C-peptide is often used as a marker to measure the body's insulin production. By measuring C-peptide levels in the blood, healthcare providers can get an idea of how much insulin the body is producing on its own. This can be helpful in diagnosing and monitoring conditions such as diabetes, which is characterized by impaired insulin production or function.

It's worth noting that C-peptide is not typically used as a treatment for any medical conditions. Instead, it is primarily used as a diagnostic tool to help healthcare providers better understand their patients' health status and make informed treatment decisions.

Opioid peptides are naturally occurring short chains of amino acids in the body that bind to opioid receptors in the brain, spinal cord, and gut, acting in a similar way to opiate drugs like morphine or heroin. They play crucial roles in pain regulation, reward systems, and addictive behaviors. Some examples of opioid peptides include endorphins, enkephalins, and dynorphins. These substances are released in response to stress, physical exertion, or injury and help modulate the perception of pain and produce feelings of pleasure or euphoria.

Oxyntomodulin is a hormone that is produced and released by the intestines in response to food consumption. It is a 37-amino acid peptide, derived from the preproglucagon gene, which also encodes several other related peptides such as glucagon and GLP-1 (Glucagon-Like Peptide-1).

Oxyntomodulin has two primary effects on the body:

1. Incretin effect: Oxyntomodulin acts as an incretin hormone, which means that it enhances the secretion of insulin and inhibits the release of glucagon in response to a meal. This helps to regulate blood sugar levels and maintain metabolic homeostasis.
2. Appetite regulation: Oxyntomodulin also acts on the hypothalamus to suppress appetite and promote weight loss. It does this by activating receptors in the brain that signal satiety, leading to a decrease in food intake.

Overall, oxyntomodulin plays an important role in regulating energy balance, glucose metabolism, and body weight.

Electrophoresis, polyacrylamide gel (EPG) is a laboratory technique used to separate and analyze complex mixtures of proteins or nucleic acids (DNA or RNA) based on their size and electrical charge. This technique utilizes a matrix made of cross-linked polyacrylamide, a type of gel, which provides a stable and uniform environment for the separation of molecules.

In this process:

1. The polyacrylamide gel is prepared by mixing acrylamide monomers with a cross-linking agent (bis-acrylamide) and a catalyst (ammonium persulfate) in the presence of a buffer solution.
2. The gel is then poured into a mold and allowed to polymerize, forming a solid matrix with uniform pore sizes that depend on the concentration of acrylamide used. Higher concentrations result in smaller pores, providing better resolution for separating smaller molecules.
3. Once the gel has set, it is placed in an electrophoresis apparatus containing a buffer solution. Samples containing the mixture of proteins or nucleic acids are loaded into wells on the top of the gel.
4. An electric field is applied across the gel, causing the negatively charged molecules to migrate towards the positive electrode (anode) while positively charged molecules move toward the negative electrode (cathode). The rate of migration depends on the size, charge, and shape of the molecules.
5. Smaller molecules move faster through the gel matrix and will migrate farther from the origin compared to larger molecules, resulting in separation based on size. Proteins and nucleic acids can be selectively stained after electrophoresis to visualize the separated bands.

EPG is widely used in various research fields, including molecular biology, genetics, proteomics, and forensic science, for applications such as protein characterization, DNA fragment analysis, cloning, mutation detection, and quality control of nucleic acid or protein samples.

Messenger RNA (mRNA) is a type of RNA (ribonucleic acid) that carries genetic information copied from DNA in the form of a series of three-base code "words," each of which specifies a particular amino acid. This information is used by the cell's machinery to construct proteins, a process known as translation. After being transcribed from DNA, mRNA travels out of the nucleus to the ribosomes in the cytoplasm where protein synthesis occurs. Once the protein has been synthesized, the mRNA may be degraded and recycled. Post-transcriptional modifications can also occur to mRNA, such as alternative splicing and addition of a 5' cap and a poly(A) tail, which can affect its stability, localization, and translation efficiency.

Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry (MALDI-MS) is a type of mass spectrometry that is used to analyze large biomolecules such as proteins and peptides. In this technique, the sample is mixed with a matrix compound, which absorbs laser energy and helps to vaporize and ionize the analyte molecules.

The matrix-analyte mixture is then placed on a target plate and hit with a laser beam, causing the matrix and analyte molecules to desorb from the plate and become ionized. The ions are then accelerated through an electric field and into a mass analyzer, which separates them based on their mass-to-charge ratio.

The separated ions are then detected and recorded as a mass spectrum, which can be used to identify and quantify the analyte molecules present in the sample. MALDI-MS is particularly useful for the analysis of complex biological samples, such as tissue extracts or biological fluids, because it allows for the detection and identification of individual components within those mixtures.

Molecular mimicry is a phenomenon in immunology where structurally similar molecules from different sources can induce cross-reactivity of the immune system. This means that an immune response against one molecule also recognizes and responds to another molecule due to their structural similarity, even though they may be from different origins.

In molecular mimicry, a foreign molecule (such as a bacterial or viral antigen) shares sequence or structural homology with self-antigens present in the host organism. The immune system might not distinguish between these two similar molecules, leading to an immune response against both the foreign and self-antigens. This can potentially result in autoimmune diseases, where the immune system attacks the body's own tissues or organs.

Molecular mimicry has been implicated as a possible mechanism for the development of several autoimmune disorders, including rheumatic fever, Guillain-Barré syndrome, and multiple sclerosis. However, it is essential to note that molecular mimicry alone may not be sufficient to trigger an autoimmune response; other factors like genetic predisposition and environmental triggers might also play a role in the development of these conditions.

'Escherichia coli' (E. coli) is a type of gram-negative, facultatively anaerobic, rod-shaped bacterium that commonly inhabits the intestinal tract of humans and warm-blooded animals. It is a member of the family Enterobacteriaceae and one of the most well-studied prokaryotic model organisms in molecular biology.

While most E. coli strains are harmless and even beneficial to their hosts, some serotypes can cause various forms of gastrointestinal and extraintestinal illnesses in humans and animals. These pathogenic strains possess virulence factors that enable them to colonize and damage host tissues, leading to diseases such as diarrhea, urinary tract infections, pneumonia, and sepsis.

E. coli is a versatile organism with remarkable genetic diversity, which allows it to adapt to various environmental niches. It can be found in water, soil, food, and various man-made environments, making it an essential indicator of fecal contamination and a common cause of foodborne illnesses. The study of E. coli has contributed significantly to our understanding of fundamental biological processes, including DNA replication, gene regulation, and protein synthesis.

Calcium is an essential mineral that is vital for various physiological processes in the human body. The medical definition of calcium is as follows:

Calcium (Ca2+) is a crucial cation and the most abundant mineral in the human body, with approximately 99% of it found in bones and teeth. It plays a vital role in maintaining structural integrity, nerve impulse transmission, muscle contraction, hormonal secretion, blood coagulation, and enzyme activation.

Calcium homeostasis is tightly regulated through the interplay of several hormones, including parathyroid hormone (PTH), calcitonin, and vitamin D. Dietary calcium intake, absorption, and excretion are also critical factors in maintaining optimal calcium levels in the body.

Hypocalcemia refers to low serum calcium levels, while hypercalcemia indicates high serum calcium levels. Both conditions can have detrimental effects on various organ systems and require medical intervention to correct.

Gastric Inhibitory Polypeptide (GIP) is a 42-amino acid long peptide hormone that is released from the K cells in the duodenum and jejunum of the small intestine in response to food intake, particularly carbohydrates and fats. It is also known as glucose-dependent insulinotropic polypeptide.

GIP has several physiological effects on the body, including:

* Incretin effect: GIP stimulates the release of insulin from the pancreas in a glucose-dependent manner, which means that it only increases insulin secretion when blood glucose levels are high. This is known as the incretin effect and helps to regulate postprandial glucose levels.
* Inhibition of gastric acid secretion: GIP inhibits the release of gastric acid from the stomach, which helps to protect the intestinal mucosa from damage caused by excessive acid production.
* Increase in blood flow: GIP increases blood flow to the intestines, which helps to facilitate nutrient absorption.
* Energy storage: GIP promotes the storage of energy by increasing fat synthesis and reducing fat breakdown in adipose tissue.

Overall, GIP plays an important role in regulating glucose metabolism, energy balance, and gastrointestinal function.

Recombinant fusion proteins are artificially created biomolecules that combine the functional domains or properties of two or more different proteins into a single protein entity. They are generated through recombinant DNA technology, where the genes encoding the desired protein domains are linked together and expressed as a single, chimeric gene in a host organism, such as bacteria, yeast, or mammalian cells.

The resulting fusion protein retains the functional properties of its individual constituent proteins, allowing for novel applications in research, diagnostics, and therapeutics. For instance, recombinant fusion proteins can be designed to enhance protein stability, solubility, or immunogenicity, making them valuable tools for studying protein-protein interactions, developing targeted therapies, or generating vaccines against infectious diseases or cancer.

Examples of recombinant fusion proteins include:

1. Etaglunatide (ABT-523): A soluble Fc fusion protein that combines the heavy chain fragment crystallizable region (Fc) of an immunoglobulin with the extracellular domain of the human interleukin-6 receptor (IL-6R). This fusion protein functions as a decoy receptor, neutralizing IL-6 and its downstream signaling pathways in rheumatoid arthritis.
2. Etanercept (Enbrel): A soluble TNF receptor p75 Fc fusion protein that binds to tumor necrosis factor-alpha (TNF-α) and inhibits its proinflammatory activity, making it a valuable therapeutic option for treating autoimmune diseases like rheumatoid arthritis, ankylosing spondylitis, and psoriasis.
3. Abatacept (Orencia): A fusion protein consisting of the extracellular domain of cytotoxic T-lymphocyte antigen 4 (CTLA-4) linked to the Fc region of an immunoglobulin, which downregulates T-cell activation and proliferation in autoimmune diseases like rheumatoid arthritis.
4. Belimumab (Benlysta): A monoclonal antibody that targets B-lymphocyte stimulator (BLyS) protein, preventing its interaction with the B-cell surface receptor and inhibiting B-cell activation in systemic lupus erythematosus (SLE).
5. Romiplostim (Nplate): A fusion protein consisting of a thrombopoietin receptor agonist peptide linked to an immunoglobulin Fc region, which stimulates platelet production in patients with chronic immune thrombocytopenia (ITP).
6. Darbepoetin alfa (Aranesp): A hyperglycosylated erythropoiesis-stimulating protein that functions as a longer-acting form of recombinant human erythropoietin, used to treat anemia in patients with chronic kidney disease or cancer.
7. Palivizumab (Synagis): A monoclonal antibody directed against the F protein of respiratory syncytial virus (RSV), which prevents RSV infection and is administered prophylactically to high-risk infants during the RSV season.
8. Ranibizumab (Lucentis): A recombinant humanized monoclonal antibody fragment that binds and inhibits vascular endothelial growth factor A (VEGF-A), used in the treatment of age-related macular degeneration, diabetic retinopathy, and other ocular disorders.
9. Cetuximab (Erbitux): A chimeric monoclonal antibody that binds to epidermal growth factor receptor (EGFR), used in the treatment of colorectal cancer and head and neck squamous cell carcinoma.
10. Adalimumab (Humira): A fully humanized monoclonal antibody that targets tumor necrosis factor-alpha (TNF-α), used in the treatment of various inflammatory diseases, including rheumatoid arthritis, psoriasis, and Crohn's disease.
11. Bevacizumab (Avastin): A recombinant humanized monoclonal antibody that binds to VEGF-A, used in the treatment of various cancers, including colorectal, lung, breast, and kidney cancer.
12. Trastuzumab (Herceptin): A humanized monoclonal antibody that targets HER2/neu receptor, used in the treatment of breast cancer.
13. Rituximab (Rituxan): A chimeric monoclonal antibody that binds to CD20 antigen on B cells, used in the treatment of non-Hodgkin's lymphoma and rheumatoid arthritis.
14. Palivizumab (Synagis): A humanized monoclonal antibody that binds to the F protein of respiratory syncytial virus, used in the prevention of respiratory syncytial virus infection in high-risk infants.
15. Infliximab (Remicade): A chimeric monoclonal antibody that targets TNF-α, used in the treatment of various inflammatory diseases, including Crohn's disease, ulcerative colitis, rheumatoid arthritis, and ankylosing spondylitis.
16. Natalizumab (Tysabri): A humanized monoclonal antibody that binds to α4β1 integrin, used in the treatment of multiple sclerosis and Crohn's disease.
17. Adalimumab (Humira): A fully human monoclonal antibody that targets TNF-α, used in the treatment of various inflammatory diseases, including rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, Crohn's disease, and ulcerative colitis.
18. Golimumab (Simponi): A fully human monoclonal antibody that targets TNF-α, used in the treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and ulcerative colitis.
19. Certolizumab pegol (Cimzia): A PEGylated Fab' fragment of a humanized monoclonal antibody that targets TNF-α, used in the treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
20. Ustekinumab (Stelara): A fully human monoclonal antibody that targets IL-12 and IL-23, used in the treatment of psoriasis, psoriatic arthritis, and Crohn's disease.
21. Secukinumab (Cosentyx): A fully human monoclonal antibody that targets IL-17A, used in the treatment of psoriasis, psoriatic arthritis, and ankylosing spondylitis.
22. Ixekizumab (Taltz): A fully human monoclonal antibody that targets IL-17A, used in the treatment of psoriasis and psoriatic arthritis.
23. Brodalumab (Siliq): A fully human monoclonal antibody that targets IL-17 receptor A, used in the treatment of psoriasis.
24. Sarilumab (Kevzara): A fully human monoclonal antibody that targets the IL-6 receptor, used in the treatment of rheumatoid arthritis.
25. Tocilizumab (Actemra): A humanized monoclonal antibody that targets the IL-6 receptor, used in the treatment of rheumatoid arthritis, systemic juvenile idiopathic arthritis, polyarticular juvenile idiopathic arthritis, giant cell arteritis, and chimeric antigen receptor T-cell-induced cytokine release syndrome.
26. Siltuximab (Sylvant): A chimeric monoclonal antibody that targets IL-6, used in the treatment of multicentric Castleman disease.
27. Satralizumab (Enspryng): A humanized monoclonal antibody that targets IL-6 receptor alpha, used in the treatment of neuromyelitis optica spectrum disorder.
28. Sirukumab (Plivensia): A human monoclonal antibody that targets IL-6, used in the treatment

An islet cell adenoma is a rare, typically benign tumor that develops in the islets of Langerhans, which are clusters of hormone-producing cells in the pancreas. The islets of Langerhans contain several types of cells, including beta cells that produce insulin, alpha cells that produce glucagon, and delta cells that produce somatostatin.

Islet cell adenomas can cause various endocrine disorders depending on the type of hormone-producing cells involved. For example, if the tumor consists mainly of beta cells, it may secrete excessive amounts of insulin, leading to hypoglycemia (low blood sugar). Conversely, if the tumor is composed primarily of alpha cells, it may produce too much glucagon, resulting in hyperglycemia (high blood sugar) and a condition known as glucagonoma.

Islet cell adenomas are usually slow-growing and small but can become quite large in some cases. They are typically diagnosed through imaging tests such as CT scans or MRI, and hormone levels may be measured to determine the type of cells involved. Treatment options include surgical removal of the tumor, medication to manage hormonal imbalances, and, in rare cases, radiofrequency ablation or embolization.

I apologize for the confusion, but "Bucladesine" is not a recognized medical term or a medication in current use in medicine. It's possible that there may be some mistake or typo in the spelling. If you have any more context about where you encountered this term, I might be able to provide a more accurate and helpful response.

C57BL/6 (C57 Black 6) is an inbred strain of laboratory mouse that is widely used in biomedical research. The term "inbred" refers to a strain of animals where matings have been carried out between siblings or other closely related individuals for many generations, resulting in a population that is highly homozygous at most genetic loci.

The C57BL/6 strain was established in 1920 by crossing a female mouse from the dilute brown (DBA) strain with a male mouse from the black strain. The resulting offspring were then interbred for many generations to create the inbred C57BL/6 strain.

C57BL/6 mice are known for their robust health, longevity, and ease of handling, making them a popular choice for researchers. They have been used in a wide range of biomedical research areas, including studies of cancer, immunology, neuroscience, cardiovascular disease, and metabolism.

One of the most notable features of the C57BL/6 strain is its sensitivity to certain genetic modifications, such as the introduction of mutations that lead to obesity or impaired glucose tolerance. This has made it a valuable tool for studying the genetic basis of complex diseases and traits.

Overall, the C57BL/6 inbred mouse strain is an important model organism in biomedical research, providing a valuable resource for understanding the genetic and molecular mechanisms underlying human health and disease.

In genetics, sequence alignment is the process of arranging two or more DNA, RNA, or protein sequences to identify regions of similarity or homology between them. This is often done using computational methods to compare the nucleotide or amino acid sequences and identify matching patterns, which can provide insight into evolutionary relationships, functional domains, or potential genetic disorders. The alignment process typically involves adjusting gaps and mismatches in the sequences to maximize the similarity between them, resulting in an aligned sequence that can be visually represented and analyzed.

Magnetic Resonance Spectroscopy (MRS) is a non-invasive diagnostic technique that provides information about the biochemical composition of tissues, including their metabolic state. It is often used in conjunction with Magnetic Resonance Imaging (MRI) to analyze various metabolites within body tissues, such as the brain, heart, liver, and muscles.

During MRS, a strong magnetic field, radio waves, and a computer are used to produce detailed images and data about the concentration of specific metabolites in the targeted tissue or organ. This technique can help detect abnormalities related to energy metabolism, neurotransmitter levels, pH balance, and other biochemical processes, which can be useful for diagnosing and monitoring various medical conditions, including cancer, neurological disorders, and metabolic diseases.

There are different types of MRS, such as Proton (^1^H) MRS, Phosphorus-31 (^31^P) MRS, and Carbon-13 (^13^C) MRS, each focusing on specific elements or metabolites within the body. The choice of MRS technique depends on the clinical question being addressed and the type of information needed for diagnosis or monitoring purposes.

Glucagon-like peptide 2 (GLP-2) is a hormone that is produced in the intestines by the enteroendocrine L cells. It is a 33-amino acid peptide that is derived from the preproglucagon gene and has a variety of effects on the gastrointestinal system, including increasing nutrient absorption, stimulating intestinal growth, and reducing gut permeability.

GLP-2 acts by binding to its receptor, which is found on the surface of intestinal epithelial cells, as well as on blood vessels and immune cells in the gut. Activation of the GLP-2 receptor leads to a variety of intracellular signaling pathways that promote cell survival, proliferation, and differentiation.

In addition to its role in normal intestinal function, GLP-2 has been investigated as a potential therapeutic agent for various gastrointestinal disorders, including short bowel syndrome, inflammatory bowel disease, and intestinal injury. Synthetic GLP-2 agonists have been developed and are currently being studied in clinical trials for these indications.

Hyperglycemia is a medical term that refers to an abnormally high level of glucose (sugar) in the blood. Fasting hyperglycemia is defined as a fasting blood glucose level greater than or equal to 126 mg/dL (milligrams per deciliter) on two separate occasions. Alternatively, a random blood glucose level greater than or equal to 200 mg/dL in combination with symptoms of hyperglycemia (such as increased thirst, frequent urination, blurred vision, and fatigue) can also indicate hyperglycemia.

Hyperglycemia is often associated with diabetes mellitus, a chronic metabolic disorder characterized by high blood glucose levels due to insulin resistance or insufficient insulin production. However, hyperglycemia can also occur in other conditions such as stress, surgery, infection, certain medications, and hormonal imbalances.

Prolonged or untreated hyperglycemia can lead to serious complications such as diabetic ketoacidosis (DKA), hyperosmolar hyperglycemic state (HHS), and long-term damage to various organs such as the eyes, kidneys, nerves, and blood vessels. Therefore, it is essential to monitor blood glucose levels regularly and maintain them within normal ranges through proper diet, exercise, medication, and lifestyle modifications.

Perfusion, in medical terms, refers to the process of circulating blood through the body's organs and tissues to deliver oxygen and nutrients and remove waste products. It is a measure of the delivery of adequate blood flow to specific areas or tissues in the body. Perfusion can be assessed using various methods, including imaging techniques like computed tomography (CT) scans, magnetic resonance imaging (MRI), and perfusion scintigraphy.

Perfusion is critical for maintaining proper organ function and overall health. When perfusion is impaired or inadequate, it can lead to tissue hypoxia, acidosis, and cell death, which can result in organ dysfunction or failure. Conditions that can affect perfusion include cardiovascular disease, shock, trauma, and certain surgical procedures.

Vasopressin, also known as antidiuretic hormone (ADH), is a hormone that helps regulate water balance in the body. It is produced by the hypothalamus and stored in the posterior pituitary gland. When the body is dehydrated or experiencing low blood pressure, vasopressin is released into the bloodstream, where it causes the kidneys to decrease the amount of urine they produce and helps to constrict blood vessels, thereby increasing blood pressure. This helps to maintain adequate fluid volume in the body and ensure that vital organs receive an adequate supply of oxygen-rich blood. In addition to its role in water balance and blood pressure regulation, vasopressin also plays a role in social behaviors such as pair bonding and trust.

Cricetinae is a subfamily of rodents that includes hamsters, gerbils, and relatives. These small mammals are characterized by having short limbs, compact bodies, and cheek pouches for storing food. They are native to various parts of the world, particularly in Europe, Asia, and Africa. Some species are popular pets due to their small size, easy care, and friendly nature. In a medical context, understanding the biology and behavior of Cricetinae species can be important for individuals who keep them as pets or for researchers studying their physiology.

Post-translational protein processing refers to the modifications and changes that proteins undergo after their synthesis on ribosomes, which are complex molecular machines responsible for protein synthesis. These modifications occur through various biochemical processes and play a crucial role in determining the final structure, function, and stability of the protein.

The process begins with the translation of messenger RNA (mRNA) into a linear polypeptide chain, which is then subjected to several post-translational modifications. These modifications can include:

1. Proteolytic cleavage: The removal of specific segments or domains from the polypeptide chain by proteases, resulting in the formation of mature, functional protein subunits.
2. Chemical modifications: Addition or modification of chemical groups to the side chains of amino acids, such as phosphorylation (addition of a phosphate group), glycosylation (addition of sugar moieties), methylation (addition of a methyl group), acetylation (addition of an acetyl group), and ubiquitination (addition of a ubiquitin protein).
3. Disulfide bond formation: The oxidation of specific cysteine residues within the polypeptide chain, leading to the formation of disulfide bonds between them. This process helps stabilize the three-dimensional structure of proteins, particularly in extracellular environments.
4. Folding and assembly: The acquisition of a specific three-dimensional conformation by the polypeptide chain, which is essential for its function. Chaperone proteins assist in this process to ensure proper folding and prevent aggregation.
5. Protein targeting: The directed transport of proteins to their appropriate cellular locations, such as the nucleus, mitochondria, endoplasmic reticulum, or plasma membrane. This is often facilitated by specific signal sequences within the protein that are recognized and bound by transport machinery.

Collectively, these post-translational modifications contribute to the functional diversity of proteins in living organisms, allowing them to perform a wide range of cellular processes, including signaling, catalysis, regulation, and structural support.

A glucagonoma is a rare type of neuroendocrine tumor that originates from the alpha cells of the pancreas, where the hormone glucagon is produced. This tumor can lead to an overproduction of glucagon, resulting in a characteristic syndrome known as the "glucagonoma syndrome."

The symptoms of glucagonoma syndrome may include:

1. A distinctive rash called necrolytic migratory erythema, which is characterized by red, swollen, and painful skin lesions that can affect various parts of the body.
2. Weight loss
3. Diabetes or high blood sugar levels (hyperglycemia)
4. Anemia
5. Deep vein thrombosis (blood clots in the deep veins)
6. Depression and confusion
7. A decreased appetite
8. Fatigue and weakness
9. Diarrhea or steatorrhea (fatty stools)
10. High levels of amino acids, fatty acids, and zinc in the blood.

Glucagonomas are typically slow-growing tumors, but they can metastasize (spread) to other organs such as the liver, lymph nodes, and bones. Treatment options for glucagonoma may include surgery to remove the tumor, chemotherapy, targeted therapy, or radiation therapy. Regular follow-up care is essential to monitor the tumor's progression and manage any associated symptoms.

Enzyme activation refers to the process by which an enzyme becomes biologically active and capable of carrying out its specific chemical or biological reaction. This is often achieved through various post-translational modifications, such as proteolytic cleavage, phosphorylation, or addition of cofactors or prosthetic groups to the enzyme molecule. These modifications can change the conformation or structure of the enzyme, exposing or creating a binding site for the substrate and allowing the enzymatic reaction to occur.

For example, in the case of proteolytic cleavage, an inactive precursor enzyme, known as a zymogen, is cleaved into its active form by a specific protease. This is seen in enzymes such as trypsin and chymotrypsin, which are initially produced in the pancreas as inactive precursors called trypsinogen and chymotrypsinogen, respectively. Once they reach the small intestine, they are activated by enteropeptidase, a protease that cleaves a specific peptide bond, releasing the active enzyme.

Phosphorylation is another common mechanism of enzyme activation, where a phosphate group is added to a specific serine, threonine, or tyrosine residue on the enzyme by a protein kinase. This modification can alter the conformation of the enzyme and create a binding site for the substrate, allowing the enzymatic reaction to occur.

Enzyme activation is a crucial process in many biological pathways, as it allows for precise control over when and where specific reactions take place. It also provides a mechanism for regulating enzyme activity in response to various signals and stimuli, such as hormones, neurotransmitters, or changes in the intracellular environment.

Lactates, also known as lactic acid, are compounds that are produced by muscles during intense exercise or other conditions of low oxygen supply. They are formed from the breakdown of glucose in the absence of adequate oxygen to complete the full process of cellular respiration. This results in the production of lactate and a hydrogen ion, which can lead to a decrease in pH and muscle fatigue.

In a medical context, lactates may be measured in the blood as an indicator of tissue oxygenation and metabolic status. Elevated levels of lactate in the blood, known as lactic acidosis, can indicate poor tissue perfusion or hypoxia, and may be seen in conditions such as sepsis, cardiac arrest, and severe shock. It is important to note that lactates are not the primary cause of acidemia (low pH) in lactic acidosis, but rather a marker of the underlying process.

Sprague-Dawley rats are a strain of albino laboratory rats that are widely used in scientific research. They were first developed by researchers H.H. Sprague and R.C. Dawley in the early 20th century, and have since become one of the most commonly used rat strains in biomedical research due to their relatively large size, ease of handling, and consistent genetic background.

Sprague-Dawley rats are outbred, which means that they are genetically diverse and do not suffer from the same limitations as inbred strains, which can have reduced fertility and increased susceptibility to certain diseases. They are also characterized by their docile nature and low levels of aggression, making them easier to handle and study than some other rat strains.

These rats are used in a wide variety of research areas, including toxicology, pharmacology, nutrition, cancer, and behavioral studies. Because they are genetically diverse, Sprague-Dawley rats can be used to model a range of human diseases and conditions, making them an important tool in the development of new drugs and therapies.

I believe there may be some confusion in your question. "Rabbits" is a common name used to refer to the Lagomorpha species, particularly members of the family Leporidae. They are small mammals known for their long ears, strong legs, and quick reproduction.

However, if you're referring to "rabbits" in a medical context, there is a term called "rabbit syndrome," which is a rare movement disorder characterized by repetitive, involuntary movements of the fingers, resembling those of a rabbit chewing. It is also known as "finger-chewing chorea." This condition is usually associated with certain medications, particularly antipsychotics, and typically resolves when the medication is stopped or adjusted.

Signal transduction is the process by which a cell converts an extracellular signal, such as a hormone or neurotransmitter, into an intracellular response. This involves a series of molecular events that transmit the signal from the cell surface to the interior of the cell, ultimately resulting in changes in gene expression, protein activity, or metabolism.

The process typically begins with the binding of the extracellular signal to a receptor located on the cell membrane. This binding event activates the receptor, which then triggers a cascade of intracellular signaling molecules, such as second messengers, protein kinases, and ion channels. These molecules amplify and propagate the signal, ultimately leading to the activation or inhibition of specific cellular responses.

Signal transduction pathways are highly regulated and can be modulated by various factors, including other signaling molecules, post-translational modifications, and feedback mechanisms. Dysregulation of these pathways has been implicated in a variety of diseases, including cancer, diabetes, and neurological disorders.

Somatostatin-secreting cells, also known as delta cells or D cells, are a type of neuroendocrine cell found in the pancreatic islets and the central nervous system. These cells produce and secrete somatostatin, a peptide hormone that inhibits the release of several other hormones such as insulin, glucagon, and gastrin.

Somatostatin has a wide range of physiological effects, including inhibition of gastrointestinal motility, secretion, and blood flow; modulation of neurotransmission; and regulation of cell growth and differentiation. Somatostatin-secreting cells play an essential role in maintaining hormonal homeostasis by regulating the release of other hormones in response to various physiological stimuli.

In the pancreas, somatostatin-secreting cells are located in the islets of Langerhans, where they represent about 10% of the endocrine cell population. They are scattered among the insulin-producing beta cells and glucagon-producing alpha cells and form a dense network of fine processes that surround other islet cells. Somatostatin released from these cells acts in a paracrine manner to regulate the secretion of insulin, glucagon, and other hormones produced by the islet cells.

In the central nervous system, somatostatin-secreting cells are found in various regions, including the hypothalamus, hippocampus, and cortex. They play a role in regulating neurotransmission, neuronal excitability, and synaptic plasticity. Dysfunction of somatostatin-secreting cells has been implicated in several neurological and endocrine disorders, such as diabetes, acromegaly, and certain types of tumors.

Cell surface receptors, also known as membrane receptors, are proteins located on the cell membrane that bind to specific molecules outside the cell, known as ligands. These receptors play a crucial role in signal transduction, which is the process of converting an extracellular signal into an intracellular response.

Cell surface receptors can be classified into several categories based on their structure and mechanism of action, including:

1. Ion channel receptors: These receptors contain a pore that opens to allow ions to flow across the cell membrane when they bind to their ligands. This ion flux can directly activate or inhibit various cellular processes.
2. G protein-coupled receptors (GPCRs): These receptors consist of seven transmembrane domains and are associated with heterotrimeric G proteins that modulate intracellular signaling pathways upon ligand binding.
3. Enzyme-linked receptors: These receptors possess an intrinsic enzymatic activity or are linked to an enzyme, which becomes activated when the receptor binds to its ligand. This activation can lead to the initiation of various signaling cascades within the cell.
4. Receptor tyrosine kinases (RTKs): These receptors contain intracellular tyrosine kinase domains that become activated upon ligand binding, leading to the phosphorylation and activation of downstream signaling molecules.
5. Integrins: These receptors are transmembrane proteins that mediate cell-cell or cell-matrix interactions by binding to extracellular matrix proteins or counter-receptors on adjacent cells. They play essential roles in cell adhesion, migration, and survival.

Cell surface receptors are involved in various physiological processes, including neurotransmission, hormone signaling, immune response, and cell growth and differentiation. Dysregulation of these receptors can contribute to the development of numerous diseases, such as cancer, diabetes, and neurological disorders.

Hydrogen-ion concentration, also known as pH, is a measure of the acidity or basicity of a solution. It is defined as the negative logarithm (to the base 10) of the hydrogen ion activity in a solution. The standard unit of measurement is the pH unit. A pH of 7 is neutral, less than 7 is acidic, and greater than 7 is basic.

In medical terms, hydrogen-ion concentration is important for maintaining homeostasis within the body. For example, in the stomach, a high hydrogen-ion concentration (low pH) is necessary for the digestion of food. However, in other parts of the body such as blood, a high hydrogen-ion concentration can be harmful and lead to acidosis. Conversely, a low hydrogen-ion concentration (high pH) in the blood can lead to alkalosis. Both acidosis and alkalosis can have serious consequences on various organ systems if not corrected.

Aptamers are short, single-stranded oligonucleotides (DNA or RNA) or peptides that bind to specific target molecules with high affinity and specificity. They are generated through an iterative process called Systematic Evolution of Ligands by EXponential enrichment (SELEX).

Peptide aptamers, on the other hand, are small protein-like molecules that consist of a short peptide sequence displayed on a scaffold protein. They are generated through molecular display technologies such as phage display or ribosome display. Peptide aptamers can bind to various targets, including proteins, with high affinity and specificity, making them useful tools in basic research and therapeutic applications.

Gel chromatography is a type of liquid chromatography that separates molecules based on their size or molecular weight. It uses a stationary phase that consists of a gel matrix made up of cross-linked polymers, such as dextran, agarose, or polyacrylamide. The gel matrix contains pores of various sizes, which allow smaller molecules to penetrate deeper into the matrix while larger molecules are excluded.

In gel chromatography, a mixture of molecules is loaded onto the top of the gel column and eluted with a solvent that moves down the column by gravity or pressure. As the sample components move down the column, they interact with the gel matrix and get separated based on their size. Smaller molecules can enter the pores of the gel and take longer to elute, while larger molecules are excluded from the pores and elute more quickly.

Gel chromatography is commonly used to separate and purify proteins, nucleic acids, and other biomolecules based on their size and molecular weight. It is also used in the analysis of polymers, colloids, and other materials with a wide range of applications in chemistry, biology, and medicine.

Secretory rate refers to the amount or volume of a secretion produced by a gland or an organ over a given period of time. It is a measure of the productivity or activity level of the secreting structure. The secretory rate can be quantified for various bodily fluids, such as saliva, sweat, digestive enzymes, hormones, or milk, depending on the context and the specific gland or organ being studied.

In clinical settings, measuring the secretory rate might involve collecting and analyzing samples over a certain duration to estimate the production rate of the substance in question. This information can be helpful in diagnosing conditions related to impaired secretion, monitoring treatment responses, or understanding the physiological adaptations of the body under different circumstances.

Phosphorylation is the process of adding a phosphate group (a molecule consisting of one phosphorus atom and four oxygen atoms) to a protein or other organic molecule, which is usually done by enzymes called kinases. This post-translational modification can change the function, localization, or activity of the target molecule, playing a crucial role in various cellular processes such as signal transduction, metabolism, and regulation of gene expression. Phosphorylation is reversible, and the removal of the phosphate group is facilitated by enzymes called phosphatases.

"Wistar rats" are a strain of albino rats that are widely used in laboratory research. They were developed at the Wistar Institute in Philadelphia, USA, and were first introduced in 1906. Wistar rats are outbred, which means that they are genetically diverse and do not have a fixed set of genetic characteristics like inbred strains.

Wistar rats are commonly used as animal models in biomedical research because of their size, ease of handling, and relatively low cost. They are used in a wide range of research areas, including toxicology, pharmacology, nutrition, cancer, cardiovascular disease, and behavioral studies. Wistar rats are also used in safety testing of drugs, medical devices, and other products.

Wistar rats are typically larger than many other rat strains, with males weighing between 500-700 grams and females weighing between 250-350 grams. They have a lifespan of approximately 2-3 years. Wistar rats are also known for their docile and friendly nature, making them easy to handle and work with in the laboratory setting.

Nonesterified fatty acids (NEFA), also known as free fatty acids (FFA), refer to fatty acid molecules that are not bound to glycerol in the form of triglycerides or other esters. In the bloodstream, NEFAs are transported while bound to albumin and can serve as a source of energy for peripheral tissues. Under normal physiological conditions, NEFA levels are tightly regulated by the body; however, elevated NEFA levels have been associated with various metabolic disorders such as insulin resistance, obesity, and type 2 diabetes.

Cholecystokinin (CCK) is a hormone that is produced in the duodenum (the first part of the small intestine) and in the brain. It is released into the bloodstream in response to food, particularly fatty foods, and plays several roles in the digestive process.

In the digestive system, CCK stimulates the contraction of the gallbladder, which releases bile into the small intestine to help digest fats. It also inhibits the release of acid from the stomach and slows down the movement of food through the intestines.

In the brain, CCK acts as a neurotransmitter and has been shown to have effects on appetite regulation, mood, and memory. It may play a role in the feeling of fullness or satiety after eating, and may also be involved in anxiety and panic disorders.

CCK is sometimes referred to as "gallbladder-stimulating hormone" or "pancreozymin," although these terms are less commonly used than "cholecystokinin."

I'm not aware of a specific medical definition for "amphibian proteins." However, I can provide some context that might help you understand what you might be looking for.

Proteins are complex molecules that perform a wide variety of functions within organisms, including catalyzing metabolic reactions, DNA replication, responding to stimuli, and transporting molecules from one location to another. Amphibians are a class of animals that include frogs, toads, salamanders, and newts.

If you're looking for information about proteins that are found in amphibians or are unique to amphibians, then you might be interested in researching the specific proteins that are involved in various biological processes in these animals. For example, some amphibian proteins have been studied for their potential roles in wound healing, immune response, and developmental biology.

One well-known example of an amphibian protein is antimicrobial peptides (AMPs), which are produced by the skin of many amphibians as a defense against pathogens. These peptides have been studied for their potential therapeutic applications in human medicine, particularly in the context of antibiotic resistance.

If you could provide more context or clarify what you're looking for, I might be able to give you a more specific answer!

Membrane proteins are a type of protein that are embedded in the lipid bilayer of biological membranes, such as the plasma membrane of cells or the inner membrane of mitochondria. These proteins play crucial roles in various cellular processes, including:

1. Cell-cell recognition and signaling
2. Transport of molecules across the membrane (selective permeability)
3. Enzymatic reactions at the membrane surface
4. Energy transduction and conversion
5. Mechanosensation and signal transduction

Membrane proteins can be classified into two main categories: integral membrane proteins, which are permanently associated with the lipid bilayer, and peripheral membrane proteins, which are temporarily or loosely attached to the membrane surface. Integral membrane proteins can further be divided into three subcategories based on their topology:

1. Transmembrane proteins, which span the entire width of the lipid bilayer with one or more alpha-helices or beta-barrels.
2. Lipid-anchored proteins, which are covalently attached to lipids in the membrane via a glycosylphosphatidylinositol (GPI) anchor or other lipid modifications.
3. Monotopic proteins, which are partially embedded in the membrane and have one or more domains exposed to either side of the bilayer.

Membrane proteins are essential for maintaining cellular homeostasis and are targets for various therapeutic interventions, including drug development and gene therapy. However, their structural complexity and hydrophobicity make them challenging to study using traditional biochemical methods, requiring specialized techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, and single-particle cryo-electron microscopy (cryo-EM).

An epitope is a specific region on an antigen (a substance that triggers an immune response) that is recognized and bound by an antibody or a T-cell receptor. In the case of T-lymphocytes, which are a type of white blood cell that plays a central role in cell-mediated immunity, epitopes are typically presented on the surface of infected cells in association with major histocompatibility complex (MHC) molecules.

T-lymphocytes recognize and respond to epitopes through their T-cell receptors (TCRs), which are membrane-bound proteins that can bind to specific epitopes presented on the surface of infected cells. There are two main types of T-lymphocytes: CD4+ T-cells, also known as helper T-cells, and CD8+ T-cells, also known as cytotoxic T-cells.

CD4+ T-cells recognize epitopes presented in the context of MHC class II molecules, which are typically expressed on the surface of professional antigen-presenting cells such as dendritic cells, macrophages, and B-cells. CD4+ T-cells help to coordinate the immune response by producing cytokines that activate other immune cells.

CD8+ T-cells recognize epitopes presented in the context of MHC class I molecules, which are expressed on the surface of almost all nucleated cells. CD8+ T-cells are able to directly kill infected cells by releasing cytotoxic granules that contain enzymes that can induce apoptosis (programmed cell death) in the target cell.

In summary, epitopes are specific regions on antigens that are recognized and bound by T-lymphocytes through their T-cell receptors. CD4+ T-cells recognize epitopes presented in the context of MHC class II molecules, while CD8+ T-cells recognize epitopes presented in the context of MHC class I molecules.

Bacterial proteins are a type of protein that are produced by bacteria as part of their structural or functional components. These proteins can be involved in various cellular processes, such as metabolism, DNA replication, transcription, and translation. They can also play a role in bacterial pathogenesis, helping the bacteria to evade the host's immune system, acquire nutrients, and multiply within the host.

Bacterial proteins can be classified into different categories based on their function, such as:

1. Enzymes: Proteins that catalyze chemical reactions in the bacterial cell.
2. Structural proteins: Proteins that provide structural support and maintain the shape of the bacterial cell.
3. Signaling proteins: Proteins that help bacteria to communicate with each other and coordinate their behavior.
4. Transport proteins: Proteins that facilitate the movement of molecules across the bacterial cell membrane.
5. Toxins: Proteins that are produced by pathogenic bacteria to damage host cells and promote infection.
6. Surface proteins: Proteins that are located on the surface of the bacterial cell and interact with the environment or host cells.

Understanding the structure and function of bacterial proteins is important for developing new antibiotics, vaccines, and other therapeutic strategies to combat bacterial infections.

Atrial natriuretic factor (ANF) receptors are specialized proteins found on the surface of certain cells in the body, primarily in the kidneys, heart, and blood vessels. They play a crucial role in regulating blood pressure, volume, and electrolyte balance.

There are two main types of ANF receptors: type A and type B. Type A receptors, also known as guanylyl cyclase-A (GC-A) receptors, are found in the kidneys, heart, and blood vessels. When ANF binds to these receptors, it triggers a series of reactions that lead to an increase in the production of a molecule called cyclic GMP (cGMP). This, in turn, causes vasodilation (relaxation of blood vessels), increased urine production, and reduced sodium reabsorption in the kidneys, all of which help lower blood pressure.

Type B receptors, on the other hand, are found mainly in the brain and have been shown to modulate the release of ANF from the heart. When ANF binds to type B receptors, it inhibits the release of vasopressin, a hormone that helps regulate water balance in the body. This further contributes to the overall effects of ANF on blood pressure and fluid balance.

Overall, ANF receptors are essential components of the complex system that helps maintain homeostasis in the cardiovascular and renal systems.

Amyloid beta-peptides (Aβ) are small protein fragments that are crucially involved in the pathogenesis of Alzheimer's disease. They are derived from a larger transmembrane protein called the amyloid precursor protein (APP) through a series of proteolytic cleavage events.

The two primary forms of Aβ peptides are Aβ40 and Aβ42, which differ in length by two amino acids. While both forms can be harmful, Aβ42 is more prone to aggregation and is considered to be the more pathogenic form. These peptides have the tendency to misfold and accumulate into oligomers, fibrils, and eventually insoluble plaques that deposit in various areas of the brain, most notably the cerebral cortex and hippocampus.

The accumulation of Aβ peptides is believed to initiate a cascade of events leading to neuroinflammation, oxidative stress, synaptic dysfunction, and neuronal death, which are all hallmarks of Alzheimer's disease. Although the exact role of Aβ in the onset and progression of Alzheimer's is still under investigation, it is widely accepted that they play a central part in the development of this debilitating neurodegenerative disorder.

Salivary proteins and peptides refer to the diverse group of molecules that are present in saliva, which is the clear, slightly alkaline fluid produced by the salivary glands in the mouth. These proteins and peptides play a crucial role in maintaining oral health and contributing to various physiological functions.

Some common types of salivary proteins and peptides include:

1. **Mucins**: These are large, heavily glycosylated proteins that give saliva its viscous quality. They help to lubricate the oral cavity, protect the mucosal surfaces, and aid in food bolus formation.
2. **Amylases**: These enzymes break down carbohydrates into simpler sugars, initiating the digestive process even before food reaches the stomach.
3. **Proline-rich proteins (PRPs)**: PRPs contribute to the buffering capacity of saliva and help protect against tooth erosion by forming a protective layer on tooth enamel.
4. **Histatins**: These are small cationic peptides with antimicrobial properties, playing a significant role in maintaining oral microbial homeostasis and preventing dental caries.
5. **Lactoferrin**: An iron-binding protein that exhibits antibacterial, antifungal, and anti-inflammatory activities, contributing to the overall oral health.
6. **Statherin and Cystatins**: These proteins regulate calcium phosphate precipitation, preventing dental calculus formation and maintaining tooth mineral homeostasis.

Salivary proteins and peptides have attracted significant interest in recent years due to their potential diagnostic and therapeutic applications. Alterations in the composition of these molecules can provide valuable insights into various oral and systemic diseases, making them promising biomarkers for disease detection and monitoring.

Transfection is a term used in molecular biology that refers to the process of deliberately introducing foreign genetic material (DNA, RNA or artificial gene constructs) into cells. This is typically done using chemical or physical methods, such as lipofection or electroporation. Transfection is widely used in research and medical settings for various purposes, including studying gene function, producing proteins, developing gene therapies, and creating genetically modified organisms. It's important to note that transfection is different from transduction, which is the process of introducing genetic material into cells using viruses as vectors.

Hydrolysis is a chemical process, not a medical one. However, it is relevant to medicine and biology.

Hydrolysis is the breakdown of a chemical compound due to its reaction with water, often resulting in the formation of two or more simpler compounds. In the context of physiology and medicine, hydrolysis is a crucial process in various biological reactions, such as the digestion of food molecules like proteins, carbohydrates, and fats. Enzymes called hydrolases catalyze these hydrolysis reactions to speed up the breakdown process in the body.

Carrier proteins, also known as transport proteins, are a type of protein that facilitates the movement of molecules across cell membranes. They are responsible for the selective and active transport of ions, sugars, amino acids, and other molecules from one side of the membrane to the other, against their concentration gradient. This process requires energy, usually in the form of ATP (adenosine triphosphate).

Carrier proteins have a specific binding site for the molecule they transport, and undergo conformational changes upon binding, which allows them to move the molecule across the membrane. Once the molecule has been transported, the carrier protein returns to its original conformation, ready to bind and transport another molecule.

Carrier proteins play a crucial role in maintaining the balance of ions and other molecules inside and outside of cells, and are essential for many physiological processes, including nerve impulse transmission, muscle contraction, and nutrient uptake.

"Swine" is a common term used to refer to even-toed ungulates of the family Suidae, including domestic pigs and wild boars. However, in a medical context, "swine" often appears in the phrase "swine flu," which is a strain of influenza virus that typically infects pigs but can also cause illness in humans. The 2009 H1N1 pandemic was caused by a new strain of swine-origin influenza A virus, which was commonly referred to as "swine flu." It's important to note that this virus is not transmitted through eating cooked pork products; it spreads from person to person, mainly through respiratory droplets produced when an infected person coughs or sneezes.

Antigen presentation is the process by which certain cells in the immune system, known as antigen presenting cells (APCs), display foreign or abnormal proteins (antigens) on their surface to other immune cells, such as T-cells. This process allows the immune system to recognize and mount a response against harmful pathogens, infected or damaged cells.

There are two main types of antigen presentation: major histocompatibility complex (MHC) class I and MHC class II presentation.

1. MHC class I presentation: APCs, such as dendritic cells, macrophages, and B-cells, process and load antigens onto MHC class I molecules, which are expressed on the surface of almost all nucleated cells in the body. The MHC class I-antigen complex is then recognized by CD8+ T-cells (cytotoxic T-cells), leading to the destruction of infected or damaged cells.
2. MHC class II presentation: APCs, particularly dendritic cells and B-cells, process and load antigens onto MHC class II molecules, which are mainly expressed on the surface of professional APCs. The MHC class II-antigen complex is then recognized by CD4+ T-cells (helper T-cells), leading to the activation of other immune cells, such as B-cells and macrophages, to eliminate the pathogen or damaged cells.

In summary, antigen presentation is a crucial step in the adaptive immune response, allowing for the recognition and elimination of foreign or abnormal substances that could potentially harm the body.

Phosphorylases are enzymes that catalyze the phosphorolytic cleavage of a bond, often a glycosidic bond, in a carbohydrate molecule, releasing a sugar moiety and a phosphate group. This reaction is important in metabolic pathways such as glycogenolysis, where glycogen is broken down into glucose-1-phosphate by the action of glycogen phosphorylase. The resulting glucose-1-phosphate can then be further metabolized to produce energy. Phosphorylases are widely found in nature and play a crucial role in various biological processes, including energy metabolism and signal transduction.

A dipeptide is a type of molecule that is formed by the condensation of two amino acids. In this process, the carboxyl group (-COOH) of one amino acid combines with the amino group (-NH2) of another amino acid, releasing a water molecule and forming a peptide bond.

The resulting molecule contains two amino acids joined together by a single peptide bond, which is a type of covalent bond that forms between the carboxyl group of one amino acid and the amino group of another. Dipeptides are relatively simple molecules compared to larger polypeptides or proteins, which can contain hundreds or even thousands of amino acids linked together by multiple peptide bonds.

Dipeptides have a variety of biological functions in the body, including serving as building blocks for larger proteins and playing important roles in various physiological processes. Some dipeptides also have potential therapeutic uses, such as in the treatment of hypertension or muscle wasting disorders.

I couldn't find a medical definition specifically for "Diabetes Mellitus, Experimental." However, I can provide you with information about experimental diabetes research and its relevance to understanding the disease.

Experimental diabetes models are used in biomedical research to study the pathophysiology of diabetes mellitus and to test potential therapies or treatments. These models can be broadly categorized into two types: chemically-induced and genetically modified.

1. Chemically-induced diabetes models: These involve administering chemicals, such as alloxan or streptozotocin, to animals (commonly mice or rats) to destroy their pancreatic β-cells, which produce insulin. This results in hyperglycemia and symptoms similar to those seen in type 1 diabetes in humans.
2. Genetically modified diabetes models: These involve altering the genes of animals (commonly mice) to create a diabetes phenotype. Examples include non-obese diabetic (NOD) mice, which develop an autoimmune form of diabetes similar to human type 1 diabetes, and various strains of obese mice with insulin resistance, such as ob/ob or db/db mice, which model aspects of type 2 diabetes.

These experimental models help researchers better understand the mechanisms behind diabetes development and progression, identify new therapeutic targets, and test potential treatments before moving on to human clinical trials. However, it's essential to recognize that these models may not fully replicate all aspects of human diabetes, so findings from animal studies should be interpreted with caution.

3-Hydroxybutyric acid, also known as β-hydroxybutyric acid, is a type of ketone body that is produced in the liver during the metabolism of fatty acids. It is a colorless, slightly water-soluble compound with a bitter taste and an unpleasant odor.

In the body, 3-hydroxybutyric acid is produced when there is not enough glucose available to meet the body's energy needs, such as during fasting, starvation, or prolonged intense exercise. It can also be produced in large amounts in people with uncontrolled diabetes, particularly during a condition called diabetic ketoacidosis.

3-Hydroxybutyric acid is an important source of energy for the brain and other organs during periods of low glucose availability. However, high levels of 3-hydroxybutyric acid in the blood can lead to a condition called ketosis, which can cause symptoms such as nausea, vomiting, abdominal pain, and confusion. If left untreated, ketosis can progress to diabetic ketoacidosis, a potentially life-threatening complication of diabetes.

Amino acid motifs are recurring patterns or sequences of amino acids in a protein molecule. These motifs can be identified through various sequence analysis techniques and often have functional or structural significance. They can be as short as two amino acids in length, but typically contain at least three to five residues.

Some common examples of amino acid motifs include:

1. Active site motifs: These are specific sequences of amino acids that form the active site of an enzyme and participate in catalyzing chemical reactions. For example, the catalytic triad in serine proteases consists of three residues (serine, histidine, and aspartate) that work together to hydrolyze peptide bonds.
2. Signal peptide motifs: These are sequences of amino acids that target proteins for secretion or localization to specific organelles within the cell. For example, a typical signal peptide consists of a positively charged n-region, a hydrophobic h-region, and a polar c-region that directs the protein to the endoplasmic reticulum membrane for translocation.
3. Zinc finger motifs: These are structural domains that contain conserved sequences of amino acids that bind zinc ions and play important roles in DNA recognition and regulation of gene expression.
4. Transmembrane motifs: These are sequences of hydrophobic amino acids that span the lipid bilayer of cell membranes and anchor transmembrane proteins in place.
5. Phosphorylation sites: These are specific serine, threonine, or tyrosine residues that can be phosphorylated by protein kinases to regulate protein function.

Understanding amino acid motifs is important for predicting protein structure and function, as well as for identifying potential drug targets in disease-associated proteins.

I'm sorry for any confusion, but the term "Melitten" does not appear to be a recognized medical term or condition. It is possible that there may be a spelling mistake or typo in the term you are looking for. Please double-check the spelling and try again, or provide more context so I can try to help you find the information you're looking for.

'Gene expression regulation' refers to the processes that control whether, when, and where a particular gene is expressed, meaning the production of a specific protein or functional RNA encoded by that gene. This complex mechanism can be influenced by various factors such as transcription factors, chromatin remodeling, DNA methylation, non-coding RNAs, and post-transcriptional modifications, among others. Proper regulation of gene expression is crucial for normal cellular function, development, and maintaining homeostasis in living organisms. Dysregulation of gene expression can lead to various diseases, including cancer and genetic disorders.

Ketone bodies, also known as ketones or ketoacids, are organic compounds that are produced by the liver during the metabolism of fats when carbohydrate intake is low. They include acetoacetate (AcAc), beta-hydroxybutyrate (BHB), and acetone. These molecules serve as an alternative energy source for the body, particularly for the brain and heart, when glucose levels are insufficient to meet energy demands.

In a healthy individual, ketone bodies are present in low concentrations; however, during periods of fasting, starvation, or intense physical exertion, ketone production increases significantly. In some pathological conditions like uncontrolled diabetes mellitus, the body may produce excessive amounts of ketones, leading to a dangerous metabolic state called diabetic ketoacidosis (DKA).

Elevated levels of ketone bodies can be detected in blood or urine and are often used as an indicator of metabolic status. Monitoring ketone levels is essential for managing certain medical conditions, such as diabetes, where maintaining optimal ketone concentrations is crucial to prevent complications.

Hydrophobic interactions: These are the interactions that occur between non-polar molecules or groups of atoms in an aqueous environment, leading to their association or aggregation. The term "hydrophobic" means "water-fearing" and describes the tendency of non-polar substances to repel water. When non-polar molecules or groups are placed in water, they tend to clump together to minimize contact with the polar water molecules. These interactions are primarily driven by the entropy increase of the system as a whole, rather than energy minimization. Hydrophobic interactions play crucial roles in various biological processes, such as protein folding, membrane formation, and molecular self-assembly.

Hydrophilic interactions: These are the interactions that occur between polar molecules or groups of atoms and water molecules. The term "hydrophilic" means "water-loving" and describes the attraction of polar substances to water. When polar molecules or groups are placed in water, they can form hydrogen bonds with the surrounding water molecules, which helps solvate them. Hydrophilic interactions contribute to the stability and functionality of various biological systems, such as protein structure, ion transport across membranes, and enzyme catalysis.

Endopeptidases are a type of enzyme that breaks down proteins by cleaving peptide bonds inside the polypeptide chain. They are also known as proteinases or endoproteinases. These enzymes work within the interior of the protein molecule, cutting it at specific points along its length, as opposed to exopeptidases, which remove individual amino acids from the ends of the protein chain.

Endopeptidases play a crucial role in various biological processes, such as digestion, blood coagulation, and programmed cell death (apoptosis). They are classified based on their catalytic mechanism and the structure of their active site. Some examples of endopeptidase families include serine proteases, cysteine proteases, aspartic proteases, and metalloproteases.

It is important to note that while endopeptidases are essential for normal physiological functions, they can also contribute to disease processes when their activity is unregulated or misdirected. For instance, excessive endopeptidase activity has been implicated in the pathogenesis of neurodegenerative disorders, cancer, and inflammatory conditions.

Epitope mapping is a technique used in immunology to identify the specific portion or regions (called epitopes) on an antigen that are recognized and bind to antibodies or T-cell receptors. This process helps to understand the molecular basis of immune responses against various pathogens, allergens, or transplanted tissues.

Epitope mapping can be performed using different methods such as:

1. Peptide scanning: In this method, a series of overlapping peptides spanning the entire length of the antigen are synthesized and tested for their ability to bind to antibodies or T-cell receptors. The peptide that shows binding is considered to contain the epitope.
2. Site-directed mutagenesis: In this approach, specific amino acids within the antigen are altered, and the modified antigens are tested for their ability to bind to antibodies or T-cell receptors. This helps in identifying the critical residues within the epitope.
3. X-ray crystallography and NMR spectroscopy: These techniques provide detailed information about the three-dimensional structure of antigen-antibody complexes, allowing for accurate identification of epitopes at an atomic level.

The results from epitope mapping can be useful in various applications, including vaccine design, diagnostic test development, and understanding the basis of autoimmune diseases.

Complementary DNA (cDNA) is a type of DNA that is synthesized from a single-stranded RNA molecule through the process of reverse transcription. In this process, the enzyme reverse transcriptase uses an RNA molecule as a template to synthesize a complementary DNA strand. The resulting cDNA is therefore complementary to the original RNA molecule and is a copy of its coding sequence, but it does not contain non-coding regions such as introns that are present in genomic DNA.

Complementary DNA is often used in molecular biology research to study gene expression, protein function, and other genetic phenomena. For example, cDNA can be used to create cDNA libraries, which are collections of cloned cDNA fragments that represent the expressed genes in a particular cell type or tissue. These libraries can then be screened for specific genes or gene products of interest. Additionally, cDNA can be used to produce recombinant proteins in heterologous expression systems, allowing researchers to study the structure and function of proteins that may be difficult to express or purify from their native sources.

Insulin-secreting cells, also known as beta cells, are a type of cell found in the pancreas. They are responsible for producing and releasing insulin, a hormone that regulates blood glucose levels by allowing cells in the body to take in glucose from the bloodstream. Insulin-secreting cells are clustered together in the pancreatic islets, along with other types of cells that produce other hormones such as glucagon and somatostatin. In people with diabetes, these cells may not function properly, leading to an impaired ability to regulate blood sugar levels.

Defensins are small, cationic host defense peptides that contribute to the innate immune system's response against microbial pathogens. They are produced by various cell types, including neutrophils, epithelial cells, and some bone marrow-derived cells. Defensins have a broad spectrum of antimicrobial activity against bacteria, fungi, viruses, and enveloped lipid bilayers.

Defensins are classified into two main groups: α-defensins and β-defensins. Human α-defensins include human neutrophil peptides (HNP) 1-4 and human defensin 5, 6 (HD5, HD6). These are primarily produced by neutrophils and Paneth cells in the small intestine. β-defensins, on the other hand, are produced by various epithelial cells throughout the body.

Defensins work by disrupting the microbial membrane's integrity, leading to cell lysis and death. They also have immunomodulatory functions, such as chemotaxis of immune cells, modulation of cytokine production, and enhancement of adaptive immune responses. Dysregulation of defensin expression has been implicated in several diseases, including inflammatory bowel disease, chronic obstructive pulmonary disease, and certain skin disorders.

Proprotein convertase 2 (PCSK2) is a type of enzyme known as a proprotein convertase. It plays a role in the activation of other proteins by cleaving off specific peptide sequences and allowing them to become biologically active. PCSK2 is primarily involved in the processing of hormones and neurotransmitters, including insulin, prolactin, and members of the bombesin family.

Defects in the gene that encodes PCSK2 have been associated with certain medical conditions, such as congenital hyperinsulinism, a disorder characterized by low blood sugar levels due to excessive insulin secretion. However, more research is needed to fully understand the relationship between PCSK2 and these conditions.

Deoxyribonucleic acid (DNA) is the genetic material present in the cells of organisms where it is responsible for the storage and transmission of hereditary information. DNA is a long molecule that consists of two strands coiled together to form a double helix. Each strand is made up of a series of four nucleotide bases - adenine (A), guanine (G), cytosine (C), and thymine (T) - that are linked together by phosphate and sugar groups. The sequence of these bases along the length of the molecule encodes genetic information, with A always pairing with T and C always pairing with G. This base-pairing allows for the replication and transcription of DNA, which are essential processes in the functioning and reproduction of all living organisms.

Hydrocortisone is a synthetic glucocorticoid, which is a class of steroid hormones. It is identical to the naturally occurring cortisol, a hormone produced by the adrenal gland that helps regulate metabolism and helps your body respond to stress. Hydrocortisone has anti-inflammatory effects and is used to treat various inflammatory conditions such as allergies, skin disorders, and autoimmune diseases. It works by suppressing the immune system's response to reduce swelling, redness, itching, and other symptoms caused by inflammation.

Hydrocortisone is available in different forms, including oral tablets, topical creams, lotions, gels, and ointments, as well as injectable solutions. The specific use and dosage depend on the condition being treated and the individual patient's medical history and current health status.

As with any medication, hydrocortisone can have side effects, especially when used in high doses or for extended periods. Common side effects include increased appetite, weight gain, mood changes, insomnia, and skin thinning. Long-term use of hydrocortisone may also increase the risk of developing osteoporosis, diabetes, cataracts, and other health problems. Therefore, it is essential to follow your healthcare provider's instructions carefully when using this medication.

Cyanogen bromide is a solid compound with the chemical formula (CN)Br. It is a highly reactive and toxic substance that is used in research and industrial settings for various purposes, such as the production of certain types of resins and gels. Cyanogen bromide is an alkyl halide, which means it contains a bromine atom bonded to a carbon atom that is also bonded to a cyano group (a nitrogen atom bonded to a carbon atom with a triple bond).

Cyanogen bromide is classified as a class B poison, which means it can cause harm or death if swallowed, inhaled, or absorbed through the skin. It can cause irritation and burns to the eyes, skin, and respiratory tract, and prolonged exposure can lead to more serious health effects, such as damage to the nervous system and kidneys. Therefore, it is important to handle cyanogen bromide with care and to use appropriate safety precautions when working with it.

Gene expression is the process by which the information encoded in a gene is used to synthesize a functional gene product, such as a protein or RNA molecule. This process involves several steps: transcription, RNA processing, and translation. During transcription, the genetic information in DNA is copied into a complementary RNA molecule, known as messenger RNA (mRNA). The mRNA then undergoes RNA processing, which includes adding a cap and tail to the mRNA and splicing out non-coding regions called introns. The resulting mature mRNA is then translated into a protein on ribosomes in the cytoplasm through the process of translation.

The regulation of gene expression is a complex and highly controlled process that allows cells to respond to changes in their environment, such as growth factors, hormones, and stress signals. This regulation can occur at various stages of gene expression, including transcriptional activation or repression, RNA processing, mRNA stability, and translation. Dysregulation of gene expression has been implicated in many diseases, including cancer, genetic disorders, and neurological conditions.

An Enzyme-Linked Immunosorbent Assay (ELISA) is a type of analytical biochemistry assay used to detect and quantify the presence of a substance, typically a protein or peptide, in a liquid sample. It takes its name from the enzyme-linked antibodies used in the assay.

In an ELISA, the sample is added to a well containing a surface that has been treated to capture the target substance. If the target substance is present in the sample, it will bind to the surface. Next, an enzyme-linked antibody specific to the target substance is added. This antibody will bind to the captured target substance if it is present. After washing away any unbound material, a substrate for the enzyme is added. If the enzyme is present due to its linkage to the antibody, it will catalyze a reaction that produces a detectable signal, such as a color change or fluorescence. The intensity of this signal is proportional to the amount of target substance present in the sample, allowing for quantification.

ELISAs are widely used in research and clinical settings to detect and measure various substances, including hormones, viruses, and bacteria. They offer high sensitivity, specificity, and reproducibility, making them a reliable choice for many applications.

Cytotoxic T-lymphocytes, also known as CD8+ T cells, are a type of white blood cell that plays a central role in the cell-mediated immune system. They are responsible for identifying and destroying virus-infected cells and cancer cells. When a cytotoxic T-lymphocyte recognizes a specific antigen presented on the surface of an infected or malignant cell, it becomes activated and releases toxic substances such as perforins and granzymes, which can create pores in the target cell's membrane and induce apoptosis (programmed cell death). This process helps to eliminate the infected or malignant cells and prevent the spread of infection or cancer.

Biological transport refers to the movement of molecules, ions, or solutes across biological membranes or through cells in living organisms. This process is essential for maintaining homeostasis, regulating cellular functions, and enabling communication between cells. There are two main types of biological transport: passive transport and active transport.

Passive transport does not require the input of energy and includes:

1. Diffusion: The random movement of molecules from an area of high concentration to an area of low concentration until equilibrium is reached.
2. Osmosis: The diffusion of solvent molecules (usually water) across a semi-permeable membrane from an area of lower solute concentration to an area of higher solute concentration.
3. Facilitated diffusion: The assisted passage of polar or charged substances through protein channels or carriers in the cell membrane, which increases the rate of diffusion without consuming energy.

Active transport requires the input of energy (in the form of ATP) and includes:

1. Primary active transport: The direct use of ATP to move molecules against their concentration gradient, often driven by specific transport proteins called pumps.
2. Secondary active transport: The coupling of the movement of one substance down its electrochemical gradient with the uphill transport of another substance, mediated by a shared transport protein. This process is also known as co-transport or counter-transport.

A chemical stimulation in a medical context refers to the process of activating or enhancing physiological or psychological responses in the body using chemical substances. These chemicals can interact with receptors on cells to trigger specific reactions, such as neurotransmitters and hormones that transmit signals within the nervous system and endocrine system.

Examples of chemical stimulation include the use of medications, drugs, or supplements that affect mood, alertness, pain perception, or other bodily functions. For instance, caffeine can chemically stimulate the central nervous system to increase alertness and decrease feelings of fatigue. Similarly, certain painkillers can chemically stimulate opioid receptors in the brain to reduce the perception of pain.

It's important to note that while chemical stimulation can have therapeutic benefits, it can also have adverse effects if used improperly or in excessive amounts. Therefore, it's essential to follow proper dosing instructions and consult with a healthcare provider before using any chemical substances for stimulation purposes.

Hydroxybutyrates are compounds that contain a hydroxyl group (-OH) and a butyric acid group. More specifically, in the context of clinical medicine and biochemistry, β-hydroxybutyrate (BHB) is often referred to as a "ketone body."

Ketone bodies are produced by the liver during periods of low carbohydrate availability, such as during fasting, starvation, or a high-fat, low-carbohydrate diet. BHB is one of three major ketone bodies, along with acetoacetate and acetone. These molecules serve as alternative energy sources for the brain and other tissues when glucose levels are low.

In some pathological states, such as diabetic ketoacidosis, the body produces excessive amounts of ketone bodies, leading to a life-threatening metabolic acidosis. Elevated levels of BHB can also be found in other conditions like alcoholism, severe illnesses, and high-fat diets.

It is important to note that while BHB is a hydroxybutyrate, not all hydroxybutyrates are ketone bodies. The term "hydroxybutyrates" can refer to any compound containing both a hydroxyl group (-OH) and a butyric acid group.

Monoclonal antibodies are a type of antibody that are identical because they are produced by a single clone of cells. They are laboratory-produced molecules that act like human antibodies in the immune system. They can be designed to attach to specific proteins found on the surface of cancer cells, making them useful for targeting and treating cancer. Monoclonal antibodies can also be used as a therapy for other diseases, such as autoimmune disorders and inflammatory conditions.

Monoclonal antibodies are produced by fusing a single type of immune cell, called a B cell, with a tumor cell to create a hybrid cell, or hybridoma. This hybrid cell is then able to replicate indefinitely, producing a large number of identical copies of the original antibody. These antibodies can be further modified and engineered to enhance their ability to bind to specific targets, increase their stability, and improve their effectiveness as therapeutic agents.

Monoclonal antibodies have several mechanisms of action in cancer therapy. They can directly kill cancer cells by binding to them and triggering an immune response. They can also block the signals that promote cancer growth and survival. Additionally, monoclonal antibodies can be used to deliver drugs or radiation directly to cancer cells, increasing the effectiveness of these treatments while minimizing their side effects on healthy tissues.

Monoclonal antibodies have become an important tool in modern medicine, with several approved for use in cancer therapy and other diseases. They are continuing to be studied and developed as a promising approach to treating a wide range of medical conditions.

Magainins are a group of antimicrobial peptides that were first isolated from the skin of the African clawed frog, Xenopus laevis. These peptides have broad-spectrum activity against various microorganisms including bacteria, fungi, and enveloped viruses. Magainins are thought to play a crucial role in the innate immune system of the frog, helping to protect the animal from infection through its skin. They function by disrupting the membranes of microbial cells, leading to cell death. Magainins have been studied for their potential use as therapeutic agents, particularly in the context of antibiotic-resistant bacterial infections. However, more research is needed to fully understand their mechanisms of action and safety profile before they can be widely used in clinical settings.

'Immune sera' refers to the serum fraction of blood that contains antibodies produced in response to an antigenic stimulus, such as a vaccine or an infection. These antibodies are proteins known as immunoglobulins, which are secreted by B cells (a type of white blood cell) and can recognize and bind to specific antigens. Immune sera can be collected from an immunized individual and used as a source of passive immunity to protect against infection or disease. It is often used in research and diagnostic settings to identify or measure the presence of specific antigens or antibodies.

A mutation is a permanent change in the DNA sequence of an organism's genome. Mutations can occur spontaneously or be caused by environmental factors such as exposure to radiation, chemicals, or viruses. They may have various effects on the organism, ranging from benign to harmful, depending on where they occur and whether they alter the function of essential proteins. In some cases, mutations can increase an individual's susceptibility to certain diseases or disorders, while in others, they may confer a survival advantage. Mutations are the driving force behind evolution, as they introduce new genetic variability into populations, which can then be acted upon by natural selection.

HLA-A2 antigen is a type of human leukocyte antigen (HLA) class I molecule, which is found on the surface of cells in our body. HLA molecules are responsible for presenting pieces of proteins (peptides) from inside the cell to the immune system's T-cells, helping them distinguish between "self" and "non-self" proteins.

HLA-A2 is one of the most common HLA class I antigens in the Caucasian population, with an estimated frequency of around 50%. It presents a variety of peptides to T-cells, including those derived from viruses and tumor cells. The presentation of these peptides can trigger an immune response, leading to the destruction of infected or malignant cells.

It is important to note that HLA typing is crucial in organ transplantation, as a mismatch between donor and recipient HLA antigens can lead to rejection of the transplanted organ. Additionally, HLA-A2 has been associated with certain autoimmune diseases and cancer types, making it an area of interest for researchers studying these conditions.

A lipid bilayer is a thin membrane made up of two layers of lipid molecules, primarily phospholipids. The hydrophilic (water-loving) heads of the lipids face outwards, coming into contact with watery environments on both sides, while the hydrophobic (water-fearing) tails point inward, away from the aqueous surroundings. This unique structure allows lipid bilayers to form a stable barrier that controls the movement of molecules and ions in and out of cells and organelles, thus playing a crucial role in maintaining cellular compartmentalization and homeostasis.

Insulin antagonists are drugs or substances that interfere with the action of insulin, a hormone that regulates blood sugar levels in the body. These agents can either block the binding of insulin to its receptors on cell surfaces or inhibit the signaling pathways that mediate insulin's effects.

Examples of insulin antagonists include some glucocorticoids, thyroid hormones, and certain medications used to treat diabetes such as sulfonylureas and meglitinides. These drugs can increase blood sugar levels by stimulating the release of glucose from the liver or impairing the ability of insulin to promote glucose uptake in muscle and fat tissues.

It's important to note that while insulin antagonists can be useful in managing certain medical conditions, they can also contribute to the development of insulin resistance and diabetes if used inappropriately or in excess.

Amyloid is a term used in medicine to describe abnormally folded protein deposits that can accumulate in various tissues and organs of the body. These misfolded proteins can form aggregates known as amyloid fibrils, which have a characteristic beta-pleated sheet structure. Amyloid deposits can be composed of different types of proteins, depending on the specific disease associated with the deposit.

In some cases, amyloid deposits can cause damage to organs and tissues, leading to various clinical symptoms. Some examples of diseases associated with amyloidosis include Alzheimer's disease (where amyloid-beta protein accumulates in the brain), systemic amyloidosis (where amyloid fibrils deposit in various organs such as the heart, kidneys, and liver), and type 2 diabetes (where amyloid deposits form in the pancreas).

It's important to note that not all amyloid deposits are harmful or associated with disease. However, when they do cause problems, treatment typically involves managing the underlying condition that is leading to the abnormal protein accumulation.

Glycogenolysis is the biochemical process by which glycogen, a polymer of glucose, is broken down into its constituent glucose molecules. This process occurs primarily in the liver and muscles and is critical for maintaining normal blood glucose levels between meals and during periods of increased physical activity.

Glycogenolysis is initiated by the enzyme glycogen phosphorylase, which cleaves off individual glucose molecules from the end of a glycogen branch, resulting in the formation of glucose-1-phosphate. This compound is then converted to glucose-6-phosphate by the enzyme phosphoglucomutase.

Glucose-6-phosphate can be further metabolized through several pathways, including glycolysis or the pentose phosphate pathway, depending on the energy needs of the cell. In the liver, glucose-6-phosphatase can remove the phosphate group from glucose-6-phosphate to produce free glucose, which is released into the bloodstream and transported to other tissues for use as an energy source.

Overall, glycogenolysis plays a crucial role in maintaining normal blood glucose levels and providing energy to cells during periods of increased demand.

Cross reactions, in the context of medical diagnostics and immunology, refer to a situation where an antibody or a immune response directed against one antigen also reacts with a different antigen due to similarities in their molecular structure. This can occur in allergy testing, where a person who is allergic to a particular substance may have a positive test result for a different but related substance because of cross-reactivity between them. For example, some individuals who are allergic to birch pollen may also have symptoms when eating certain fruits, such as apples, due to cross-reactive proteins present in both.

Calcitonin gene-related peptide (CGRP) receptors are a type of cell surface receptor found in various tissues and cells, including the nervous system and blood vessels. CGRP is a neuropeptide that plays a role in regulating vasodilation, inflammation, and nociception (the sensation of pain).

The CGRP receptor is a complex of two proteins: calcitonin receptor-like receptor (CLR) and receptor activity-modifying protein 1 (RAMP1). When CGRP binds to the CLR-RAMP1 complex, it activates a signaling pathway that leads to vasodilation and increased pain sensitivity.

CGRP receptors have been identified as important targets for the treatment of migraine headaches, as CGRP levels are known to increase during migraine attacks. Several drugs that target CGRP receptors have been developed and approved for the prevention and acute treatment of migraines.

Cathelicidins are a family of antimicrobial peptides that are widely distributed in nature and play an important role in the innate immune system. They are expressed in various tissues, including the epithelia of the respiratory, gastrointestinal, and urogenital tracts, as well as in immune cells such as neutrophils and macrophages.

The human cathelicidin gene is called CAMP (camp gene) and encodes a precursor protein called hCAP-18 (human cationic antimicrobial protein of 18 kDa). After cleavage by proteolytic enzymes, the active peptide LL-37 is generated.

LL-37 has broad-spectrum antimicrobial activity against bacteria, viruses, fungi, and parasites. It also has immunomodulatory functions, such as chemotaxis of immune cells, modulation of cytokine production, and promotion of wound healing. Dysregulation of cathelicidins has been implicated in various inflammatory diseases, including chronic obstructive pulmonary disease (COPD), psoriasis, and rosacea.

Glycerol, also known as glycerine or glycerin, is a simple polyol (a sugar alcohol) with a sweet taste and a thick, syrupy consistency. It is a colorless, odorless, viscous liquid that is slightly soluble in water and freely miscible with ethanol and ether.

In the medical field, glycerol is often used as a medication or supplement. It can be used as a laxative to treat constipation, as a source of calories and energy for people who cannot eat by mouth, and as a way to prevent dehydration in people with certain medical conditions.

Glycerol is also used in the production of various medical products, such as medications, skin care products, and vaccines. It acts as a humectant, which means it helps to keep things moist, and it can also be used as a solvent or preservative.

In addition to its medical uses, glycerol is also widely used in the food industry as a sweetener, thickening agent, and moisture-retaining agent. It is generally recognized as safe (GRAS) by the U.S. Food and Drug Administration (FDA).

Diabetes Mellitus, Type 1 is a chronic autoimmune disease characterized by the destruction of insulin-producing beta cells in the pancreas, leading to an absolute deficiency of insulin. This results in an inability to regulate blood glucose levels, causing hyperglycemia (high blood sugar). Type 1 diabetes typically presents in childhood or early adulthood, although it can develop at any age. It is usually managed with regular insulin injections or the use of an insulin pump, along with monitoring of blood glucose levels and adjustments to diet and physical activity. Uncontrolled type 1 diabetes can lead to serious complications such as kidney damage, nerve damage, blindness, and cardiovascular disease.

Pyruvate kinase is an enzyme that plays a crucial role in the final step of glycolysis, a process by which glucose is broken down to produce energy in the form of ATP (adenosine triphosphate). Specifically, pyruvate kinase catalyzes the transfer of a phosphate group from phosphoenolpyruvate (PEP) to adenosine diphosphate (ADP), resulting in the formation of pyruvate and ATP.

There are several isoforms of pyruvate kinase found in different tissues, including the liver, muscle, and brain. The type found in red blood cells is known as PK-RBC or PK-M2. Deficiencies in pyruvate kinase can lead to a genetic disorder called pyruvate kinase deficiency, which can result in hemolytic anemia due to the premature destruction of red blood cells.

Biological models, also known as physiological models or organismal models, are simplified representations of biological systems, processes, or mechanisms that are used to understand and explain the underlying principles and relationships. These models can be theoretical (conceptual or mathematical) or physical (such as anatomical models, cell cultures, or animal models). They are widely used in biomedical research to study various phenomena, including disease pathophysiology, drug action, and therapeutic interventions.

Examples of biological models include:

1. Mathematical models: These use mathematical equations and formulas to describe complex biological systems or processes, such as population dynamics, metabolic pathways, or gene regulation networks. They can help predict the behavior of these systems under different conditions and test hypotheses about their underlying mechanisms.
2. Cell cultures: These are collections of cells grown in a controlled environment, typically in a laboratory dish or flask. They can be used to study cellular processes, such as signal transduction, gene expression, or metabolism, and to test the effects of drugs or other treatments on these processes.
3. Animal models: These are living organisms, usually vertebrates like mice, rats, or non-human primates, that are used to study various aspects of human biology and disease. They can provide valuable insights into the pathophysiology of diseases, the mechanisms of drug action, and the safety and efficacy of new therapies.
4. Anatomical models: These are physical representations of biological structures or systems, such as plastic models of organs or tissues, that can be used for educational purposes or to plan surgical procedures. They can also serve as a basis for developing more sophisticated models, such as computer simulations or 3D-printed replicas.

Overall, biological models play a crucial role in advancing our understanding of biology and medicine, helping to identify new targets for therapeutic intervention, develop novel drugs and treatments, and improve human health.

"Drug design" is the process of creating and developing a new medication or therapeutic agent to treat or prevent a specific disease or condition. It involves identifying potential targets within the body, such as proteins or enzymes that are involved in the disease process, and then designing small molecules or biologics that can interact with these targets to produce a desired effect.

The drug design process typically involves several stages, including:

1. Target identification: Researchers identify a specific molecular target that is involved in the disease process.
2. Lead identification: Using computational methods and high-throughput screening techniques, researchers identify small molecules or biologics that can interact with the target.
3. Lead optimization: Researchers modify the chemical structure of the lead compound to improve its ability to interact with the target, as well as its safety and pharmacokinetic properties.
4. Preclinical testing: The optimized lead compound is tested in vitro (in a test tube or petri dish) and in vivo (in animals) to evaluate its safety and efficacy.
5. Clinical trials: If the preclinical testing is successful, the drug moves on to clinical trials in humans to further evaluate its safety and efficacy.

The ultimate goal of drug design is to create a new medication that is safe, effective, and can be used to improve the lives of patients with a specific disease or condition.

BALB/c is an inbred strain of laboratory mouse that is widely used in biomedical research. The strain was developed at the Institute of Cancer Research in London by Henry Baldwin and his colleagues in the 1920s, and it has since become one of the most commonly used inbred strains in the world.

BALB/c mice are characterized by their black coat color, which is determined by a recessive allele at the tyrosinase locus. They are also known for their docile and friendly temperament, making them easy to handle and work with in the laboratory.

One of the key features of BALB/c mice that makes them useful for research is their susceptibility to certain types of tumors and immune responses. For example, they are highly susceptible to developing mammary tumors, which can be induced by chemical carcinogens or viral infection. They also have a strong Th2-biased immune response, which makes them useful models for studying allergic diseases and asthma.

BALB/c mice are also commonly used in studies of genetics, neuroscience, behavior, and infectious diseases. Because they are an inbred strain, they have a uniform genetic background, which makes it easier to control for genetic factors in experiments. Additionally, because they have been bred in the laboratory for many generations, they are highly standardized and reproducible, making them ideal subjects for scientific research.

Western blotting is a laboratory technique used in molecular biology to detect and quantify specific proteins in a mixture of many different proteins. This technique is commonly used to confirm the expression of a protein of interest, determine its size, and investigate its post-translational modifications. The name "Western" blotting distinguishes this technique from Southern blotting (for DNA) and Northern blotting (for RNA).

The Western blotting procedure involves several steps:

1. Protein extraction: The sample containing the proteins of interest is first extracted, often by breaking open cells or tissues and using a buffer to extract the proteins.
2. Separation of proteins by electrophoresis: The extracted proteins are then separated based on their size by loading them onto a polyacrylamide gel and running an electric current through the gel (a process called sodium dodecyl sulfate-polyacrylamide gel electrophoresis or SDS-PAGE). This separates the proteins according to their molecular weight, with smaller proteins migrating faster than larger ones.
3. Transfer of proteins to a membrane: After separation, the proteins are transferred from the gel onto a nitrocellulose or polyvinylidene fluoride (PVDF) membrane using an electric current in a process called blotting. This creates a replica of the protein pattern on the gel but now immobilized on the membrane for further analysis.
4. Blocking: The membrane is then blocked with a blocking agent, such as non-fat dry milk or bovine serum albumin (BSA), to prevent non-specific binding of antibodies in subsequent steps.
5. Primary antibody incubation: A primary antibody that specifically recognizes the protein of interest is added and allowed to bind to its target protein on the membrane. This step may be performed at room temperature or 4°C overnight, depending on the antibody's properties.
6. Washing: The membrane is washed with a buffer to remove unbound primary antibodies.
7. Secondary antibody incubation: A secondary antibody that recognizes the primary antibody (often coupled to an enzyme or fluorophore) is added and allowed to bind to the primary antibody. This step may involve using a horseradish peroxidase (HRP)-conjugated or alkaline phosphatase (AP)-conjugated secondary antibody, depending on the detection method used later.
8. Washing: The membrane is washed again to remove unbound secondary antibodies.
9. Detection: A detection reagent is added to visualize the protein of interest by detecting the signal generated from the enzyme-conjugated or fluorophore-conjugated secondary antibody. This can be done using chemiluminescent, colorimetric, or fluorescent methods.
10. Analysis: The resulting image is analyzed to determine the presence and quantity of the protein of interest in the sample.

Western blotting is a powerful technique for identifying and quantifying specific proteins within complex mixtures. It can be used to study protein expression, post-translational modifications, protein-protein interactions, and more. However, it requires careful optimization and validation to ensure accurate and reproducible results.

Gastrins are a group of hormones that are produced by G cells in the stomach lining. These hormones play an essential role in regulating gastric acid secretion and motor functions of the gastrointestinal tract. The most well-known gastrin is known as "gastrin-17," which is released into the bloodstream and stimulates the release of hydrochloric acid from parietal cells in the stomach lining.

Gastrins are stored in secretory granules within G cells, and their release is triggered by several factors, including the presence of food in the stomach, gastrin-releasing peptide (GRP), and vagus nerve stimulation. Once released, gastrins bind to specific receptors on parietal cells, leading to an increase in intracellular calcium levels and the activation of enzymes that promote hydrochloric acid secretion.

Abnormalities in gastrin production can lead to several gastrointestinal disorders, including gastrinomas (tumors that produce excessive amounts of gastrin), which can cause severe gastric acid hypersecretion and ulcers. Conversely, a deficiency in gastrin production can result in hypochlorhydria (low stomach acid levels) and impaired digestion.

I'd be happy to help! However, I believe there might be a slight misunderstanding in your question. Mitochondria are organelles found in the cells of all complex living organisms, including humans, while the liver is a large, solid organ located in the upper right portion of the abdomen. They don't have a medical definition together. I can certainly provide you with separate definitions for each:

1. Mitochondria: These are double-membrane-bound cellular organelles that generate most of the chemical energy needed to power the cell's biochemical reactions. Commonly known as the "powerhouse of the cell," mitochondria convert organic substrates, such as glucose, fatty acids, and amino acids, into adenosine triphosphate (ATP) through a process called oxidative phosphorylation. Mitochondria are dynamic structures that can change their shape, size, and number through fission (division) and fusion (merging) processes. They play essential roles in various cellular functions, including calcium signaling, apoptosis (programmed cell death), and the regulation of cellular metabolism.

2. Liver: The liver is a large, lobulated organ that lies mainly in the upper right portion of the abdominal cavity, just below the diaphragm. It plays a crucial role in various physiological functions, such as detoxification, protein synthesis, metabolism, and nutrient storage. The liver is responsible for removing toxins from the bloodstream, producing bile to aid in digestion, regulating glucose levels, synthesizing plasma proteins, and storing glycogen, vitamins, and minerals. It also contributes to the metabolism of carbohydrates, lipids, and amino acids, helping maintain energy homeostasis in the body.

I hope this clarifies any confusion! If you have any further questions or need more information, please don't hesitate to ask.

Tandem mass spectrometry (MS/MS) is a technique used to identify and quantify specific molecules, such as proteins or metabolites, within complex mixtures. This method uses two or more sequential mass analyzers to first separate ions based on their mass-to-charge ratio and then further fragment the selected ions into smaller pieces for additional analysis. The fragmentation patterns generated in MS/MS experiments can be used to determine the structure and identity of the original molecule, making it a powerful tool in various fields such as proteomics, metabolomics, and forensic science.

Immunohistochemistry (IHC) is a technique used in pathology and laboratory medicine to identify specific proteins or antigens in tissue sections. It combines the principles of immunology and histology to detect the presence and location of these target molecules within cells and tissues. This technique utilizes antibodies that are specific to the protein or antigen of interest, which are then tagged with a detection system such as a chromogen or fluorophore. The stained tissue sections can be examined under a microscope, allowing for the visualization and analysis of the distribution and expression patterns of the target molecule in the context of the tissue architecture. Immunohistochemistry is widely used in diagnostic pathology to help identify various diseases, including cancer, infectious diseases, and immune-mediated disorders.

Protein sequence analysis is the systematic examination and interpretation of the amino acid sequence of a protein to understand its structure, function, evolutionary relationships, and other biological properties. It involves various computational methods and tools to analyze the primary structure of proteins, which is the linear arrangement of amino acids along the polypeptide chain.

Protein sequence analysis can provide insights into several aspects, such as:

1. Identification of functional domains, motifs, or sites within a protein that may be responsible for its specific biochemical activities.
2. Comparison of homologous sequences from different organisms to infer evolutionary relationships and determine the degree of similarity or divergence among them.
3. Prediction of secondary and tertiary structures based on patterns of amino acid composition, hydrophobicity, and charge distribution.
4. Detection of post-translational modifications that may influence protein function, localization, or stability.
5. Identification of protease cleavage sites, signal peptides, or other sequence features that play a role in protein processing and targeting.

Some common techniques used in protein sequence analysis include:

1. Multiple Sequence Alignment (MSA): A method to align multiple protein sequences to identify conserved regions, gaps, and variations.
2. BLAST (Basic Local Alignment Search Tool): A widely-used tool for comparing a query protein sequence against a database of known sequences to find similarities and infer function or evolutionary relationships.
3. Hidden Markov Models (HMMs): Statistical models used to describe the probability distribution of amino acid sequences in protein families, allowing for more sensitive detection of remote homologs.
4. Protein structure prediction: Methods that use various computational approaches to predict the three-dimensional structure of a protein based on its amino acid sequence.
5. Phylogenetic analysis: The construction and interpretation of evolutionary trees (phylogenies) based on aligned protein sequences, which can provide insights into the historical relationships among organisms or proteins.

Genetic transcription is the process by which the information in a strand of DNA is used to create a complementary RNA molecule. This process is the first step in gene expression, where the genetic code in DNA is converted into a form that can be used to produce proteins or functional RNAs.

During transcription, an enzyme called RNA polymerase binds to the DNA template strand and reads the sequence of nucleotide bases. As it moves along the template, it adds complementary RNA nucleotides to the growing RNA chain, creating a single-stranded RNA molecule that is complementary to the DNA template strand. Once transcription is complete, the RNA molecule may undergo further processing before it can be translated into protein or perform its functional role in the cell.

Transcription can be either "constitutive" or "regulated." Constitutive transcription occurs at a relatively constant rate and produces essential proteins that are required for basic cellular functions. Regulated transcription, on the other hand, is subject to control by various intracellular and extracellular signals, allowing cells to respond to changing environmental conditions or developmental cues.

  • The glucoincretin hormone glucagon-like peptide 1 (GLP-1) enhances glucose-stimulated insulin secretion and stimulates pancreatic β-cell mass expansion. (diabetesjournals.org)
  • GLP-1 improves insulin secretion in subjects with impaired glucose tolerance and type 2 diabetes ( 5 ). (diabetesjournals.org)
  • In humans, obesity is also associated with reduced nutrient-stimulated secretion of the intestinal incretin hormone, glucagon-like peptide-1 (GLP-1). (nih.gov)
  • GLP-1 (7-36) amide was supposed to improved glycemic control in patients with type 2 diabetes by increasing insulin secretion, by inhibiting glucagon secretion and by delaying gastric emptying rather than by altering extrapancreatic glucose metabolism. (biovendor.com)
  • decreases glucagon secretion from the pancreas . (wikidoc.org)
  • They are given by injection, and regulate glucose levels by stimulating glucose-dependent insulin secretion and biosynthesis, suppressing glucagon secretion, and delaying gastric emptying and promoting satiety. (biomedcentral.com)
  • Recent evidence shows that these SGLT2 inhibitors with low SGLT2/SGLT1 selectivity elevate the level of circulating glucagon like peptide-1 (GLP-1), an incretin hormone that promotes insulin secretion in pancreatic β cells. (omicsdi.org)
  • cells regulates glucagon secretion in mice, possibly explaining the distinct effects of SGLT2 inhibitors on plasma glucagon levels. (omicsdi.org)
  • Little is known about regulated glucagon secretion by human islet α-cells compared to insulin secretion from β-cells, despite conclusive evidence of dysfunction in both cell types in diabetes mellitus. (nature.com)
  • Fig. 2: Transplanted human islets retain regulated glucagon secretion in GKO-NSG mice. (nature.com)
  • Fig. 6: Excessive glucagon secretion by transplanted T2D islets in GKO-NSG mice. (nature.com)
  • Stimulates insulin secretion, suppresses glucagon secretion and delays gastric emptying. (drugfuture.com)
  • Liraglutide also decreases glucagon secretion in a glucose-dependent manner. (empr.com)
  • Glucagon-like peptide 1 (GLP-1) exhibits considerable potential for the treatment of type 2 diabetes because of its effects on stimulation of insulin secretion and the inhibition of gastric emptying, appetite, and glucagon secretion. (diabetesjournals.org)
  • Glucagon-like peptide 1 (GLP-1) lowers blood glucose through several distinct mechanisms that include amplification of glucose-stimulated insulin secretion and inhibition of both glucagon secretion and gastric emptying. (diabetesjournals.org)
  • Glucagon-like peptide 1 (GLP-1) is an incretin hormone that powerfully stimulates insulin secretion. (mayo.edu)
  • Understanding how genes and the environment interact to affect insulin secretion, insulin action, weight and appetite will help inform more rational treatments for type 2 diabetes. (mayo.edu)
  • They mimic the action of GLP-1 to reduce glucose levels through stimulation of insulin secretion and inhibition of glucagon secretion. (lu.se)
  • Type 2 is characterized by insulin resistance and deficiency of insulin secretion. (who.int)
  • Type 2 is characterized by insulin resistance partial blindness, 30-45% some degree of retinopathy, and deficiency of insulin secretion. (who.int)
  • Regarding β -cell function in patients with LADA, some but not all studies show an accelerated decline in insulin secretion comparedwith type 2 diabetes. (medscape.com)
  • The incretin hormones GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) are released from the intestine after food ingestion to stimulate insulin secretion in a glucose-dependent manner. (lu.se)
  • The primary aim of treatments for type 2 diabetes is to control blood glucose and reduce the development of diabetes-associated secondary complications[ 1 ]. (biomedcentral.com)
  • During weeks 2 and 3, glucose tolerance tests (GTT), insulin tolerance tests (ITT), and meal tolerance tests (MTT) were performed to evaluate blood glucose, plasma, and insulin. (frontiersin.org)
  • Glucagon-like peptide-1 is an important incretin hormone that helps reduce blood glucose levels but, in people with type 2 diabetes, its production is often reduced or absent. (prnewswire.com)
  • In addition, GLP-1/glucagon and GLP-1/GIP dual receptor agonists and GLP-1/GIP/glucagon triple receptor agonists have shown the potential to reduce blood glucose levels and body weight through their effects on islets and peripheral tissues, improving beta cell function and stimulating energy expenditure. (lu.se)
  • It is a major drug used in obese patients with type 2 diabetes. (medscape.com)
  • We identified 28 randomised controlled trials comparing GLP-1 analogues with placebo, other glucose-lowering agents, or another GLP-1 analogue, in patients with type 2 diabetes with inadequate control on a single oral agent, or on dual therapy. (biomedcentral.com)
  • These findings suggest that a combination of canagliflozin or sotagliflozin and a DPP4 inhibitor can provide a beneficial effect associated with elevation of circulating active GLP-1 and may serve as a treatment for patients with type 2 diabetes. (omicsdi.org)
  • Sodium glucose cotransporter 2 (SGLT2) inhibitors and glucagon-like peptide 1 receptor agonists (GLP-1 RAs) have been demonstrated to be able to improve the cardiovascular and renal prognosis in patients with type 2 diabetes (T2D). (omicsdi.org)
  • The researchers aimed to assess the efficacy and safety of adding once-weekly tirzepatide compared with thrice-daily prandial insulin lispro as an adjunctive therapy to insulin glargine for patients with type 2 diabetes that was inadequately controlled with basal insulin. (medscape.com)
  • As an adjunct to diet and exercise, to improve glycemic control in patients with type 2 diabetes mellitus (T2DM). (empr.com)
  • Albiglutide was licensed by the European Medicines Agency in March 2014 , under the brand name Eperzan ® , for use in adult patients with type 2 diabetes. (prnewswire.com)
  • We recruited patients with type 2 diabetes from 3 public health clinics in Jordan. (who.int)
  • We validated an Arabic tool that can be used to evaluate QoL among Arabic-speaking patients with type 2 diabetes. (who.int)
  • Patients with type 2 diabetes mellitus are often initially treated with only diet and exercise. (msdmanuals.com)
  • Insulin is also used in the management of many patients with type 2 diabetes. (msdmanuals.com)
  • According to current estimates, up to 10% of all patients with type 2 diabetes meet the criteria of LADA. (medscape.com)
  • [ 12 ] Of note, the metabolic phenotype might be determined by the antibody titer in that patients with a high GAD antibody titer are phenotypically closer to type 1 diabetes with lower body mass index (BMI), whereas those with a low GAD antibody titer resemble patients with type 2 diabetes. (medscape.com)
  • To determine the respective associations of premorbid glucagon-like peptide-1 receptor agonists (GLP1-RA) and sodium-glucose-linked cotransporter 2 inhibitors (SGLT2i) use, compared to premorbid dipeptidyl peptidase-4 inhibitor (DPP4i) use, with severity of outcomes in the setting of COVID-19 infection. (figshare.com)
  • Cochrane Abstracts , Evidence Central , evidence.unboundmedicine.com/evidence/view/Cochrane/433293/all/Dipeptidyl_peptidase���4_inhibitors__glucagon���like_peptide_1_receptor_agonists_and_sodium���glucose_co���transporter���2_inhibitors_for_people_with_cardiovascular_disease:_a_network_meta���analysis_New. (unboundmedicine.com)
  • Effect of Sodium Glucose Cotransporter 2 Inhibitors With Low SGLT2/SGLT1 Selectivity on Circulating Glucagon-Like Peptide 1 Levels in Type 2 Diabetes Mellitus. (omicsdi.org)
  • Sodium glucose cotransporter 2 (SGLT2) inhibitors are a new class of antidiabetic drugs that improve glycemic control by inhibiting reabsorption of glucose filtered through the renal glomerulus. (omicsdi.org)
  • Examine trends and disparities in use of and expenditures for three new classes of diabetes drugs (glucagon-like peptide-1 receptor agonists, dipeptidyl peptidase 4 inhibitors, and sodium-glucose cotransporter-2 inhibitors) by race, ethnicity, insurance coverage, education, and income. (commonwealthfund.org)
  • Cost-Utility Analysis of Glucagon-Like Peptide-1 Agonists Compared with Dipeptidyl Peptidase-4 Inhibitors or Neutral Protamine Hagedorn Basal Insulin as Add-On to Metformin in Type 2 Diabetes in Sweden. (lu.se)
  • Clinical course after immune checkpoint inhibitors treatment initiation for type 1 diabetes mellitus associated with nivolumab after second SARS-CoV-2 vaccination, Japan. (cdc.gov)
  • glucosidase inhibitors, glucagon-like peptide-1 receptor agonists, dipeptidyl peptidase-IV inhibitors, sodium glucose co-transporter 2 inhibitors, bromocriptine, and bile acid sequestrants. (cdc.gov)
  • Finally, GLP-2 did not alter other markers of intestinal or pancreatic gene expression, including levels of mRNA transcripts for ornithine decarboxylase, multidrug resistance gene, amylase, proglucagon, proinsulin, and prosomatostatin. (nih.gov)
  • Activation of the glucagon-like peptide-1 receptor (GLP-1R) upon ligand binding results in the discharge of insulin from pancreatic cells. (ncbcs.org)
  • We sought to understand whether pancreatic GLP-1 alters islet function in humans and whether this is affected by type 2 diabetes.METHODS We therefore studied individuals with and without type 2 diabetes on two occasions in random order. (jci.org)
  • The pancreatic processing enzymes, PC1 and PC2, convert proinsulin to insulin and convert proglucagon to glucagon and glucagon-like peptide 1 (GLP-1). (jci.org)
  • Pancreatic PC1 and PC2 mRNA increased >2-fold and >4-fold, respectively, in rats receiving intraperitoneal STZ (50 mg/kg) daily for 5 days. (jci.org)
  • Immunocytochemistry revealed that, although pancreatic islet cells in the STZ-treated rats were sparse and atrophic PC1, PC2, glucagon, and GLP-1 immunoreactivity increased dramatically in the remaining islet cells. (jci.org)
  • Glucagon knockout NSG (GKO-NSG) mice have metabolic, liver and pancreatic phenotypes associated with glucagon-signalling deficits that revert after transplantation of human islets from non-diabetic donors. (nature.com)
  • The effects of daily administration of a novel dipeptidyl peptidase IV-resistant glucagon-like peptide-1 (GLP-1) analog, (Val(8))GLP-1, on glucose tolerance and pancreatic beta-cell function were examined in obese-diabetic (ob/ob) mice. (ulster.ac.uk)
  • Glucagon-like peptide 1 (1-37) (human, rat) is a pancreatic hormone synthesized by post-translational processing of proglucagon. (tocris.com)
  • Recombinant GLP-1 (7-36) amide was recently shown to cause significant weight loss in type 2 diabetics when administered for 6 weeks as a continuous subcutaneous infusion, 5-day treatment of hereby obese human subjects with GLP-1 at high doses by prandial subcutaneous infusion promptly slowed gastric emptying as a probable mechanism of action of increased satiety, decreased hunger and reduced food intake with an ensuing weight loss. (biovendor.com)
  • GLP-1 stimulates glucose-dependent insulin release, inhibits glucagon release, delays gastric emptying, and suppresses the appetite through GLP-1 receptor binding. (e-dmj.org)
  • We tested whether treatment with the intestinotrophic hormone glucagon-like peptide-2 (GLP-2) increases intestinal volume and function in the period immediately following intestinal resection in preterm pigs. (unboundmedicine.com)
  • Results of low-dose recombinant human insulin-like development factor-I on insulin sensitivity, development hormone and glucagon ranges in younger adults with insulin-dependent diabetes mellitus. (ncbcs.org)
  • We've studied the results of low-dose bolus subcutaneous rhIGF-I (40 microg/kg and 20 microg/kg) on insulin sensitivity, development hormone (GH) and glucagon ranges in seven younger adults with insulin-dependent diabetes mellitus (IDDM) utilizing a randomized double-blind placebo-controlled crossover research design. (ncbcs.org)
  • The glucoincretin hormone glucagon-like peptide 1-[7-36]amide (GLP-1) ( 1 - 3 ) is a potent therapeutic agent in the treatment of diabetes ( 4 ). (diabetesjournals.org)
  • GLP-1 is a peptide hormone from the intestinal mucosa, which is produced from its precursor, proglucagon by post transnational processing. (biovendor.com)
  • Incretin hormone includes glucagon-like peptide-1 (GLP-1) from L-cells and glucose-dependent insulinotrophic polypeptide from K-cells of the small intestine. (e-dmj.org)
  • GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium. (immunoportal.com)
  • This review summarises developments in gut hormone-based therapies and presents the future outlook for their use in type 2 diabetes and obesity. (lu.se)
  • Glucagon-like peptide-1 (GLP-1) receptor agonist. (empr.com)
  • Liraglutide is an acylated human Glucagon-Like Peptide-1 (GLP-1) receptor agonist with 97% amino acid sequence homology to endogenous human GLP-1(7-37). (empr.com)
  • Hence, current GLP-1-based therapies are focused on the use of GLP-1 mimetics with protracted action, including the lizard peptide exendin-4 (Ex-4), a DPP-4-resistant GLP-1 receptor agonist that can reduce both fasting and postprandial glucose levels in type 2 diabetic patients ( 5 ). (diabetesjournals.org)
  • Albiglutide, a glucagon-like peptide-1 receptor agonist (GLP-1), is a biological product for the treatment of type 2 diabetes, administered once-weekly using an injector pen supplied with a 5mm 29-gauge thin-walled needle. (prnewswire.com)
  • Tanzeum is a GLP-1 receptor agonist indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus. (prnewswire.com)
  • In people with type 2 diabetes, fasting glucagon concentrations were markedly elevated and persisted despite hyperglycemia. (jci.org)
  • This impaired suppression of endogenous glucose production by hyperglycemia.CONCLUSION These data show that GLP1R blockade impairs islet function, implying that intra-islet GLP1R activation alters islet responses to glucose and does so to a greater degree in people with type 2 diabetes.TRIAL REGISTRATION This study was registered at ClinicalTrials.gov NCT04466618.FUNDING The study was primarily funded by NIH NIDDK DK126206. (jci.org)
  • Initially people with type 2 diabetes should be advised on lifestyle changes (weight loss, increasing physical activity, diet) and offered ongoing patient education. (biomedcentral.com)
  • Many people with type 2 diabetes start with the oral drug metformin (Glucophage) to help meet their blood sugar level goals. (everydayhealth.com)
  • Sulfonylurea drugs have also been used for many years to help people with type 2 diabetes control their blood sugar. (everydayhealth.com)
  • These medicines are especially useful among people with type 2 diabetes who are at risk of low blood sugar or lactic acidosis. (everydayhealth.com)
  • The hormonal pathway regulating production of GLP-1 is harnessed by various therapeutic interventions designed to improve glucose homeostasis in people with type 2 diabetes. (mayo.edu)
  • Once in the circulation, GLP-1 has a half life of less than 2 minutes, due to rapid degradation by the enzyme dipeptidyl peptidase-4 . (wikidoc.org)
  • Despite the efficacy of continuous GLP-1 administration for the treatment of type 2 diabetic patients ( 3 ), the clinical potential of the native peptide is hampered by its very short plasma half-life, due to rapid inactivation of GLP-1 by the ubiquitous protease dipeptidyl peptidase-4 (DPP-4) ( 4 ) and by renal clearance. (diabetesjournals.org)
  • Both GIP and GLP-1 are rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP IV), inhibition of which is a novel approach to enhance incretin levels in the treatment of type 2 diabetes. (lu.se)
  • Here, we use CRISPR-Cas9 editing to remove glucagon codons 2-29 in immunocompromised NSG mice, preserving the production of other proglucagon-derived hormones. (nature.com)
  • Prebiotic increased the endogenous intestinotrophic proglucagon-derived peptide (GLP-2) production whereas the GLP-2 antagonist abolished most of the prebiotic effects. (bmj.com)
  • Intestinal resection was associated with markedly reduced endogenous GLP-2 levels. (unboundmedicine.com)
  • It has been demonstrated that glucagon-like peptide-1 (GLP-1), which is an endogenous insulinotropic peptide secreted from the intestine, binds to its receptor within the mind and possesses neuroprotective results. (ncbcs.org)
  • We found that a selective gut microbiota change controls and increases endogenous GLP-2 production, and consequently improves gut barrier functions by a GLP-2-dependent mechanism, contributing to the improvement of gut barrier functions during obesity and diabetes. (bmj.com)
  • GLP-1 is a 37 amino acids peptide and produced in the small intestine and in the pancreas in the human, in either C-terminal-amidated on glycine-extended form. (biovendor.com)
  • Tirzepatide activates the body's receptors for glucose-dependent insulinotropic polypeptide and glucagon-like peptide-1 (GLP-1). (medscape.com)
  • Glucagon-like peptide-2 (GLP-2) stimulates small intestinal growth through induction of intestinal epithelial proliferation. (nih.gov)
  • To examine the physiology of GLP-2-induced bowel, mice were treated with GLP-2 (2.5 micrograms) or vehicle for 10 days. (nih.gov)
  • Oral or duodenal administration of glucose or maltose did not reveal any differences in the ability of GLP-2-treated mice to absorb these nutrients, possibly because of decreases in expression of the glucose transporters sodium-dependent glucose transporter-1 (SGLT-1) and GLUT-2. (nih.gov)
  • Thus induction of intestinal growth by GLP-2 in wild-type mice results in a normal-to-increased capacity for nutrient digestion and absorption in vivo. (nih.gov)
  • Hyperglycemia and hyperinsulinemia were reduced in HFD mice treated with the anti-TNFα biological, etanercept, for 2 weeks. (nih.gov)
  • Distinct insulins in humans and mice permit in vivo studies of human β-cell regulation after human islet transplantation in immunocompromised mice, whereas identical glucagon sequences prevent analogous in vivo measures of glucagon output from human α-cells. (nature.com)
  • Fig. 3: Human islet transplantation establishes a glucagon-signalling axis that corrects liver phenotypes in GKO-NSG mice. (nature.com)
  • MT-Exendin mice generate antibodies directed against Ex-4, exendin NH 2 -terminal peptide (ENTP), and proexendin-4 as well as antibodies that cross-react with native GLP-1. (diabetesjournals.org)
  • Study 2: Ob-CT and Ob-Pre mice were treated with GLP-2 antagonist or saline. (bmj.com)
  • Intravenous GLP-1(7-37) and (7-36)amide could normalize fasting hyperglycaemia in type 2 diabetic patients. (biovendor.com)
  • β -Cell function was assessed from glucagon tests and intravenous glucose tolerance tests (IVGTTs), and insulin sensitivity was determined from hyperinsulinemic-euglycemic clamps. (medscape.com)
  • Cells found throughout the lining of the GASTROINTESTINAL TRACT that contain and secrete regulatory PEPTIDE HORMONES and/or BIOGENIC AMINES. (bvsalud.org)
  • GLP-1 also has anorectic effects, and short-term infusions of GLP-1 promote satiety and reduce food intake in normal, obese, and diabetic humans ( 2 ). (diabetesjournals.org)
  • 1 2 Evidence that the gut microbiota composition can be different between healthy and obese and/or type 2 diabetic patients has led to the investigation of this environmental element as a key factor in the pathophysiology of metabolic diseases. (bmj.com)
  • This treatment also caused a 2-fold increase in the ratio of amidated forms of GLP-1 immunoreactivity to total glucagon immunoreactivity in the pancreas but did not affect the ratio of proinsulin to insulin. (jci.org)
  • Tsapas highlighted, "These data further support the very high dual glucose and weight efficacy of tirzepatide and the primary role of incretin-related therapies amongst the injectables for the treatment of type 2 diabetes. (medscape.com)
  • fasting C-peptide immunoreactivity (CPR) was 0.33 ng/mL, 24-hour urinary CPR 5.74 μg/day and 3.82 μg/day, and ΔCPR during the glucagon load test was 0.03 ng/mL ( Table ). (cdc.gov)
  • Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. (wikipedia.org)
  • When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. (wikipedia.org)
  • OBJECTIVE: To examine the effect of a GLP-2 infusion on appetite sensations and ad libitum energy intake in healthy, normal weight humans. (ku.dk)
  • BACKGROUND Proglucagon can be processed to glucagon-like peptide1 (GLP-1) within the islet, but its contribution to islet function in humans remains unknown. (jci.org)
  • previously termed latent autoimmune diabetes of adults], type 1 diabetes [antibody positive/insulin positive (ab+/ins+)], and type 2 diabetes [antibody negative/insulin negative (ab−/ins−)], as well as glucose-tolerant humans (controls) of the German Diabetes Study (n = 41/group). (medscape.com)
  • Journal of Pharmacology and Experimental Therapeutics , 318 (2), 914-921. (ulster.ac.uk)
  • However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy. (wikipedia.org)
  • Comparative efficacy of 5 sodium glucose cotransporter 2 inhibitor and 7 glucagon-like peptide 1 receptor agonists interventions on cardiorenal outcomes in type 2 diabetes patients: A network meta-analysis based on cardiovascular or renal outcome trials. (omicsdi.org)
  • These effects were consistently greater with (Val(8))GLP-1 than with native GLP-1, and both peptides retained or increased their acute efficacy compared with initial administration. (ulster.ac.uk)
  • It contains within its structure the sequences of glucagon and two glucagon-like peptides (GLP-1 and GLP-2) in tandem flanked at their amino and carboxyl termini by dibasic residues. (biovendor.com)
  • Originally identified as a 37 amino acid peptide, GLP-1 (1-37), that is truncated to the bioactive forms, GLP-1 (7-37) and GLP-1 (7-36) amide. (drugfuture.com)
  • GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. (wikipedia.org)
  • Bariatric surgery is associated with remission of type 2 diabetes, providing an invaluable opportunity to understand how caloric restriction and weight loss alter glucose metabolism. (mayo.edu)
  • Among all of the noninsulin drugs currently in use to treat type 2 diabetes in adults, the US Food and Drug Administration (FDA) has approved metformin, liraglutide, and exenatide extended-release for use in children with type 2 DM. (medscape.com)
  • Exenatide twice daily and insulin gave similar reductions in HbA1c, but exenatide 2 mg once weekly and liraglutide 1.8 mg daily reduced it by 0.20% and 0.30% respectively more than glargine. (biomedcentral.com)
  • Exenatide 2 mg weekly and liraglutide 1.8 mg daily reduced HbA1c by more than exenatide 10 μg twice daily and sitagliptin 100 mg daily. (biomedcentral.com)
  • Exenatide 2 mg weekly and liraglutide 1.8 mg daily reduced HbA1c by more than exenatide 10 ug twice daily and sitagliptin 100 mg daily. (elsevierpure.com)
  • The results of cardiovascular outcome trials of long-acting GLP-1RAs (liraglutide, semaglutide) demonstrated cardiovascular benefits in subjects with type 2 diabetes mellitus and a high risk of cardiovascular disease. (e-dmj.org)
  • Computational Design of Potent and Selective d-Peptide Agonists of the Glucagon-like Peptide-2 Receptor. (bvsalud.org)
  • Here, we designed three d-GLP-2 agonists that activated the glucagon-like peptide-2 receptor (GLP-2R) cyclic adenosine monophosphate (cAMP) accumulation without stimulating the glucagon-like peptide-1 receptor (GLP-1R). (bvsalud.org)
  • All the d-GLP-2 agonists increased the protein kinase B phosphorylated (p-AKT) expression levels in a time - and concentration-dependent manner in vitro . (bvsalud.org)
  • The higher stability to protease degradation of our d-GLP-2 agonists helps us envision their potential applications in enhancing intestinal absorption and treating inflammatory bowel illness while lowering the high dosage required by the current treatments . (bvsalud.org)
  • The glucagon-like peptide-1 receptor agonists (GLP-1RAs) were recommended as a monotherapy or combination therapy with oral hypoglycemic agents or basal insulin in the position statement of the Korean Diabetes Association 2017 for pharmacological therapy. (e-dmj.org)
  • It belongs to a group of medications called glucagon-like peptide-1 agonists . (healthline.com)
  • Glucagon-like peptide-1 (GLP-1) receptor agonists are established pharmaceutical therapies for the treatment of type 2 diabetes and obesity. (lu.se)
  • If those measures are not sufficient for glycemic control, patients may be prescribed non- insulin antihyperglycemic medications (eg, injectable glucagon -like peptide-1 [GLP-1] receptor agonists), insulin , or a combination of these medications. (msdmanuals.com)
  • Previous treatment with glucagon-like peptide-1 receptor (GLP-1)agonists within 3 months before screening. (who.int)
  • The enhancement in the p-AKT levels induced by the d-GLP-2 analogues could be explained by GLP-2R's more prolonged activation, given that the d-GLP-2 analogues induce a lower ß- arrestin recruitment. (bvsalud.org)
  • Glucagon-like peptide (GLP-1) analogues are a new class of drugs used in the treatment of type 2 diabetes. (biomedcentral.com)
  • BACKGROUND: Glucagon-like peptide (GLP-1) analogues are a new class of drugs used in the treatment of type 2 diabetes. (elsevierpure.com)
  • CONCLUSION: Circulating GLP-2 in physiological concentrations does not seem to play a significant role in human appetite regulation. (ku.dk)
  • What Medications Are Used to Treat Type 2 Diabetes? (everydayhealth.com)
  • Teduglutide injection is in a class of medications called glucagon-like peptide-2 (GLP-2) analogs. (medlineplus.gov)
  • 2,3 Treatment options include lifestyle changes such as increased physical activity and diet but, as the condition progresses, patients may require the addition of oral and injectable medications to control blood sugar levels and, ultimately, the use of insulin, either daily or with meals. (prnewswire.com)
  • In general, the treatment of type 2 diabetes in children follows the same rationale as does treatment for the disease in adults. (medscape.com)
  • Kooy et al found improved body weight, glycemic control, and insulin requirements when metformin was added to insulin in type 2 diabetes mellitus. (medscape.com)
  • Because of these sustained beneficial effects, the policy to continue metformin treatment after the introduction of insulin in type 2 diabetes mellitus should be followed unless contraindicated. (medscape.com)
  • The GLP-1-based therapy of type 2 diabetes, therefore, represents a new and attractive alternative. (biovendor.com)
  • Type 2 diabetes is usually a progressive disease, with loss of beta cell capacity[ 4 ]. (biomedcentral.com)
  • Glucagon hypersecretion by transplanted islets from donors with type 2 diabetes revealed islet-intrinsic defects. (nature.com)
  • RNA sequencing of single human islet cells reveals type 2 diabetes genes. (nature.com)
  • If you're managing type 2 diabetes, you'll need to work with your doctor to identify a treatment approach that supports your individual goals. (everydayhealth.com)
  • Treatment of type 2 diabetes is not limited to the occasional visit to the doctor: It includes important types of self-care in addition to regular medical care from doctors and other healthcare providers, such as dietitians and mental health professionals. (everydayhealth.com)
  • The latest updates about care for type 2 diabetes can be found in the American Diabetes Association's 2023 Standards of Medical Care , which lists treatment guidelines related to diabetes, complications, new technology, and more. (everydayhealth.com)
  • Can Berberine Help Prevent or Treat Type 2 Diabetes? (everydayhealth.com)
  • Are There Any New Type 2 Diabetes Drugs on the Horizon? (everydayhealth.com)
  • Type 2 diabetes is a chronic disease. (harvard.edu)
  • Type 2 diabetes is also called type 2 diabetes mellitus and adult-onset diabetes. (harvard.edu)
  • Type 2 diabetes is much more common than type 1 diabetes, and is really a different disease. (harvard.edu)
  • Type 2 diabetes occurs when your body's cells resist the normal effect of insulin, which is to drive glucose in the blood into the inside of the cells. (harvard.edu)
  • Type 2 diabetes runs in families. (harvard.edu)
  • In some cases, hyperosmolar syndrome is the first sign that a person has type 2 diabetes. (harvard.edu)
  • The treatment of type 2 diabetes also can produce symptoms. (harvard.edu)
  • Type 2 diabetes affects all parts of the body. (harvard.edu)
  • The risk of cancers appears to be increased in both type 1 diabetes mellitus (T1DM) and type 2 diabetes mellitus (T2DM) ( 2 ). (frontiersin.org)
  • If you have type 2 diabetes ,* your doctor might suggest Bydureon BCise (extended-release exenatide) as a treatment option for you. (healthline.com)
  • Bydureon BCise is a prescription medication used to treat type 2 diabetes in adults and children ages 10 years and older. (healthline.com)
  • If you have a child younger than that with type 2 diabetes , talk with your doctor about the available treatment options. (healthline.com)
  • HAMBURG, Germany ― Once-weekly tirzepatide (Mounjaro, Lilly) added to insulin glargine resulted in greater reductions in A1c along with more weight loss and less hypoglycemia compared with prandial insulin lispro (Humalog, Sanofi) for patients with inadequately controlled type 2 diabetes, show data from the SURPASS-6 randomized clinical trial. (medscape.com)
  • This is particularly true when it adds complexity, as in the case of multiple prandial insulin injections on top of basal insulin in suboptimally treated individuals with type 2 diabetes. (medscape.com)
  • The open-label, phase 3b clinical trial drew data from 135 sites across 15 countries and included 1428 adults with type 2 diabetes who were taking basal insulin. (medscape.com)
  • GSK ) today announced that the US Food and Drug Administration (FDA) has approved Tanzeum ™ (albiglutide) for injection, for subcutaneous use, as a once-weekly treatment for type 2 diabetes. (prnewswire.com)
  • Vlad Hogenhuis, Senior Vice-President and Head, GSK Global Cardiovascular, Metabolic and Neurosciences Franchise, said: "Many type 2 diabetes patients struggle to keep their blood sugar within the recommended levels. (prnewswire.com)
  • The Harmony studies evaluated albiglutide against commonly-used classes of type 2 diabetes treatment, including insulin, metformin, glimepiride and pioglitazone, in patients at different stages of the disease, as well as those with renal impairment. (prnewswire.com)
  • 1 Up to 95% of these patients have type 2 diabetes. (prnewswire.com)
  • 1 Type 2 diabetes is a life-long, progressive and, in some cases, preventable condition characterized by high blood sugar levels, known as hyperglycemia. (prnewswire.com)
  • A lack of physical activity, obesity, increasing age, high blood pressure and genetics are known risk factors that can contribute to the development of type 2 diabetes. (prnewswire.com)
  • Adrian Vella, M.D., studies the pathogenesis of type 2 diabetes. (mayo.edu)
  • Type 2 diabetes is a common metabolic disorder that arises out of a complex interaction between genes and the environment. (mayo.edu)
  • Type 2 diabetes is preceded by an intermediate condition called prediabetes, which occurs during the transition from normal fasting glucose to diabetes. (mayo.edu)
  • Mechanisms of association between TCF7L2 and type 2 diabetes. (mayo.edu)
  • A better understanding of the processes that interact to cause the defects present in type 2 diabetes has important implications in terms of preventing and treating the disease. (mayo.edu)
  • Here, we hypothesised that prebiotic modulation of gut microbiota lowers intestinal permeability, by a mechanism involving glucagon-like peptide-2 (GLP-2) thereby improving inflammation and metabolic disorders during obesity and diabetes. (bmj.com)
  • New Zealand is well behind the rest of the developed world in access to funded drugs for managing type 2 diabetes. (auckland.ac.nz)
  • This is extremely difficult for New Zealanders with type 2 diabetes when we do not have access to modern drug treatments. (auckland.ac.nz)
  • We sought to evaluate temporal trends and predictors of achieving glycemic control among adults with type 2 diabetes covered by Alabama Medicaid from 2011 through 2019. (cdc.gov)
  • 8%, more work is needed to improve outcomes of low-income adults with type 2 diabetes. (cdc.gov)
  • The prevalence of diabetes in the US increased during the past 2 decades (1). (cdc.gov)
  • in 2019, 14% of adults had diabetes, ranking third among the states, up from 8.4% in 2004 (2). (cdc.gov)
  • We report a patient who had immune checkpoint inhibitor‒associated type 1 diabetes mellitus that developed after a second mRNA-based SARS-CoV-2 vaccination. (cdc.gov)
  • We report a patient who had checkpoint inhibitor‒induced diabetes mellitus develop after he received a second mRNA-based SARS-CoV-2 vaccination. (cdc.gov)
  • To develop and validate a revised Arabic version of the DQoL questionnaire for patients in Jordan with type 2 diabetes. (who.int)
  • Among patients diagnosed with type 2 diabetes, autoimmune diabetes often remains undetected. (medscape.com)
  • Of the ab+/ins− patients, 33 (81%) were initially diagnosed as having type 2 diabetes. (medscape.com)
  • [ 5 ] These patients may present with some clinical characteristics of type 2 diabetes [ 8 ] and are preferentially treated with oral glucose-lowering medication or incretins, as insulin is not required during the first years after diagnosis. (medscape.com)
  • [ 14 , 15 ] However, only few data exist on β -cell function and insulin sensitivity in patients with adult-onset autoimmune diabetes compared with type 2 diabetes and controls. (medscape.com)
  • The aim of the study was to describe recent medication patterns and changes in medication patterns and glycemic control in adolescents and young adults with incident type 2 diabetes (T2D). (cdc.gov)
  • This guideline covers care and management for adults (aged 18 and over) with type 2 diabetes. (bvsalud.org)
  • The previous treatment guide for type 2 diabetes was prepared by the Estonian Society of Endocrinology led in 2016 and discussed type 2 diabetes screening, diagnosis and pharmacological treatment (1). (bvsalud.org)
  • Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. (tocris.com)
  • GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. (wikipedia.org)
  • 0.05), and similar to controls (29.4±6.6 kg/m 2 ). (medscape.com)
  • 30 kg/m2 at screening with established CVD or chronic kidney disease (CKD), and/or at least 2 weight-related complications or risk factors for CVD. (who.int)
  • Prearranged positive allosteric modulators (PAMs) inspired by photopharmacology are synthesized and applied to the glucagon-like peptide-1 receptor (GLP-1R), a class B G protein-coupled receptor. (wiley.com)
  • The most effective d-GLP-2 analogue boosted the AKT phosphorylation 2.28 times more effectively compared to the native l-GLP-2. (bvsalud.org)
  • Mutated recombinant human glucagon-like peptide-1 protects SH-SY5Y cells from apoptosis induced by amyloid-beta peptide (1-42). (ncbcs.org)
  • Utilizing site-directed mutagenesis and gene recombination strategies, we generated a mutated recombinant human glucagon-like peptide-1 (mGLP-1) which has longer half-life as in contrast with native GLP-1. (ncbcs.org)
  • Recombinant expression, in vitro refolding, and biophysical characterization of the human glucagon -like peptide-1 receptor. (ncbcs.org)
  • Fig. 4: Human islet-derived glucagon corrects GKO-NSG α-cell hyperplasia. (nature.com)
  • Age-dependent human β cell proliferation induced by glucagon-like peptide 1 and calcineurin signaling. (nature.com)
  • If you know of a relevant reference for Glucagon-like peptide 1 (1-37) (human, rat), please let us know . (tocris.com)
  • Do you know of a great paper that uses Glucagon-like peptide 1 (1-37) (human, rat) from Tocris? (tocris.com)
  • Be the first to review Glucagon-like peptide 1 (1-37) (human, rat) and earn rewards! (tocris.com)
  • Have you used Glucagon-like peptide 1 (1-37) (human, rat)? (tocris.com)