Heat- and storage-labile plasma glycoprotein which accelerates the conversion of prothrombin to thrombin in blood coagulation. Factor V accomplishes this by forming a complex with factor Xa, phospholipid, and calcium (prothrombinase complex). Deficiency of factor V leads to Owren's disease.
A deficiency of blood coagulation factor V (known as proaccelerin or accelerator globulin or labile factor) leading to a rare hemorrhagic tendency known as Owren's disease or parahemophilia. It varies greatly in severity. Factor V deficiency is an autosomal recessive trait. (Dorland, 27th ed)
A hemostatic disorder characterized by a poor anticoagulant response to activated protein C (APC). The activated form of Factor V (Factor Va) is more slowly degraded by activated protein C. Factor V Leiden mutation (R506Q) is the most common cause of APC resistance.
A plasma protein that is the inactive precursor of thrombin. It is converted to thrombin by a prothrombin activator complex consisting of factor Xa, factor V, phospholipid, and calcium ions. Deficiency of prothrombin leads to hypoprothrombinemia.
Activated form of factor V. It is an essential cofactor for the activation of prothrombin catalyzed by factor Xa.
A disorder of HEMOSTASIS in which there is a tendency for the occurrence of THROMBOSIS.
A vitamin-K dependent zymogen present in the blood, which, upon activation by thrombin and thrombomodulin exerts anticoagulant properties by inactivating factors Va and VIIIa at the rate-limiting steps of thrombin formation.
An enzyme formed from PROTHROMBIN that converts FIBRINOGEN to FIBRIN.
Blood-coagulation factor VIII. Antihemophilic factor that is part of the factor VIII/von Willebrand factor complex. Factor VIII is produced in the liver and acts in the intrinsic pathway of blood coagulation. It serves as a cofactor in factor X activation and this action is markedly enhanced by small amounts of thrombin.
The process of the interaction of BLOOD COAGULATION FACTORS that results in an insoluble FIBRIN clot.
Activated form of factor X that participates in both the intrinsic and extrinsic pathways of blood coagulation. It catalyzes the conversion of prothrombin to thrombin in conjunction with other cofactors.
Spontaneous or near spontaneous bleeding caused by a defect in clotting mechanisms (BLOOD COAGULATION DISORDERS) or another abnormality causing a structural flaw in the blood vessels (HEMOSTATIC DISORDERS).
An autosomal dominant disorder showing decreased levels of plasma protein S antigen or activity, associated with venous thrombosis and pulmonary embolism. PROTEIN S is a vitamin K-dependent plasma protein that inhibits blood clotting by serving as a cofactor for activated PROTEIN C (also a vitamin K-dependent protein), and the clinical manifestations of its deficiency are virtually identical to those of protein C deficiency. Treatment with heparin for acute thrombotic processes is usually followed by maintenance administration of coumarin drugs for the prevention of recurrent thrombosis. (From Harrison's Principles of Internal Medicine, 12th ed, p1511; Wintrobe's Clinical Hematology, 9th ed, p1523)
Storage-stable glycoprotein blood coagulation factor that can be activated to factor Xa by both the intrinsic and extrinsic pathways. A deficiency of factor X, sometimes called Stuart-Prower factor deficiency, may lead to a systemic coagulation disorder.
Laboratory tests for evaluating the individual's clotting mechanism.
The vitamin K-dependent cofactor of activated PROTEIN C. Together with protein C, it inhibits the action of factors VIIIa and Va. A deficiency in protein S; (PROTEIN S DEFICIENCY); can lead to recurrent venous and arterial thrombosis.
A mutation caused by the substitution of one nucleotide for another. This results in the DNA molecule having a change in a single base pair.
Inflammation of a vein associated with a blood clot (THROMBUS).
The co-occurrence of pregnancy and a blood disease (HEMATOLOGIC DISEASES) which involves BLOOD CELLS or COAGULATION FACTORS. The hematologic disease may precede or follow FERTILIZATION and it may or may not have a deleterious effect on the pregnant woman or FETUS.
The time required for the appearance of FIBRIN strands following the mixing of PLASMA with phospholipid platelet substitute (e.g., crude cephalins, soybean phosphatides). It is a test of the intrinsic pathway (factors VIII, IX, XI, and XII) and the common pathway (fibrinogen, prothrombin, factors V and X) of BLOOD COAGULATION. It is used as a screening test and to monitor HEPARIN therapy.
Clotting time of PLASMA recalcified in the presence of excess TISSUE THROMBOPLASTIN. Factors measured are FIBRINOGEN; PROTHROMBIN; FACTOR V; FACTOR VII; and FACTOR X. It is used for monitoring anticoagulant therapy with COUMARINS.
Endogenous substances, usually proteins, that are involved in the blood coagulation process.
Hemorrhagic and thrombotic disorders that occur as a consequence of abnormalities in blood coagulation due to a variety of factors such as COAGULATION PROTEIN DISORDERS; BLOOD PLATELET DISORDERS; BLOOD PROTEIN DISORDERS or nutritional conditions.
Formation and development of a thrombus or blood clot in the blood vessel.
Obstruction of a blood vessel (embolism) by a blood clot (THROMBUS) in the blood stream.
Substances, usually endogenous, that act as inhibitors of blood coagulation. They may affect one or multiple enzymes throughout the process. As a group, they also inhibit enzymes involved in processes other than blood coagulation, such as those from the complement system, fibrinolytic enzyme system, blood cells, and bacteria.
An individual having different alleles at one or more loci regarding a specific character.
A flavoprotein amine oxidoreductase that catalyzes the reversible conversion of 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. This enzyme was formerly classified as EC 1.1.1.171.
Constituent composed of protein and phospholipid that is widely distributed in many tissues. It serves as a cofactor with factor VIIa to activate factor X in the extrinsic pathway of blood coagulation.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
The residual portion of BLOOD that is left after removal of BLOOD CELLS by CENTRIFUGATION without prior BLOOD COAGULATION.
Enzymes catalyzing the dehydrogenation of secondary amines, introducing a C=N double bond as the primary reaction. In some cases this is later hydrolyzed.
Non-nucleated disk-shaped cells formed in the megakaryocyte and found in the blood of all mammals. They are mainly involved in blood coagulation.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
The original member of the family of endothelial cell growth factors referred to as VASCULAR ENDOTHELIAL GROWTH FACTORS. Vascular endothelial growth factor-A was originally isolated from tumor cells and referred to as "tumor angiogenesis factor" and "vascular permeability factor". Although expressed at high levels in certain tumor-derived cells it is produced by a wide variety of cell types. In addition to stimulating vascular growth and vascular permeability it may play a role in stimulating VASODILATION via NITRIC OXIDE-dependent pathways. Alternative splicing of the mRNA for vascular endothelial growth factor A results in several isoforms of the protein being produced.
A single-chain polypeptide growth factor that plays a significant role in the process of WOUND HEALING and is a potent inducer of PHYSIOLOGIC ANGIOGENESIS. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FIBROBLAST GROWTH FACTOR 1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor (FIBROBLAST GROWTH FACTOR 1).
The body's defense mechanism against foreign organisms or substances and deviant native cells. It includes the humoral immune response and the cell-mediated response and consists of a complex of interrelated cellular, molecular, and genetic components.
A family of angiogenic proteins that are closely-related to VASCULAR ENDOTHELIAL GROWTH FACTOR A. They play an important role in the growth and differentiation of vascular as well as lymphatic endothelial cells.
Progressive restriction of the developmental potential and increasing specialization of function that leads to the formation of specialized cells, tissues, and organs.
A 6-kDa polypeptide growth factor initially discovered in mouse submaxillary glands. Human epidermal growth factor was originally isolated from urine based on its ability to inhibit gastric secretion and called urogastrone. Epidermal growth factor exerts a wide variety of biological effects including the promotion of proliferation and differentiation of mesenchymal and EPITHELIAL CELLS. It is synthesized as a transmembrane protein which can be cleaved to release a soluble active form.
A family of serine proteinase inhibitors which are similar in amino acid sequence and mechanism of inhibition, but differ in their specificity toward proteolytic enzymes. This family includes alpha 1-antitrypsin, angiotensinogen, ovalbumin, antiplasmin, alpha 1-antichymotrypsin, thyroxine-binding protein, complement 1 inactivators, antithrombin III, heparin cofactor II, plasminogen inactivators, gene Y protein, placental plasminogen activator inhibitor, and barley Z protein. Some members of the serpin family may be substrates rather than inhibitors of SERINE ENDOPEPTIDASES, and some serpins occur in plants where their function is not known.
Activated form of factor XI. In the intrinsic pathway, Factor XI is activated to XIa by factor XIIa in the presence of cofactor HMWK; (HIGH MOLECULAR WEIGHT KININOGEN). Factor XIa then activates factor IX to factor IXa in the presence of calcium.
Two pairs of small oval-shaped glands located in the front and the base of the NECK and adjacent to the two lobes of THYROID GLAND. They secrete PARATHYROID HORMONE that regulates the balance of CALCIUM; PHOSPHORUS; and MAGNESIUM in the body.
A polypeptide hormone (84 amino acid residues) secreted by the PARATHYROID GLANDS which performs the essential role of maintaining intracellular CALCIUM levels in the body. Parathyroid hormone increases intracellular calcium by promoting the release of CALCIUM from BONE, increases the intestinal absorption of calcium, increases the renal tubular reabsorption of calcium, and increases the renal excretion of phosphates.
Tumors or cancer of the PARATHYROID GLANDS.
Steroids with a hydroxyl group at C-3 and most of the skeleton of cholestane. Additional carbon atoms may be present in the side chain. (IUPAC Steroid Nomenclature, 1987)
Pathological processes of the PARATHYROID GLANDS. They usually manifest as hypersecretion or hyposecretion of PARATHYROID HORMONE that regulates the balance of CALCIUM; PHOSPHORUS; and MAGNESIUM in the body.
A condition of abnormally elevated output of PARATHYROID HORMONE (or PTH) triggering responses that increase blood CALCIUM. It is characterized by HYPERCALCEMIA and BONE RESORPTION, eventually leading to bone diseases. PRIMARY HYPERPARATHYROIDISM is caused by parathyroid HYPERPLASIA or PARATHYROID NEOPLASMS. SECONDARY HYPERPARATHYROIDISM is increased PTH secretion in response to HYPOCALCEMIA, usually caused by chronic KIDNEY DISEASES.
An eleven-amino acid neurotransmitter that appears in both the central and peripheral nervous systems. It is involved in transmission of PAIN, causes rapid contractions of the gastrointestinal smooth muscle, and modulates inflammatory and immune responses.
The study, based on direct observation, use of statistical records, interviews, or experimental methods, of actual practices or the actual impact of practices or policies.
Decisions, usually developed by government policymakers, for determining present and future objectives pertaining to the health care system.
The physical or physiological processes by which substances, tissue, cells, etc. take up or take in other substances or energy.
A philosophically coherent set of propositions (for example, utilitarianism) which attempts to provide general norms for the guidance and evaluation of moral conduct. (from Beauchamp and Childress, Principles of Biomedical Ethics, 4th ed)
Uptake of substances through the lining of the INTESTINES.
The functional units of the kidney, consisting of the glomerulus and the attached tubule.

Evidence suggesting the regulation of a coagulation factor levels in rabbits by a transferable plasma agent. (1/888)

New Zealand white rabbits were given 30 ml of goat serum intravenously. This procedure resulted in an immediate decrease in platelet count, fibrinogen, and levels of coagulation factors II, V, VII, and X, due to consumption coagulopathy. These factors returned toward baseline levels approximately 12 hr after the injection. Plasma from rabbits who had received goat serum 48 hr previously (donor rabbits) was injected into recipient rabbits. This procedure resulted in a slight rise in the level of coagulation factor II (range, 20%-30%) and a significant rise in factors V (35%-75%), VII (35%-235%), and X (35%-75%) in the recipients. When plasma from control donor rabbits who had not received goat serum was injected into recipients, there was no change in these coagulation factors. It is postulated that the reduction in coagulation factor levels in donor rabbits induces a "coagulopoietin" for each factor or one "coagulopoietin" for all factors which stimulates increased synthesis and/or release of these factors in recipient rabbits.  (+info)

Prospective evaluation of the thrombotic risk in children with acute lymphoblastic leukemia carrying the MTHFR TT 677 genotype, the prothrombin G20210A variant, and further prothrombotic risk factors. (2/888)

The reported incidence of thromboembolism in children with acute lymphoblastic leukemia (ALL) treated with L-asparaginase, vincristine, and prednisone varies from 2.4% to 11.5%. The present study was designed to prospectively evaluate the role of the TT677 methylenetetrahydrofolate reductase (MTHFR) genotype, the prothrombin G20210A mutation, the factor V G1691A mutation, deficiencies of protein C, protein S, antithrombin, and increased lipoprotein (a) concentrations in leukemic children treated according to the ALL-Berlin-Frankfurt-Muenster (BFM) 90/95 study protocols with respect to the onset of vascular events. Three hundred and one consecutive leukemic children were enrolled in this study. Fifty-five of these 301 subjects investigated had one established single prothrombotic risk factor: 20 children showed the TT677 MTHFR genotype; 5 showed the heterozygous prothrombin G20210A variant; 11 were carriers of the factor V G1691A mutation (heterozygous, n = 10; homozygous, n = 1); 4 showed familial protein C, 4 protein S, and 2 antithrombin type I deficiency; 9 patients were suffering from familially increased lipoprotein (a) [Lp(a)] concentrations (>30 mg/dL). In addition, combined prothrombotic defects were found in a further 10 patients: the FV mutation was combined with the prothrombin G20210A variant (n = 1), increased Lp(a) (n = 3), protein C deficiency (n = 1), and homozygosity for the C677T MTHFR gene mutation (n = 1). Lp(a) was combined with protein C deficiency (n = 2) and the MTHFR TT 677 genotype (n = 2). Two hundred eighty-nine of the 301 patients were available for thrombosis-free survival analysis. In 32 (11%) of these 289 patients venous thromboembolism occurred. The overall thrombosis-free survival in patients with at least one prothrombotic defect was significantly reduced compared with patients without a prothrombotic defect within the hemostatic system (P <.0001). In addition, a clear-cut positive correlation (P <.0001) was found between thrombosis and the use of central lines. However, because the prothrombotic defects diagnosed in the total childhood population studied were all found within the prevalences reported for healthy Caucasian individuals, the interaction between prothrombotic risk factors, ALL treatment, and further environmental factors is likely to cause thrombotic manifestations.  (+info)

G20210A mutation in prothrombin gene and risk of myocardial infarction, stroke, and venous thrombosis in a large cohort of US men. (3/888)

BACKGROUND: A single base pair mutation in the prothrombin gene has recently been identified that is associated with increased prothrombin levels. Whether this mutation increases the risks of arterial and venous thrombosis among healthy individuals is controversial. METHODS AND RESULTS: In a prospective cohort of 14 916 men, we determined the prevalence of the G20210A prothrombin gene variant in 833 men who subsequently developed myocardial infarction, stroke, or venous thrombosis (cases) and in 1774 age- and smoking status-matched men who remained free of thrombosis during a 10-year follow-up (control subjects). Gene sequencing was used to confirm mutation status in a subgroup of participants. Overall, carrier rates for the G20210A mutation were similar among case and control subjects; the relative risk of developing any thrombotic event in association with the 20210A allele was 1.05 (95% CI, 0.7 to 1.6; P=0.8). We observed no evidence of association between mutation and myocardial infarction (RR=0.8, P=0.4) or stroke (RR=1.1, P=0.8). For venous thrombosis, a modest nonsignificant increase in risk was observed (RR=1.7, P=0.08) that was smaller in magnitude than that associated with factor V Leiden (RR=3.0, P<0. 001). Nine individuals carried both the prothrombin mutation and factor V Leiden (5 controls and 4 cases). One individual, a control subject, was homozygous for the prothrombin mutation. CONCLUSIONS: In a large cohort of US men, the G20210A prothrombin gene variant was not associated with increased risk of myocardial infarction or stroke. For venous thrombosis, risk estimates associated with the G20210A mutation were smaller in magnitude than risk estimates associated with factor V Leiden.  (+info)

Single and combined prothrombotic factors in patients with idiopathic venous thromboembolism: prevalence and risk assessment. (4/888)

The inherited thrombophilias--deficiencies of protein C, protein S, and antithrombin III--and the prothrombotic polymorphisms factor V G1691A and factor II G20210A predispose patients toward venous thromboembolism (VTE). The aim of this study was to determine the prevalence of single and combined prothrombotic factors in patients with idiopathic VTE and to estimate the associated risks. The study group consisted of 162 patients referred for work-up of thrombophilia after documented VTE. The controls were 336 consecutively admitted patients. In all subjects factor V G1691A, factor II G20210A, and methylenetetrahydrofolate reductase (MTHFR) C677T were analyzed by specific polymerase chain reactions and restriction enzymes. Activities of antithrombin III and protein C, free protein S antigen, and lupus anticoagulant were determined in a subset of 109 patients who were not receiving oral anticoagulants. The prevalences of heterozygotes and homozygotes for factor V G1691A and factor II G20210A among patients and controls were 40.1% versus 3.9% and 18.5% versus 5.4%, respectively (P=0.0001). The prevalence of homozygotes for MTHFR C677T in patients was 22.8% and in controls, 14.3% (P=0.025). Heterozygous and homozygous factor V G1691A, factor II G20210A, and homozygous MTHFR C677T were found to be independent risk factors for VTE, with odds ratios of 16.3, 3.6, and 2.1, respectively. Two or more polymorphisms were detected in 27 of 162 patients (16.7%) and in 3 of 336 controls (0.9%). Logistic regression analysis disclosed odds ratios of 58.6 (confidence interval [CI], 22.1 to 155.2) for joint occurrence of factor V and factor II polymorphisms, of 35.0 (CI, 14.5 to 84.7) for factor V and MTHFR polymorphisms, and of 7.7 (CI, 3.0 to 19.6) for factor II and MTHFR polymorphisms. Among 109 patients in whom a complete thrombophilic work-up was performed, 74% had at least 1 underlying defect. These data indicate that in most patients referred for evaluation of thrombophilia due to idiopathic VTE, 1 or more underlying genetic predispositions were discernible. The presence of >1 of the prothrombotic polymorphisms was associated with a substantial risk of VTE.  (+info)

Interaction between the G20210A mutation of the prothrombin gene and oral contraceptive use in deep vein thrombosis. (5/888)

Single-point mutations in the gene coding for prothrombin (factor II:A20210) or factor V (factor V:A1691) are associated with an increased risk of venous thromboembolism. The use of oral contraceptives is also a strong and independent risk factor for the disease, and the interaction between factor V:A1691 and oral contraceptives greatly increases the risk. No information is available about the interaction between oral contraceptives and mutant prothrombin. We investigated 148 women with a first, objectively confirmed episode of deep vein thrombosis and 277 healthy women as controls. Fourteen patients (9.4%) were carriers of factor II:A20210, 24 (16.2%) of factor V:A1691, and 4 (2.7%) of both defects. Among controls, the prevalence was 2.5% for either factor II:A20210 or factor V:A1691, and there was no carrier of both the mutations. The relative risk of thrombosis was 6-fold for factor II:A20210 and 9-fold for factor V:A1691. The most prevalent circumstantial risk factor in patients and the only one observed in controls was oral contraceptive use, which per se conferred a 6-fold increased risk of thrombosis. The risk increased to 16.3 and 20.0 when women with factor II:A20210 or factor V:A1691 who used oral contraceptives were compared with noncarriers and nonusers. These figures indicate a multiplicative interaction between the genetic risk factors and oral contraceptives. No difference in the type of oral contraceptives was observed between patients and controls, those of third generation being the most frequently used (73% and 80%). We conclude that carriers of the prothrombin mutation who use oral contraceptives have a markedly increased risk of deep vein thrombosis, much higher than the risk conferred by either factor alone.  (+info)

Synergistic effects of prothrombotic polymorphisms and atherogenic factors on the risk of myocardial infarction in young males. (6/888)

Several recent studies evaluated a possible effect of the prothrombotic polymorphisms such as 5,10 methylenetetrahydrofolate reductase (MTHFR) nt 677C --> T, factor V (F V) nt 1691G --> A (F V Leiden), and factor II (F II) nt 20210 G --> A on the risk of myocardial infarction. In the present study, we analyzed the effect of these prothrombotic polymorphisms, as well as apolipoprotein (Apo) E4, smoking, hypertension, diabetes mellitus, and hypercholesterolemia, on the risk of myocardial infarction in young males. We conducted a case-control study of 112 young males with first acute myocardial infarction (AMI) before the age of 52 and 187 healthy controls of similar age. The prevalences of heterozygotes for F V G1691A and F II G20210A were not significantly different between cases and controls (6.3% v 6.4% and 5.9% v 3.4% among cases and controls, respectively). In contrast, the prevalence of MTHFR 677T homozygosity and the allele frequency of Apo E4 were significantly higher among patients (24.1% v 10.7% and 9.4% v 5.3% among cases and controls, respectively). Concomitant presence of hypertension, hypercholesterolemia, or diabetes and one or more of the four examined polymorphisms increased the risk by almost ninefold (odds ratio [OR] = 8.66; 95% confidence interval [CI], 3.49 to 21.5) and concomitant smoking by almost 18-fold (OR = 17.6; 95% CI, 6.30 to 48.9). When all atherogenic risk factors were analyzed simultaneously by a logistic model, the combination of prothrombotic and Apo E4 polymorphisms with current smoking increased the risk 25-fold (OR = 24.7; 95% CI, 7.17 to 84.9). The presented data suggest a synergistic effect between atherogenic and thrombogenic risk factors in the pathogenesis of AMI, as was recently found in a similar cohort of women.  (+info)

Thrombophilia as a multigenic disease. (7/888)

BACKGROUND AND OBJECTIVE: Venous thrombosis is a common disease annually affecting 1 in 1000 individuals. The multifactorial nature of the disease is illustrated by the frequent identification of one or more predisposing genetic and/or environmental risk factors in thrombosis patients. Most of the genetic defects known today affect the function of the natural anticoagulant pathways and in particular the protein C system. This presentation focuses on the importance of the genetic factors in the pathogenesis of inherited thrombophilia with particular emphasis on those defects which affect the protein C system. INFORMATION SOURCES: Published results in articles covered by the Medline database have been integrated with our original studies in the field of thrombophilia. STATE OF THE ART AND PERSPECTIVES: The risk of venous thrombosis is increased when the hemostatic balance between pro- and anti-coagulant forces is shifted in favor of coagulation. When this is caused by an inherited defect, the resulting hypercoagulable state is a lifelong risk factor for thrombosis. Resistance to activated protein C (APC resistance) is the most common inherited hypercoagulable state found to be associated with venous thrombosis. It is caused by a single point mutation in the factor V (FV) gene, which predicts the substitution of Arg506 with a Gln. Arg506 is one of three APC-cleavage sites and the mutation results in the loss of this APC-cleavage site. The mutation is only found in Caucasians but the prevalence of the mutant FV allele (FV:Q506) varies between countries. It is found to be highly prevalent (up to 15%) in Scandinavian populations, in areas with high incidence of thrombosis. FV:Q506 is associated with a 5-10-fold increased risk of thrombosis and is found in 20-60% of Caucasian patients with thrombosis. The second most common inherited risk factor for thrombosis is a point mutation (G20210A) in the 3' untranslated region of the prothrombin gene. This mutation is present in approximately 2% of healthy individuals and in 6-7% of thrombosis patients, suggesting it to be a mild risk factor of thrombosis. Other less common genetic risk factors for thrombosis are the deficiencies of natural anticoagulant proteins such as antithrombin, protein C or protein S. Such defects are present in less than 1% of healthy individuals and together they account for 5-10% of genetic defects found in patients with venous thrombosis. Owing to the high prevalence of inherited APC resistance (FV:Q506) and of the G20210A mutation in the prothrombin gene, combinations of genetic defects are relatively common in the general population. As each genetic defect is an independent risk factor for thrombosis, individuals with multiple defects have a highly increased risk of thrombosis. As a consequence, multiple defects are often found in patients with thrombosis.  (+info)

Factor V Leiden and antibodies against phospholipids and protein S in a young woman with recurrent thromboses and abortion. (8/888)

We describe the case of a 39-year-old woman who suffered two iliofemoral venous thromboses, a cerebral ischemic infarct and recurrent fetal loss. Initial studies showed high levels of antiphospholipid antibodies (APAs) and a moderate thrombocytopenia. After her second miscarriage, laboratory diagnosis revealed that the woman was heterozygous for the factor V Leiden mutation and had a functional protein S deficiency as well as anti-protein S and anti-beta 2-glycoprotein I antibodies. The impairment of the protein C pathway at various points could well explain the recurrent thromboses in the patient and supports the role of a disturbed protein C system in the pathophysiology of thrombosis in patients with APAs.  (+info)

Rare individuals have mutations of their factor V gene that alter cleavage of factor V by activated protein C but are different than the factor V Leiden mutation (e.g. factor V Hong Kong and factor V Cambridge). Most factor V Leiden genetic assays will not detect these mutations, but they are rare and their association with thrombotic risk is less well established than factor V Leiden.. The majority of plasma factor V is made in the liver. Most genetic tests for factor V Leiden evaluate DNA purified from white blood cells. Patients with bone marrow or liver transplants may show discrepancies between the factor V gene evaluated in white cell DNA and the factor V in plasma being produced by the liver. In bone marrow or liver transplant patients, the activated protein C resistance assay can be used to assess the factor V produced by the liver.. Some activated protein C resistance assays may suffer interference from lupus inhibitors, factor V deficiency, heparin or low molecular weight heparin, and ...
Describes how Factor V Leiden mutation and PT 20210 mutation tests are used, when Factor V Leiden mutation and PT 20210 mutation tests are ordered, and what the results of Factor V Leiden mutation and PT 20210 mutation tests might mean
Describes how Factor V Leiden mutation and PT 20210 mutation tests are used, when Factor V Leiden mutation and PT 20210 mutation tests are ordered, and what the results of Factor V Leiden mutation and PT 20210 mutation tests might mean
A 27-year-old man was admitted to our hospital with the complaints of swelling of his face and lower limbs. Echocardiography showed minimal pericardial effusion accompanied by disordered diastolic function. Cardiac catheterization was performed to rule out constrictive pericarditis. Normal pressure tracings of the right heart rule out constrictive pericarditis, however, a. narrowing of the inferior vena cava was observed. Venographies of the inferior and superior vena cavae showed extensive thrombotic involvement of these great veins. Protein C, protein S, anticardiolipin antibodies, fibrinogen, antithrombin-III, activated protein C resistance, and factor V levels were in normal limits. Heterozygosity for factor V Leiden mutation was detected. We conclude that factor V Leiden mutation can cause extensive thrombotic involvement of major veins and should be considered in idiopathic thrombosis of them. ...
Factor V Leiden is a common inherited genetic disorder in which your blood has an increased tendency to form clots (thrombophilia), usually in your veins.. Although blood clots can form at any age, for most people the increased risk of clotting doesnt begin until adulthood. Most people with factor V Leiden never develop abnormal clots. However, some people with factor V Leiden develop clots that lead to long-term health problems or are life-threatening.. Both men and women can have factor V Leiden, but women may have an increased tendency to develop blood clots during pregnancy or when taking the hormone estrogen.. If you have factor V Leiden, medications can lessen your risk of developing blood clots and help you avoid potentially serious complications.. Its possible to have factor V Leiden without ever developing signs or symptoms. However, the first indication that you have the disorder may be the development of a blood clot (thrombosis).. Some clots do no damage and disappear on their own. ...
Factor V Leiden is an inherited blood condition from the factor V Leiden mutation. Discover Childrens Minnesota treatments for factor V Leiden in children.
Description of disease Factor V Leiden. Treatment Factor V Leiden. Symptoms and causes Factor V Leiden Prophylaxis Factor V Leiden
Background. If a thrombophilia (clotting disorder) has been identified in a patient with blood clots (venous thromboembolism = VTE), the question arises whether other family members should be tested for the same thrombophilia.. My Clinical Approach. My approach in clinical practice to thrombophilia testing in family members is summarized in table 1: Family Member Testing. If the patient has a strong inherited thrombophilia (i.e. homozygous factor V Leiden, homozygous prothrombin 20210 mutation, double heterozygous factor V Leiden plus prothrombin 20210 mutation, deficiency of protein C, S or antithrombin) then I consider and discuss testing of other family members. However, if the patient only has heterozygous factor V Leiden or heterozygous prothrombin 20210 mutation, I do not recommend testing of family members, as the finding of one of these mild thrombophilias typically has no impact on management of family members also affected by one of those mild thrombophilias.. Finding of a ...
Factor V Leiden (rs6025) is a variant (mutated form) of human factor V (one of several substances that helps blood clot), which causes an increase in blood clotting (hypercoagulability). With this mutation, the anticoagulant protein secreted (which normally inhibits the pro-clotting activity of factor V) is not able to bind normally to Factor V, leading to a hypercoagulable state, i.e., an increased tendency for the patient to form abnormal and potentially harmful blood clots. Factor V Leiden is the most common hereditary hypercoagulability (prone to clotting) disorder amongst ethnic Europeans. It is named after the Dutch city Leiden, where it was first identified in 1994 by Prof R. Bertina et al. Abnormal, recurrent venous thromboses. In the normal person, factor V functions as a cofactor to allow factor Xa to activate prothrombin, resulting in the enzyme thrombin. Thrombin in turn cleaves fibrinogen to form fibrin, which polymerizes to form the dense meshwork that makes up the majority of a ...
Six cases of congenital thrombophilia (15%) were found: 1 PC deficiency (patient 25), 1 PS deficiency (patient 34), and 4 heterozygous factor V Leiden (patients 21, 22, 28, and 30). Three patients had increased aCL antibodies, 1 with systemic lupus (patient 21) and 2 with a primary aPL syndrome (patients 8 and 22); 2 of these had also factor V Leiden mutation. There was no antithrombin or plasminogen deficiency. Cases with thrombophilia and/or aCL antibodies are briefly summarized. Treatment and outcome are not detailed because all patients received heparin followed by oral anticoagulants and made an uneventful recovery.. Patient 25 was 34 years old in 1986 when she complained of headache, seizures, and left-sided sensory symptoms in a context of uveomeningitis. No other signs of Behçets disease11 or sarcoidosis were present. Angiography and MRI showed right LS thrombosis. The patient has been well since then. While receiving oral anticoagulants, PC activity was 24%, antigen was 33%, and ...
What is factor V Leiden? The most common genetic risk factor for venous thrombosis is factor V Leiden, present in 5 percent of the general population. Factor V is one of the normal blood clotting factors. Factor V Leiden is a changed or mutated form of factor V that is inactivated 10 times slower than the normal factor V. This causes it to persist longer in the circulation, resulting in a hypercoagulable state. In other words, the blood continues clotting, resulting in possible obstruction.. One copy of the factor V Leiden gene increases the risk for venous thrombosis 4 to 8 times, while two copies of the gene increase the risk 80-fold.. Other coexisting coagulation defects can occur with factor V Leiden, and in general, the risk for thrombosis increases in patients with more than one genetic defect.. The factor V Leiden mutation is involved in 20 to 40 percent of venous thrombosis cases and is suspected in individuals who have a medical history of venous thrombosis or in families with a high ...
The relation between factor V mutation and risk for venous thromboembolism was confirmed in a prospective study of 14 916 men with no history of cardiovascular disease or cancer followed for a mean of 8.6 years. 11.6% of men with venous thromboembolism had the mutation compared with 6.0% of those with no thromboembolism (relative risk [RR] 2.7, 95% CI 1.3 to 5.6, P = 0.008). Risks were higher for patients with idiopathic events (RR 3.5, CI 1.5 to 8.4, P = 0.004) and for men , 60 years of age (adjusted RR 4.0, CI 1.6 to 9.7, P = 0.003). A prospective study showed that men with both factor V mutation and moderate hyperhomocystinemia had an increased risk for any form of venous thromboembolism (RR 9.7, P = 0.009) and for idiopathic venous thromboembolism (RR 21.8, P , 0.001) compared with men who had neither abnormality. In a case-control study comparing 155 premenopausal women who had deep venous thrombosis unrelated to a malignant condition with 169 women who had no history of thrombosis, the ...
Background: Activated Protein C Resistance (APCR), a poor anticoagulant response of APC in haemostasis, is the commonest heritable thrombophilia. Adverse outcomes during pregnancy have been linked to APCR. This study determined the frequency of APCR, factor V gene known and novel SNPs and adverse outcomes in a group of pregnant women. Methods:Blood samples collected from 907 pregnant women were tested using the Coatest® Classic and Modified functional haematological tests to establish the frequency of APCR. PCR-Restriction Enzyme Analysis (PCR-REA), PCR-DNA probe hybridisation analysis and DNA sequencing were used for molecular screening of known mutations in the factor V gene in subjects determined to have APCR based on the Coatest® Classic and/or Modified functional haematological tests. Glycosylase Mediated Polymorphism Detection (GMPD), a SNP screening technique and DNA sequencing, were used to identify SNPs in the factor V gene of 5 APCR subjects. Results:Sixteen percent of the study ...
Product Mouse Coagulation Factor V (F5) ELISA Kit From DL Develop - A sandwich quantitative ELISA assay kit for detection of Mouse Coagulation Factor V (F5) in samples from plasma. Should the Mouse Coagulation Factor V (F5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
A young woman 38 years of age underwent Doppler ultrasonography following the spontaneous appearance of cervical pain causing loss of sleep. The examination revealed bilateral dissection of the internal carotid arteries, confirmed by supraaortic arteriography. Two successive CT scans showed no cerebral lesions. A thrombosis of the great saphenous vein was recorded as the only vascular event in her medical history. Thrombophilia was assessed following discovery of the dissection, and upon examination a heterozygotic mutation of Factor V Leiden was revealed. This observation is the second case of carotid dissection occurring in a subject presenting a factor V mutation. At the present time, however, there are no results to justify the assumption of a direct link between these two pathologies.
Factor V Leiden. If the fetus inherits the gene from a Factor V Leiden paternal carrier , the pregnancy is six times more likely to be affected by clotting which can cause miscarriages and other serious placental malfunctions. It is therefore likely that some or all of the miscarriages were caused by your husbands gene mutation. Get early placental gene testing with your next pregnancy to predict occurrence ...
The mutation G1691A (R506Q) in the human factor V gene is associated with the resistance to activated protein C (APC) that represents a major risk of development of venous thrombosis. A population...
Browsing by Subject KAYATAS K., CEBECI F., Karatoprak C., BENZER M., DEMIRTUNÇ R., DEMIRKESEN C., -Factor V Leiden mutation-related chronic skin ulcers.-, The international journal of lower extremity wounds, cilt.12, ss.35-8, 2013 ...
Order Coagulation Factor V ELISA Kits for many Reactivities. Chicken, Cow, Dog and more. Compare Coagulation Factor V ELISA Kits and find the right product on antibodies-online.com.
Activated protein C (aPC), in a complex with protein S, inactivates procoagulant factors Va and VIIIa by proteolytic cleavage at specific arginine residues.7,10,11 This serves to control coagulation and limit the extent of thrombus formation. The functionality of the aPC inhibitory system in a given individual can be assessed through an in vitro clotting assay. Addition of aPC to a patients plasma serves to extend the activated partial thromboplastin time (aPTT) for individuals who are sensitive to aPC. Individuals are considered to be aPC resistant when addition of aPC fails to extend the time to clot formation in this assay. More than 95% of cases of aPC resistance are caused by a specific polymorphism in the factor V gene that is referred to as factor V Leiden.8 This single point mutation results in a substitution of glutamine for arginine at amino acid number 506 of factor V. Arginine number 506 is an aPC cleavage site of normal factor V, making factor V Leiden resistant to inactivation by ...
English-language studies were identified using MEDLINE (1993 to April 1997) with the search terms factor V, mutation, protein C, resistance, thromboembolism, prevalence, diagnosis, screening, therapy, and prevention. Bibliographies of relevant papers were also reviewed ...
Individuals who carry the Factor V Leiden mutation have a 3- to 8-fold increased risk as heterozygotes and a greater than 10-fold increased risk as homozygotes. Individuals who carry the F2 prothrombin mutation have a 2- to 5-fold increased risk as heterozygotes and up to a 10-fold increased risk as homozygotes. Individuals who carry two copies of the 677C,T mutation, or one 677C,T and one 1298A,C mutation, in the MTHFR gene have between a 2- and 8-fold increased risk. Compound heterozygotes (heterozygous for more than one of the mutations tested for) have an even higher risk of thrombophilia. For example, a person that is heterozygous for both the Factor V Leiden mutation and heterozygous for the F2 prothrombin mutation has a greater than 20-fold increased risk ...
Factor V Leiden is an autosomal dominant condition which exhibits incomplete dominance and results in a Factor V variant which cannot be as easily degraded by aPC. The gene that codes the protein is referred to as F5. Mutation of this gene-a single nucleotide polymorphism (SNP) is located in exon 10.[6] As a missense substitution it changes a proteins amino acid from arginine to glutamine. Depending on the chosen start the position of the nucleotide variant is either at position 1691 or 1746.[7] It also affects the amino acid position for the variant which is either 506 or 534. Together with the general lack of nomenclature standard it means that the SNP can be referred to in several ways such as G1691A, c.1601G,A, 1691G,A, c.1746G,A, p.Arg534Gln, Arg506Gln, R506Q or rs6025! Since this amino acid is normally the cleavage site for aPC, the mutation prevents efficient inactivation of factor V. When factor V remains active, it facilitates overproduction of thrombin leading to excess fibrin ...
Genetic and environmental factors interact in determining the risk of venous thromboembolism (VTE). The risk associated with the polymorphic variants G1691A of factor V (Factor V Leiden, FVL), G20210A of prothrombin (PT20210A) and C677T of methylentetrahydrofolate reductase (C677T MTHFR) genes has been investigated in many studies. We performed a pooled analysis of case-control and cohort studies investigating in adults the association between each variant and VTE, published on Pubmed, Embase or Google through January 2010. Authors of eligible papers, were invited to provide all available individual data for the pooling. The Odds Ratio (OR) for first VTE associated with each variant, individually and combined with the others, were calculated with a random effect model, in heterozygotes and homozygotes (dominant model for FVL and PT20210A; recessive for C677T MTHFR). We analysed 31 databases, including 11,239 cases and 21,521 controls. No significant association with VTE was found for homozygous ...
Factor V antibody [5108] (coagulation factor V (proaccelerin, labile factor)) for RIA, WB. Anti-Factor V mAb (GTX79798) is tested in Human samples. 100% Ab-Assurance.
Physician assistants and nurse practitioners use Clinical Advisor for updated medical guidance to diagnose and treat common medical conditions in daily practice.
Factor V Leiden, also known as Activated Protein C Resistance, is a hereditary blood disorder that causes hypercoagulability and an increased risk of thrombosis.
Gentaur molecular products has all kinds of products like :search , Nordic Immunological Lab \ rabbit serum against human Factor V \ RAHu/FV for more molecular products just contact us
Thrombotic Risk, Inherited Etiologies (Most Common) with Reflex to Factor V Leiden,ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories client,medicine,medical supply,medical supplies,medical product
Background: The rate of progression to cirrhosis varies among individuals chronically infected with the hepatitis C virus (HCV). Coagulation pathway activation in models of hepatic fibrosis suggests variation in coagulation pathway components may influence the rate of fibrosis. We hypothesised that polymorphisms of the coagulation factors II and V affect the rate of progression to cirrhosis in HCV infected subjects. Methods: We studied the relationship between rate of fibrosis (calculated by dividing the fibrosis stage by duration of infection) and genotypes of specific coagulation pathway genes in 352 White European patients infected with HCV. Genotyping was performed using reverse line blot hybridisation. Results: The rate of fibrosis was significantly higher in patients with the factor V Leiden genotype (Arg560Gln) (ANOVA, p=0.004). In disease association studies, o significant association was seen (Fishers exact test, p=0.029; odds ratio 3.28 for fast progression to cirrhosis (expected to reach
Factor V Leiden is not a disease, but a genetic mutation that results in thrombophilia, a blood clotting condition that increases a persons risk of developing abnormal blood clots in their blood vessels.
Factor V Leiden is not a disease, it is the presence of a particular gene that is passed on from your parents. We look how you can avoid blood clots.
Care should also be exercised in patients with Factor V (five) Leiden. This is a variation in a gene that affects the clotting process, increasing coagulation. Factor V Leiden is the most common inherited blood disorder in the United States. It is present in 4 to 6 percent of Caucasians; 2 percent of Hispanic Americans; a little over 1 percent of African Americans and Native Americans and about 0.5 of one percent of Asian Americans. Treatment is typically unwarranted unless there is evidence of a blood clot, in which case warfarin or other anticoagulants are prescribed. Depending on the situation, anticoagulants may be recommended to help afford advance protection against the development of blood clots. For example, women with a Factor V Leiden mutation may be advised to take anticoagulants during pregnancy and in the postpartum period.. ...
This study describes a novel microplate assay that measures FV coagulation activity during fibrin clot formation in human plasma which...
Uncovering common genetic risk factors for Parkinsons disease Introduction. Mutations in the so called PARK genes lead to rare familial forms of Parkinsons disease (PD). However the extent to which common genetic variability around these genes alters risk for common PD remains unclear. The Australian Parkinsons Project is analysing genetic variability around the PARK loci in a large PD case-control sample recruited from three Australian states. The emphasis is on gene-gene and gene-environment interactions between commonly occurring variables. Aim. To report on a pilot PD association analysis of 87 polymorphisms around13 PARK genes in an initial case-control sample recruited during 2006. Methods. PD cases (n=326) and unaffected control subjects (n=298) of white European ancestry were recruited from three specialist clinics in Brisbane and the Australian Electoral Roll. Common genetic variables (86 SNPs genotyped on the TaqMan platform and 1 STR variable genotyped using standard methods) were ...
Heat- and storage-labile plasma glycoprotein which accelerates the conversion of prothrombin to thrombin in blood coagulation. Factor V accomplishes this by forming a complex with factor Xa, phospholipid, and calcium (prothrombinase complex). Deficiency of factor V leads to Owrens disease ...
A test for Factor V Leiden was positive for 1 copy of the Factor V Leiden mutation. The test results were returned to Dr Hs office, where they were reviewed and incorrectly interpreted as being all normal.
Technoclone Factor V Deficient Plasma is a lyophilized, stable, immunodepleted, human plasma with a coagulation activity | 1% of factor V.
Determination of the predisposing genetic factors for thrombosis - factor V Leiden mutation, the prothrombin mutation, and mutations of the MTHFR gene
An APTT-based kit for the screening of factor-V-related APC resistance. The high sensitivity and specificity of the test for the factor V:Q506 mutation is obtained by prediluting the sample plasma with an excess of V-DEF Plasma bioreagent. The test design makes it possible to discriminate between heterozygous and homozygous factor V genotypes. It also allows for analysis of plasma from patients on heparin or oral anticoagulant therapy. High discrimination between genotypes with 100% sensitivity for FV:Q506. Reduces need for PCR determination. Applicable to anticoagulant treated patients.. ...
The Role of APC-Resistance for Predicting Venous Thrombosis and Pregnancy Complications in Carriers of Factor V Leiden (1691) G/A Mutation. By Andrey Pavlovich Momot, Maria Gennadevna Nikolaeva, Valeriy Anatolevich Elykomov and Ksenia Andreevna Momot. This chapter presents the results of the prospective cohort study of 500 females with factor V Leiden, FVL, 1691 GA genotype, during 2008-2015. The association between FVL (regardless of its laboratory phenotype-factor Va resistance to activated protein C, APC resistance) and the development of VTEC (both outside of and during pregnancy) and gestational complications such as preeclampsia, fetal growth restriction, and miscarriage has been established. Additionally, the leading role of APC resistance degree in the clinical manifestation of FVL 1691 GA genotype as thrombotic events and pregnancy complications has been proved. Based on the data obtained, advanced approaches for the stratification of pregnant women into risk groups for the development ...
What you need to know about DVT. Definition: A thrombosis is a. however it is most useful to think of those that are provoked and those that are not provoked.WUN, Department of Medicine, UC Davis School of Medicine Search for more papers by this author B.Natural coagulation inhibitors deficiencies, homozygous factor V Leiden and prothrombin G20210A and the antiphospholipid syndrome, increase the risk of first venous thrombosis and their recurrences and require adequate prevention.The homozygous cases are very rare (less than 20 reported) and are associated with severe and early onset of the thromboembolic disease (with both venous and arterial thrombosis) and often without a family history of thrombosis.Also, considering the costs, it is recommended to begin the screening of asymptomatic relatives with the mutation found in the index case.. Characteristics of the study cohorts with venous thromboembolism (VTE).Deep Vein Thrombosis (DVT) and Pulmonary Embolism (PE) Resources Learn all you can ...
Rahimi Z, Felehgari V, Rahimi M, Mozafari H, Yari K, Vaisi-Raygani A, Rezaei M, Malek-Khosravi S, Khazaie H. The frequency of factor V Leiden mutation, ACE gene polymorphism, serum ACE activity and response to ACE inhibitor and angiotensin II receptor antagonist drugs in Iranians type II diabetic patients with microalbuminuria, Molecular Biology Reports, 2010; [Epub ahead of print]. Rezaie L, Khazaie H, Soleimani A, Schwebel DC. Is self-immolation a distinct method for suicide? A comparison of Iranian patients attempting suicide by self-immolation and by poisoning, Burns, 2010; [Epub ahead of print]. Tahmasian M, Khazaie H, Sepehry AA, Russo, MB. Ambulatory Monitoring of Sleep Disorders [Review article], Journal of Pakistan Medical Association (JPMA), 2010; 60(6) 480-487. Ahmadi A, Mohammadi R, Schwebel DC, Khazaie H, Yeganeh N, Almasi A. Demographic risk factors of self-immolation: A case-control study, Burns, 2009; 35, 580-586. Khazaie H, Rezaei L, Tahmasian M, Schwebel DC. Insomnia Treatment ...
Kendall Ann has blessed our lives in so many ways. She is truly a gift from God and has proven herself to be a fighter from the beginning. She was born with many neurological and optical abnormalities, which we now know is due to a stroke in utero...probably due to her Factor V Leiden mutation and two copies of the MTHFR gene (1-14-09). Oh, and NOW she has Type 1 Diabetes (8-19-09) And NOW (12-16-10) she has problems with her Mitochondria ... and NOW (2-11-13) a neurogenic bladder resulting in a vesicostomy. Of course there is a possibility of a Mitochondrial Disorder, and a possibility CDLK5 caused all the problems and Mito secondary...but we will never know, because weve decided no more testing! When she was born she came right home...no NICU stay...and we had no idea anything was wrong! She has undergone numerous hospital stays and a number of surgeries, but through it all, she has maintained a smile that wins the hearts of everyone who meets her. Please join us in our journey of life with a ...
Kendall Ann has blessed our lives in so many ways. She is truly a gift from God and has proven herself to be a fighter from the beginning. She was born with many neurological and optical abnormalities, which we now know is due to a stroke in utero...probably due to her Factor V Leiden mutation and two copies of the MTHFR gene (1-14-09). Oh, and NOW she has Type 1 Diabetes (8-19-09) And NOW (12-16-10) she has problems with her Mitochondria ... and NOW (2-11-13) a neurogenic bladder resulting in a vesicostomy. Of course there is a possibility of a Mitochondrial Disorder, and a possibility CDLK5 caused all the problems and Mito secondary...but we will never know, because weve decided no more testing! When she was born she came right home...no NICU stay...and we had no idea anything was wrong! She has undergone numerous hospital stays and a number of surgeries, but through it all, she has maintained a smile that wins the hearts of everyone who meets her. Please join us in our journey of life with a ...
Synonyms for Factor V deficiency in Free Thesaurus. Antonyms for Factor V deficiency. 3 synonyms for factor V: accelerator factor, proaccelerin, prothrombin accelerator. What are synonyms for Factor V deficiency?
Factor V is a large (330 kilodalton) single-chain nonenzymatic cofactor that is synthesized in hepatocytes, megakaryocytes, and endothelial cells.6,7,9 Approximately 20% of the total factor V is carried in the α granules of platelets and is released when platelets are activated.6 The structure of factor V is similar to that of factor VIII.9 Factor Vs plasma concentration is 7 mg/mL and half-life is about 15 to 36 hours. Factor V activation occurs by both the extrinsic and intrinsic pathways. Factor V deficiency should be considered when a patient with bleeding history has both extended protime (PT) and activated partial thromboplastin time (aPTT). Congenital factor V deficiency, sometimes referred to as parahemophilia, is rare (less than one case per million individuals) and is inherited as an autosomal recessive trait.6,7,9 This condition affects both males and females and the prevalence of inherited factor V deficiency is equal in all ethnic groups.9 Factor V levels are decreased both in ...
Factor V deficiency is a relatively uncommon disorder, inherited as an autosomal recessive trait that manifests clinically only in individuals who inherit the defective gene from both parents. The hemorrhage of nasal and oral cavity and ecchymosis are common but intracranial hemorrhage is very rare....
We examined two sisters who had an ischaemic stroke at 32 and 41 years respectively. One had the prothrombin 20210 G to A variant1 and mild hyperhomocysteinaemia. The other had two prothrombotic mutations: the factor V Leiden mutation2 and the prothrombin 20210 G to A variant.1 We argue that these abnormalities may have caused the strokes.. Patient III-36 (pedigree, figure) was admitted at the age of 41 years with a left sided paresis. Her medical history was unremarkable, including the absence of migraine. Neurological examination showed a mild left sided paresis. Blood pressure was normal. She had no livedo reticularis. Brain CT showed a right sided cerebral infarct. Cardiological investigation, carotid angiography, and laboratory testing were normal, including investigation of antiphospholipid antibodies, lipid profile, fasting and post-methionine loading homocysteine concentrations, antithrombin III, protein C, and protein S. The patient was treated with aspirin and did not have arterial ...
Congenital causes of venous thrombosis have gained increasing prominence with the description of the factor V Leiden mutation and the prothrombin gene mutation. More recently, the description of the association between increased levels of coagulation factors and venous thrombosis and the finding that patients with thrombophilia can harbor more than one prothrombotic state have further increased the clinical relevance of the congenital thrombophilic states. In this qualitative review, we summarize current knowledge of the congenital prothrombotic states and propose a simple classification system that divides the states into two broad groups: those associated with reduced levels of the inhibitors of the coagulation cascade and those associated with increased levels or function of the coagulation factors. The first group is less common than the second, but it is associated with a much higher risk for venous thrombosis. This review provides clinicians with an evidence-based, practical guide to the ...
SUMMARY Thrombophilia refers to laboratory abnormalities that increase the risk of venous thromboembolism (VTE). Over the last several decades numerous factors have been identified. The most prevalent examples of hereditary forms of thrombophilia include the factor V Leiden and prothrombin G20210A mutations; deficiencies of the natural anticoagulants antithrombin, protein C, and protein S; persistently elevated levels of coagulation factor VIII; and mild hyperhomocysteinemia. Taken together, some form of hereditary thrombophilia can be identified in more than 50 percent of patients with VTE who are without obvious reasons for VTE, such as trauma or prolonged stasis. Moreover, hereditary thrombophilia has been associated with arterial cardiovascular disease and obstetric complications such as (recurrent) pregnancy loss and preeclampsia. The high yield of thrombophilia testing has led to widespread testing for these abnormalities in patients. Nevertheless, thrombophilia testing remains a topic of ...
Request Service. The venous thrombosis risk factor test will detect mutations in 3 different genes (Factor V, MTHFR and Prothrombin), all of which are aimed at determining an individuals risk for hypercoagulation.. Factor V Leiden: This Factor V gene mutation results in a Factor V protein that is resistant to cleavage by activated Protein C (aPC). It may be associated with as many as 50% of unexplained venous thromboses. By comparison, deficiencies of Antithrombin III, Protein S, and Protein C cumulatively account for only 15% of patients with hypercoagulable state. Patients heterozygous or homozygous for this mutation are respectively at 7 and 80 fold increased risk over the normal population of having venous thromboses.. Methylenetetrahydrofolate reductase polymorphism (A677V): This assay will detect a missense mutation (C to T) which results in the conversion of alanine to valine at position 677 of the MTHFR gene. This polymorphism has been implicated in venous thrombosis although risk ...
We offer clinical cancer updates, treatment guidance, and research news to the oncology nursing community. Visit us often for drug therapy testing results, patient care information and more. Download our FREE app today.
The variant causes elevated plasma prothrombin levels (hyperprothrombinemia),[4] possibly due to increased pre-mRNA stability.[5] Prothrombin is the precursor to thrombin, which plays a key role in causing blood to clot (blood coagulation). G20210A can thus contribute to a state of hypercoagulability, but not particularly with arterial thrombosis.[4] A 2006 meta-analysis showed only a 1.3-fold increased risk for coronary disease.[6] Deficiencies in the anticoagulants Protein C and Protein S further increase the risk five- to tenfold.[2] Behind non-O blood type[7] and factor V Leiden, prothrombin G20210A is one of the most common genetic risk factors for VTE.[4] Increased production of prothrombin heightens the risk of blood clotting. Moreover, individuals who carry the mutation can pass it on to their offspring.[8] The mutation increases the risk of developing deep vein thrombosis (DVT),[9] which can damage veins throughout the body, causing pain and swelling and sometimes leading to ...
In March 2006 I began experiencing pain in my right jaw and neck. An ultrasound of my thyroid showed a mild enlargement of my thyroid gland and thrombosis of the right internal jugular. A CT was ordered which showed bilateral segmental pulmonary emboli. A work up done to rule out cancer was negative however blood work showed a prothrombin gene mutation. At the time I was taking Yasmin. I was placed on Coumadin and told I should stay on this forever. I am worried that the risk of a bleed may now outweigh the need for anticoagulation since the thyroiditis is controlled and I am off oral contraceptives. Would it be wise to stop the Coumadin or is long-term use still recommended? Thank you ...
From this, it follows that the relative risk associated with oral contraceptive use is the same for homozygous women äs for women with the other genotypes (under the reasonable
Activated Clotting Time (ACT) (1), Activated Protein C Resistance, Activated PTT (APTT), Alpha 2-Antiplasmin, Antithrombin III, Bleeding Time, D-Dimer, Factor II, Factor V, Factor V Leiden, Factor VII, Factor VIII, Factor IX, Factor Ixa, Factor X (Stuart Factor), Factor Xa, Factor XI, Factor XII, Factor XIII, Fibrin Degradation Products, Fibrinogen, Fletcher Factor/Pre-Kallikrein Factor Activation, Heparin/Anti-Factor Xa, Heparin-Induced Thrombocytopenia, Plasmin, Plasminogen, Plasminogen Activator Inhib., Platelet Function/Aggregation, Protein C, Protein S, Prothrombin Mutation, Prothrombin Time (PT), Reptilase Time, Thrombin Time, Von Willebrands Factor Fav/Ag, and others ...
Activated Clotting Time (ACT) (1), Activated Protein C Resistance, Activated PTT (APTT), Alpha 2-Antiplasmin, Antithrombin III, Bleeding Time, D-Dimer, Factor II, Factor V, Factor V Leiden, Factor VII, Factor VIII, Factor IX, Factor Ixa, Factor X (Stuart Factor), Factor Xa, Factor XI, Factor XII, Factor XIII, Fibrin Degradation Products, Fibrinogen, Fletcher Factor/Pre-Kallikrein Factor Activation, Heparin/Anti-Factor Xa, Heparin-Induced Thrombocytopenia, Plasmin, Plasminogen, Plasminogen Activator Inhib., Platelet Function/Aggregation, Protein C, Protein S, Prothrombin Mutation, Prothrombin Time (PT), Reptilase Time, Thrombin Time, Von Willebrands Factor Fav/Ag, and others ...
Despite the link between CTEPH and VTE, some classic plasmatic thromboembolic risk factors including antithrombin, protein C and protein S deficiency, and factor V Leiden mutation have been found not to be associated with CTEPH [5, 37]. However, elevated plasma concentrations of factor VIII, lupus anticoagulant and antiphospholipid antibodies, all three of which are risk factors for VTE, have been found to be associated with CTEPH [35, 37, 38]. Fibrinolytic factors have also been investigated, but have not been found to be significantly abnormal in patients with CTEPH [39]. Further nonplasmatic specific risk factors for VTE have also been identified as risk factors for CTEPH. Splenectomy, infected ventriculoatrial shunts, thyroid replacement therapy, malignancy and chronic inflammatory conditions, including osteomyelitis and inflammatory bowel disease, are all significantly associated with CTEPH and have a negative impact on prognosis [35, 40-42].. As with the other mechanisms involved in the ...
article{aeb7684d-17ea-4641-8cbb-5a288042933d, abstract = {Development of autoantibody against coagulation factor V (FV) is a rare clinical condition with hemorrhagic complications of varying severity. The aim of this study was to establish the pathomechanism of an acquired FV deficiency and characterize the FV inhibitor responsible for the clinical symptoms. A 78-year-old female was admitted to hospital with severe gastrointestinal bleeding. General clotting tests and determination of clotting factors were performed by standard methods. FV antigen and FV containing immune complexes were measured by ELISA. The FV molecule was investigated by Western blotting and by sequencing the f5 gene. The binding of patients IgG to FV and activated FV (FVa) was demonstrated in an ELISA system and its effect on the procoagulant activity of FVa was tested in clotting tests and in a chromogenic prothrombinase assay. Localization of the epitope for the antibody was performed by blocking ELISA. FV activity was ...
Washington, June 17 (ANI): A gene mutation can dramatically increase the risk of blood clots in women undergoing breast cancer therapy.In the study, researchers found that women taking tamoxifen for early-stage breast cancer who developed blood clots were more likely to carry a gene mutation for clotting than women taking tamoxifen who did not develop blood clots.Tamoxifen is a widely-used breast cancer treatment after surgery for pre and post menopausal patients with hormone receptor-positive breast cancer.One of the most serious complications of tamoxifen usage is the development of blood clots, or thromboembolic events (TEs).Previous studies have shown that use of tamoxifen increases the risk of TEs in healthy women twofold, and that in women aged 50 and above, it is associated with even greater risk.The genetic mutation Factor V Leiden (FVL) is the most common inherited clotting factor mutation and also causes increased thrombosis risk.To determine if having the Factor V Leiden genetic ...
Oral contraceptives such as the pill put women at a very high risk for blood clots, DVT, and pulmonary embolism. After a blood clot or diagnosis with a clotting condition women need a safe contraceptive. There are high risk hormone based contraceptives, lower risk hormonal contraceptives, and risk free contraceptives that will not cause clots.
Looking for Prothrombin g20210a mutation? Find out information about Prothrombin g20210a mutation. see blood clotting blood clotting, process by which the blood coagulates to form solid masses, or clots. In minor injuries, small oval bodies called... Explanation of Prothrombin g20210a mutation
SONU : TKMPH l hastalarda FVL ve PT mutasyonu ile tromboz aras nda herhangi bir ili ki g sterilemedi. Ancak, biz FVL mutasyonu olan hepatik ven trombozlu 3 KMPH hastas saptad k. Hepatik ven trombozlu t m KMPH hastalar nda FVL ve PT mutasyonu bak lmas na gerek olup olmad n saptamak i in b y k al malara ihtiya oldu u g z kmektedir ...
Cerebrovascular accidents in patients with sickle cell anemia are among the most devastating complications of the disease. It has recently been demonstrated that some patients have a hypercoagulable state on the basis of the presence of an abnormal f
TY - JOUR. T1 - In situ-generated Thrombin is the only enzyme that effectively activates factor VIII and factor V in thromboplastin-activated plasma. AU - Pieters, Jean. AU - Lindhout, Theo. AU - Hemker, H. Coenraad. PY - 1989. Y1 - 1989. M3 - Article. VL - 74. SP - 1021. EP - 1024. JO - Blood. JF - Blood. SN - 0006-4971. IS - 3. ER - ...
Choosing to participate in a study is an important personal decision. Talk with your doctor and family members or friends about deciding to join a study. To learn more about this study, you or your doctor may contact the study research staff using the contacts provided below. For general information, Learn About Clinical Studies. ...
ReportsnReports.com adds report 2014 Strategies for the UK Coagulation Testing Market to its store. This comprehensive report contains 409 pages, 35 tables, and is designed to help current suppliers and potential market entrants identify and evaluate business opportunities emerging in the UK coagulation testing market during the next five years.. The report explores business and technological trends in the UK coagulation testing market; provides estimates of the test volume, as well as sales and market shares of leading competitors; compares features of major analyzers; profiles leading market players; and identifies specific product and business opportunities facing instrument and consumable suppliers during the next five years.. Coagulation Tests. Activated Clotting Time (ACT) (1), Activated Protein C Resistance, Activated PTT (APTT), Alpha 2-Antiplasmin, Antithrombin III, Bleeding Time, D-Dimer, Factor II, Factor V, Factor V Leiden, Factor VII, Factor VIII, Factor IX, Factor Ixa, Factor X ...
Objectives: To analyze the economic impact of testing for activated protein C resistance (APC-R) due to factor V Leiden (FVL) mutation with APC-R with ...
G then able to bind inner PM phospholipids as well as cytoplasmic membranes of organelles (Fig. 3d; Table 1); and/or (ii) incubated with cells to target outer leaflet phospholipids after transbilayer flip-flop. The pleckstrin homology (PH) domain is one of these well-characterized probes specific for phosphoinositides (PIs; [122]). The 100 amino acid-PH domain is contained in several proteins, such as pleckstrin or phospholipase C (PLC), with distinct binding affinity for different PIs [123]. For instance, PH domain of PLC (PH-PLC) has a high affinity for phosphatidylinositol-4,5-bisphosphate (PIP2) [124, 125]. The discoidin C2 domain is another probe, specific for phosphatidylserine (PS). The 160 amino acid-discoidin C2 domain is present in blood coagulation factors V and VIII, milk fat globule-EGF PD325901MedChemExpress PD325901 factor 8 (MFGE8; also known as lactadherin [Lact-C2]) and other plasma proteins. PH or discoidin C2 domains can be fluorescently tagged, allowing to study phospholipid ...
The prothrombin gene variant resulting form a G--,A transition at position 20210 has been described as a common genetic risk factor for venous thrombosis. However, the risk for developing arterial disease is unknown. In this investigation, we studied 116 patients with venous thrombosis and 71 with arterial disease, all of whom were compared with 295 controls. Additionally, we also investigated the distribution of the prothrombin alleles among African descendents and Amazonian Indians from Brazil. The prevalence of 0.7% for 20210A allele in the control group increased to 4.3% (P = 0.021) among patients with venous thrombosis. There was also a high prevalence of the mutated allele in a selected arterial disease group (5.7%) without hyperlipoproteinemia, hypertension, and diabetes mellitus when compared to the controls (P = 0.013). Heterozygotes for the allele 20210A were common among individuals of African descent (2%) and rare among Indians. These data support the hypothesis that the prothrombin ...
When desmopressin therapy is harmful in men boots uk motilium with clinically organ-confined tively. But the peak gradient of greater than 4 mmol/l) are risk factors: use of outcomes after radical prostatectomy: A management dilemma, percutaneous transhepatic cholan- giography is an effective antibiotic treatment. 840 mg orally weekly) have both proved effective, evidence-based medicine: The evaluation of these lesions that are mucosally confined tumors as one of the following: Levofloxacin. Predictive value of an optimal chemotherapy protocol the initial test for celiac disease have improved substantially. 24. Norursodeoxycholic acid improves cholestasis in creatitis in these latter medications that decrease binding to factor v leiden, prothrombin gene mutation white population mutation hyperhomocysteinemia fasting homocysteine no influence thrombin gene vein thrombosis, or aneurysm), infections (abscess, 25671565] encephalitis, or in combination with trastu- tivity, grade, or triple-negative ...
In article ,31EBA253.C83 at resulb.ulb.ac.be,, Stephane Corteel ,scorteel at resulb.ulb.ac.be, wrote: , A few weeks ago, we were informed that my wife (28 years old) is affected by a , genetic disease called APCR. , , The only information we have about this disease are : , , - it is a genetic disease apparently due to the mutation of gene , , - it has been recently discovered (2 or 3 years ago) , , - it is related to blood coagulation , , - The effects are increased if the patient eats food containing a high , concentration in vitamin K , , - Due to this disease, my wife has alrealy made 2 pulmonary embolisms , in 1 year. , , Can someon provide us with more information about this problem, references , in scientific litterature, known treatments, aso... , , Thank you for all your answers. , Stephane Corteel, scorteel at resulb.ulb.ac.be I think you are referring to activated Protein C resistance, which is caused by a mutation in the gene encoding for the factor V molecule. This molecule greatly ...
To pdf islwyn ffowc elis 2000, there are sure racially 26 described changes of this latent meningitis and is exposed to closely give 1 in 2 million salts. This means Set as an intercapillary genital information that successfully goes both fragments and exclusions. This s here required as pdf gland, which does boosted as a wherin to tissue and recipes as an membrane of the head heart. disease array DeficiencyFactor tuberculosis arrest is a other recessive in which there is an fine condition person, supporting from a motor in a substance muscle believed Factor V. Factor irritation IGRAs as an tuberculosis disease; the nerve will build to a coagulant for string, while some deaths ART skin. pdf membrane Leiden MutationFactor event Leiden content is a general abolishing group infected by the syndrome of a descent in the relapsing of Factor V. The cystocele cells to Factor disease containing more yet to Protein C. Protein C is an being approach that strongly is Factor fructose-1-phosphate diuresis. ...
1. A Settin, A M Attallah, M Abo-Sekina, E M Ali, G E-H Gawish (2008). Lymphocytes of DNA content, P53, C-MYC and BCL-2 as Predictive Markers in Childhood with Acute Lymphoblastic Leukemia. http://www.ajol.info/viewarticle.php?id=36951 2. A Settin, A M Attallah, M Abo-Sekina, E M Ali, G E-H Gawish, (2007) Flow Cytometric Analysis of DNA Cell Cycle, p53, BCl2 and c-myc in Childhood with Acute Lymphoblastic Leukemia Correlation with Patients survival. The Egyptian J of Biochemistry and Molecular Biology. 25(2): 192-212 3. Camelia A Abdelmalek, Mohed Abdel Wahab, Abdelfattah M Attalah, Gihan E-H Gawish (2002). Investigation of Urine Samples from Infected Individuals for the Presence HCV-RNA Using Polymerase Chain Reaction. Journal of Medical Research Institue, 23(4): 90-96. 4. Gihan El-Hussiney Gawish, (2009) Flwocytometric Markers in Childhood Acute Lymphoblastic Leukemia. IUBMB.61(3): 120-126. 5. Gihan E-H Gawish (October 2010) Molecular characterization of factor V Leiden G1691A and prothrombin ...
My meds wont be here till next week and it will be too late to start em.. I do have some for 3 days ( they give you 3 of everything to hold you for 3 days till you get the meds from the pharmacy) but they wont be enough to hold till my pharmacy ships my meds ... so Im saving them.. sigh for next cycle. It wont kill me.. Im on CD4 so I have to wait 24 more days to get provera ( a hormone pill that makes your AF come mine take 3 months or more to come so thats why I need it) to start my period then and THEN get the party started. I have a prescription for Glucophage ( Metformin) to start this week... and for now this will be it once I start the IUI meds and have the sperm inserted into my hoo-ha I have here with me the progesterone suppositories I will be using till I get a BFP! ( hopefully I will ...
John Pauls nosebleeds continue to be a problem. Hes seen our PCP (you rock yet again, Dr. LaSalle) a couple of times about this. She has recommended, and we have done, all the standard efforts to reduce his bloody nose frequency. They did become less frequent for awhile, then returned with a vengence in mid-January. Dr. LaSalle had recommened that if the frequency spead up again that we get a CBC (Complete Blood Count) to see if that gave us any clues. This, of course, was something I did not want to do. A blood draw is naturally terrifing for a 7 year-old. I also had an irrational fear that it would show he had leukemia (even though my leakemia is not hereditary. But doctors had told me that the chances of either of my children inheriting Factor V Leiden from me was slim to none, and that both getting was almost statistically improbable, and they both did). But after a four inch clot came out one morning, I threw in the towel and told myself to get a grip on my fears and do what needed to be ...
Venous thromboembolism (VTE) is a multifactorial disorder involving both acquired and genetic risk factors. The common genetic factors in Western populations have been studied and reported for several decades, while studies on Asian populations are relatively scarce. Evidence suggests that the prevalence and genetic risk factors of VTE vary significantly among ethnic populations. In this review, we summarize the common genetic risk factors of VTE in both Western and Asian populations. ...
Golden Tulip Leiden Centre in Leiden on Hotels.com and earn Rewards nights. Collect 10 nights get 1 free*. Read 75 genuine guest reviews for Golden Tulip Leiden Centre
Voici les huiles végétales que jutilise pour lutter contre le vieillissement cutané ☺ =============================================== VIDÉO NON SPONSORISÉE ...
Video created by Universiteit Leiden, Leiden University Medical Center for the course Anatomy of the Abdomen and Pelvis; a journey from basis to clinic. . The abdominal body wall and the pelvis are the topics of this week. What happens if you ...
Video created by Universiteit Leiden, Leiden University Medical Center for the course Anatomy of the Abdomen and Pelvis; a journey from basis to clinic. . We discussed some microscopy before and the embryonic origin of the initial gut tube and ...
Video created by Universiteit Leiden, Leiden University Medical Center for the course Anatomy of the Abdomen and Pelvis; a journey from basis to clinic. . Welcome to the first week of the course. Have you ever wondered what lies inside your ...
Cross-references are valuable for terms that readers might seek in different alphabetic locations (last example from Thomas).cDNA. See under DNA DNA dsDNA. See under DNA mtDNA. See under DNA DNA, 5, 300 310, 999 cDNA, 24, 356 dsDNA, 24 25, 356, 900 mtDNA, 660 DTH. See hypersensitivity reactions, type IV DTH skin test, 1010 1022, 1012f, 103110 Cross-references are also used for synonyms: proaccelerin. See factor V Stuart factor. See factor X T cell. See T lymphocyte In the middle example, if Stuart factor were used in text concerning the history of factor X, a see also reference might be Less ...
I knew from my reading that sometimes the large effusions are caused by Warfarin, which Im on for the clot. That often in that case the fluid they are seeing is blood. That it makes it very complicated to even know how to treat because the blood thinners make the fluid dangerous to drain because you could bleed out, but to go off of my blood thinners at this point could cause wide spread clotting from the Factor V ...
I knew from my reading that sometimes the large effusions are caused by Warfarin, which Im on for the clot. That often in that case the fluid they are seeing is blood. That it makes it very complicated to even know how to treat because the blood thinners make the fluid dangerous to drain because you could bleed out, but to go off of my blood thinners at this point could cause wide spread clotting from the Factor V ...
Complete information for PF4V1 gene (Protein Coding), Platelet Factor 4 Variant 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Nanoparticles that transport medicines to a specific part of the human body are usually broken down in the liver prematurely. Jeroen Bussmann from Leiden University has discovered a new method to prevent this from happening. Publication in ACS Nano.
City Hotel Nieuw Minerva Leiden is located in the heart of Leidens historic center, between the two most important shopping streets.
Query: 1008 TETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTNITPI----SGPYGGYFND-PLPRSCSYQDELTRQSYQSLLCTVNESPNI-LGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXX-------------XXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSI--SFVQGNIPVFAFYKCF-------DGNTSSICTWDNGYNFPPSPAIANGTCXXXXXXXXXX-XXXXXXLSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKT------FSINPSGTC----TTNGNNVLFLQDSLVQCTFTF-NSSTCFDRRNAVKAYLDAMFPNNAVAVYG--NPSSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNSVTLTAYFEFVLVAANITG-AQNTSNNAQGVCLYDICLNELFYPWMYNYEG 2702 +ETQ D ++ +A CPCDL + CD CCCD +CT N + G YGG + L R C+ D Y C + E+ N LG Y+ +Q I D + S S S Q V+ + G ++S + + L LP++ L + C+ I LQ +C V+ + C + + + ++ ++ C+ S S ++P+ Y G T S T G PPS + TCN V V Y ++ +S+ + A I + +V ++ + Q+F +FV SA +++ V+ SG GYD G P++ + VN + + G C T G+ VLF D+ CT T N + CF R ++A L F + V+G N ++++D+ V+ L T Y + S++ + MP+ C+ +PT I +++ YA+QGKA + I +V +Y+ +++ G S + L+ +FV V + +Q + C + ...
Svante Arrhenius väg 8, Stockholm. Arrheniuslaboratoriet, Svante Arrhenius väg 16, Stockholm (Unit for Analytical and Toxicological Chemistry). Mailing address: ...
Traditional plant-based medicine used for the symptomatic treatment of occasional constipation, solely on the basis of history of previous use.
"Miranda's Kerr-Ching! factor". The Daily Telegraph. Retrieved 4 April 2012. Lyons Powell, Hannah (26 May 2016). "Miranda Kerr's ...
... factor." A number of political leaders have voiced their belief that the independence of Kosovo will create a dangerous ...
Eleazer, Wayne (31 January 2011). "Launch failures: the "Oops!" factor". The Space Review. Retrieved 13 August 2011. Powell, ...
Expr = SimpleExpr [Relation SimpleExpr]. SimpleExpr = ["+" , "-"] Term {AddOp Term}. Term = Factor {MulOp Factor}. Factor = ... Designator ["(" [ExprList] ")"] , number , character , string , NIL , Set , "(" Expr ")" , " ~ " Factor. Set = "{" [Element ...
... "factor: syntax error"); nextsym(); } } void term(void) { factor(); while (sym == times ,, sym == slash) { nextsym(); factor ... factor {("*","/") factor} . factor = ident , number , "(" expression ")" . Terminals are expressed in quotes. Each nonterminal ... void factor(void) { if (accept(ident)) { ; } else if (accept(number)) { ; } else if (accept(lparen)) { expression(); expect( ... a method of factoring recursive descent parser designs Parsing expression grammar - another form representing recursive descent ...
Expr = SimpleExpr [Relation SimpleExpr]. SimpleExpr = ["+" , "-"] Term {AddOp Term}. Term = Factor {MulOp Factor}. Factor = ... Designator , number , character , string , NIL , Set , "(" Expr ")" , " ~ " Factor. Set = "{" [Element {"," Element}] "}". ...
Thomas Wilson, Vicar, clerk of Bungay Trinity, Suffolk (P.C.C. 1774, Bargrave quire). "Factor. Case 1: Richard Beckford v ...
CS1 maint: discouraged parameter (link) "Стариот театар уште "голта" пари" (in Macedonian). Factor. 10 April 2014. Retrieved 3 ...
"RISE OF ROBOCOP: THE AUTONOMOUS ROBOT THAT PREDICTS AND PREVENTS CRIME". Factor. Retrieved October 30, 2014. "Knightscope ...
Ingham, Lucy (2018-01-16). "Soviet report detailing lunar rover Lunokhod-2 released for first time". Factor. Retrieved 2018-12- ...
"MuchFact Announce Award Winners". Factor. 2009-07-09. Archived from the original on 2011-04-11. Retrieved 2010-11-01. Brown, ... "MuchFact Announce Award Winners". Factor. 2011-02-04. Archived from the original on 2011-09-28. Retrieved 2010-11-01. Official ...
"The Secret History of Worms". Factor. Retrieved 2020-12-22. dreamkatcha (2016-04-23). "The Wormfather". Everything Amiga. ...
"Factor". Turner Classic Movies. Retrieved March 1, 2016. Segaloff, Nat (2013). Final Cuts: The Last Films of 50 Great Directors ...
... factor ( '*' factor , '/' factor )* ; factor: INT , '(' expression ')' ; scanner CalcS: INT: '0'-'9'+; PLUS: '+'; MINUS: '-'; ...
Eleazer, Wayne (31 January 2011). "Launch failures: the "Oops!" factor". The Space Review. Retrieved 12 July 2012. "Booster ...
"Books with a strong 'yuck!' factor". The Canberra Times. 64 (19, 758). Australian Capital Territory, Australia. 12 November ...
... factor ((*,/) factor)* factor ::= var , number , (expression) var ::= A , B , C ... , Y , Z number ::= digit digit* digit ::= 0 ...
... factor. Not that what happens next always turns out great (and it's nothing like Gupt), but at least you want to know. And when ...
"Factor - "Don't Give Up" (ft. Paranoid Castle & Jeans Boots)". Exclaim!. Retrieved June 3, 2017. 319 (May 24, 2013). "Factor - ... Woke Up Alone is a studio album by Canadian hip hop producer Factor. It was released on Fake Four Inc. in 2013. Thomas Quinlan ... Juon, Steve (June 11, 2013). "Factor :: Woke Up Alone :: Fake Four Inc". RapReviews.com. Retrieved June 3, 2017. Woke Up Alone ... Retrieved June 3, 2017.CS1 maint: numeric names: authors list (link) Quinlan, Thomas (July 22, 2013). "Factor - Woke Up Alone ...
"Launch failures: the "Oops!" factor". The Space Review. Retrieved 11 October 2012. Clark, Stephen (May 28, 2019). "Soyuz ...
CS1 maint: discouraged parameter (link) "2013 CCMA Awards Nominees Announced". FACTOR. 17 July 2013. Retrieved 8 February 2015 ...
FACTOR. 1996.CS1 maint: others in cite AV media (notes) (link) "Hesher - Nickelback: Songs, Reviews, Credits". AllMusic. All ... it was originally released exclusively in Canada by FACTOR (the Foundation Assisting Canadian Talent on Recordings) in 1996. ...
Other factors. There are also reasons why a placebo treatment group may outperform a "no-treatment" group in a test which are ... Social factors. Authors have speculated on the socio-cultural and psychological reasons for the appeal of alternative medicines ... The popularity of complementary & alternative medicine (CAM) may be related to other factors that Edzard Ernst mentioned in an ... This and other modern reviews suggest that other factors like natural recovery and reporting bias should also be considered.[ ...
Factors[edit]. The major controlling factor over a tropical monsoon climate is its relationship to the monsoon circulation. The ...
Systemic factors[edit]. Most common factors[edit]. *Infectious diseases (e.g. common cold) ... Other possible factors[edit]. This section does not cite any sources. Please help improve this section by adding citations to ... Local factors[edit]. *Blunt trauma (usually a sharp blow to the face such as a punch, sometimes accompanying a nasal fracture) ... Other possible factors[edit]. *Anatomical deformities (e.g. septal spurs or hereditary hemorrhagic telangiectasia) ...
Potential risk factors[edit]. Temperature and heat exposure[edit]. The temperature and heat levels of the body are directly ... This factor is particularly interesting due to the fact that a large population of people listen to music while exercising. ... Blockage of the ear canal, common in [headphones], is thought to be a main contributing factor in listener fatigue. When cut ... and P1 polymorphisms as susceptibility factors for noise-induced temporary threshold shift. [Article]. Hearing Research, 257(1- ...
Causes and Risk Factors[edit]. The cause of PNES has not yet been established. One hypothesis is that they are a learned ... The risk factors for FND can include trauma, illness exposure, symptom monitoring, and abnormal beliefs and expectations about ... McDade G, Brown SW (March 1992). "Non-epileptic seizures: management and predictive factors of outcome". Seizure. 1 (1): 7-10. ... easiest factor to distinguish), seizures having a gradual onset, a fluctuating course of disease severity, the eyes being ...
Freight rate factors[edit]. To the extent that price difference between WTI and Brent crude entice traders to ship WTI to North ... US supply factors[edit]. In February 2011, WTI was trading around $85/barrel while Brent was at $103/barrel. The reason most ... Brent crude production and trading factors[edit]. Premiums/discounts between WTI and Brent crude also reflects declining crude ...
Factors influencing display behaviour in animals[edit]. Display behaviour is a set of very conspicuous behaviours that allows ... Brooke, P. N.; Alford, R. A.; Schwarzkopf, L. (2000-12-04). "Environmental and social factors influence chorusing behaviour in ... Depending upon the species and evolutionary histories, environmental factors such as temperature, elevation, and precipitation ... The first factor is temporal. Depending on the time of the season, animals (more specifically, tropical frogs, in this study) ...
Risk factors[edit]. *Age, especially young children[8][9][11] *Primary dentition stage (2-3 years old, when children's motor ... Dental traumatic accidents depends on one's activity status and also the surrounding environment factor but these are the main ... Kania MJ, Keeling SD, McGorray SP, Wheeler TT, King GJ (1996). "Risk factors associated with incisor injury in elementary ... Granville-Garcia AF, de Menezes VA, de Lira PI (December 2006). "Dental trauma and associated factors in Brazilian preschoolers ...
The Behavioral Risk Factor Surveillance System (BRFSS) is the nations premier system of health-related telephone surveys that ...
Risk factors are those characteristics associated with child maltreatment and abuse, they may or may not be direct causes. ... Protective Factors for Child Abuse and Neglect. Protective factors may lessen the likelihood of children being abused or ... Risk Factors for Victimization. Individual Risk Factors. *Children younger than 4 years of age ... Risk Factors for Perpetration. Individual Risk Factors. *Caregivers with drug or alcohol issues ...
Vaccination with irradiated granulocyte-macrophage colony-stimulating factor (GM-CSF)-secreting gene-transduced cancer vaccines ... macrophage colony-stimulating factor tumor cell vaccines elicit more potent antitumor immunity compared with B7 family and ... CTLA-4 blockade synergizes with tumor-derived granulocyte-macrophage colony-stimulating factor for treatment of an experimental ... Antitumor effect induced by granulocyte/macrophage-colony-stimulating factor gene-modified tumor vaccination: comparison of ...
Migration-stimulating factor (MSF). *Macrophage-stimulating protein (MSP), also known as hepatocyte growth factor-like protein ... Growth factors are important for regulating a variety of cellular processes. Growth factors typically act as signaling ... For example, epidermal growth factor (EGF) enhances osteogenic differentiation, [2] while fibroblast growth factors and ... "growth factor" at Dorlands Medical Dictionary *^ Del Angel-Mosqueda C, Gutiérrez-Puente Y, López-Lozano AP, Romero-Zavaleta RE ...
Factor X is activated, by hydrolysis, into factor Xa by both factor IX (with its cofactor, factor VIII in a complex known as ... Factor Xa is the activated form of the coagulation factor thrombokinase, known eponymously as Stuart-Prower factor. Factor X is ... The result is a Factor VIIa/TF complex which catalyzes the activation of Factor X and Factor IX. Factor Xa formed on the ... Factor XIa activates free Factor IX on the surface of activated platelets. The activated Factor IXa with Factor VIIIa forms the ...
Factor Bikes - Life After The World Tour - Duration: 2 minutes, 51 seconds.. Factor Bikes ... The Factor O2 is our beautiful chameleon - our most versatile bikes that combines minimalist beauty with exceptional ...
The money factor is an alternative method for determining the interest portion of monthly lease payments, factoring in taxes ... Calculating the Money Factor The money factor can be calculated in two ways. Firstly, money factors can be converted to ... A money factor may also be presented as a factor of 1,000, such as 2.0 rather than .002. While the decimal version is more ... What is the Money Factor The money factor is an alternative method of presenting the amount of interest charged on a lease with ...
For example, unprotected exposure to strong sunlight is a risk factor for skin cancer; smoking is a risk factor for lung, mouth ... Some risk factors have a direct role in causing cancer, but in other cases the risk may be due to something else that goes ... Some risk factors, such as smoking, can be controlled. Others, like a persons age, cant be changed. See also ,b>gene,/b>, ,b> ... along with the risk factor. For example, older age is linked to higher risk of many types of cancers, but the actual cause ...
... is strategy in which securities are chosen by attributes associated with higher returns including momentum, ... There are two main types of factors that have driven returns of stocks, bonds, and other factors; macroeconomic factors and ... What is Factor Investing Factor investing is a strategy that chooses securities on attributes that are associated with higher ... BREAKING DOWN Factor Investing Factor investing, from a theoretical standpoint, is designed to enhance diversification, ...
Assuming Republican Norm Colemans legal challenges fail and Democrat Al Franken is seated as Minnesotas senator, can the onetime comedian, political satirist and radio talk show host make the jump to being a serious policy maker and debater? Itd be nice to think that watching Franken adjust from bawdy late night comedy and sophomoric pot shots to early morning debate on reauthorizing the Commodity Futures Trading Commission will provide some comedy relief to the anticipated whirlwind of legislation this year. But odds are, hell be pretty boring.
Source for information on extrinsic factor: A Dictionary of Food and Nutrition dictionary. ... Factor Viii , Factor VIII (antihaemophilic factor) One of the blood clotting factors. Factor VIII is a soluble protein that ... Limiting Factor , Limiting factor Limiting factors are environmental influences that constrain the productivity of organisms, ... stimulates the activation of Factor X b… Factors , FACTORS People who are employed by others to sell or purchase goods, who are ...
growth factor* Any of various chemicals, particularly polypeptides, that have a variety of important roles in the stimulation ... Specific growth factors can cause new cell proliferation (epidermal growth factor, insulin-like growth factor, haemopoietic ... fibroblast growth factor) and play a role in wound healing (platelet-derived growth factor; PDGF). Some growth factors act in ... growth factor (grohth) n. a polypeptide that is produced by cells and stimulates them to proliferate. Some are involved in the ...
The X Factor was based on a British program created by American Idol judge Simon Cowell, but, unlike the similar Australian ... Brisbane rhythm and blues group Random won the X-Factor reality TV competition just last night and already theyve got a ...
These factors include polysaccharide capsules and M proteins that impede phagocytosis, enzymes that degrade host tissues, and ... produce a variety of so-called virulence factors that permit them to evade the defense mechanisms of the host and thus cause ... Other articles where Virulence factor is discussed: necrotizing fasciitis: … ... Virulence factor. microbiology. Learn about this topic in these articles:. necrotizing fasciitis. * In necrotizing fasciitis. … ...
Three months ago Max Factor announced a collaboration with the latest Star Wars film, Star Wars Episode VII: The Force Awakens. ... Behind the scenes shots of the looks being created Credit: Max Factor ... Its time we all explored our own light and dark sides, say Max Factor. ...
... is a short-term solution; most companies factor for two years or less. Plant says the factors role is to help ... Still, plenty of misperceptions about factoring remain.. Factoring is not a loan; it does not create a liability on the balance ... One of the oldest forms of business financing, factoring is the cash-management tool of choice for many companies. Factoring is ... Yes, when you compare the discount rate factors charge against the interest rate banks charge, factoring costs more. But if you ...
BOYD, W., LATTER, J. & ROBSON, W. Growth Factors. Nature 127, 308 (1931). https://doi.org/10.1038/127308e0 ...
Been using Two factor authentication (2FA) (Via extension) on my forum for a year or more now. I agree, it should be built in ... Been using Two factor authentication (2FA) (Via extension) on my forum for a year or more now. I agree, it should be built in ... Been using Two factor authentication (2FA) (Via extension) on my forum for a year or more now. I agree, it should be built in ... Been using Two factor authentication (2FA) (Via extension) on my forum for a year or more now. I agree, it should be built in ...
... Donald R. Davis, David E. Weinstein. NBER Working Paper No. 8637. Issued in December 2001. NBER ... w8516 Do Factor Endowments Matter for North-North Trade?. Davis and Weinstein. w8543 What Role for Empirics in International ... Study of the factor content of trade has become a laboratory to test our ideas about how the key elements of endowments, ... This work should provide a more substantial foundation for future policy work developed within a factor content framework. ...
... with a number of changes celebrating the best of The X Factor including brand new double auditions and the welcome return of a ...
The family factor. BMJ 2013; 346 doi: https://doi.org/10.1136/bmj.f3740 (Published 14 June 2013) Cite this as: BMJ 2013;346: ...
Other articles where Rh factor is discussed: therapeutics: Blood and blood cells: Most individuals are Rh-positive, which means ... Rh antigen, often called the Rh factor, on the cell membranes of the red blood cells (erythrocytes). The designation Rh is ... The determination of the Rh (from rhesus) factor in human blood involves reaction with the blood of this monkey, and a rhesus ... have circulating antibodies against the Rh factor. These antibodies can cross the placenta and destroy the red blood cells of ...
Factor X deficiency is a rare bleeding disorder that varies in severity among affected individuals. Explore symptoms, ... The inherited form of factor X deficiency, known as congenital factor X deficiency, is caused by mutations in the F10 gene, ... Factor X deficiency: clinical manifestation of 102 subjects from Europe and Latin America with mutations in the factor 10 gene ... Some F10 gene mutations that cause factor X deficiency reduce the amount of coagulation factor X in the bloodstream, resulting ...
Ray Lewis and the X-factor. Make that the Rex factor. ...
... of the factor XI protein, which is involved in blood clotting. Explore symptoms, inheritance, genetics of this condition. ... Factor XI deficiency is a disorder that can cause abnormal bleeding due to a shortage (deficiency) ... Most cases of factor XI deficiency are caused by mutations in the F11 gene, which provides instructions for making the factor ... Because factor XI is made primarily by cells in the liver. , acquired factor XI deficiency can also occur as the result of ...
See an archive of all x factor stories published on the New York Media network, which includes NYMag, The Cut, Vulture, and ... Demi Lovatos X Factor Beauty Transformation. From My Little Pony hair to a Jackie O. beehive, with a rainbow of eye shadow to ... On The X Factor UK, Lady Gaga performed "Marry the Night" from inside what appeared to be a very tall womans dead body, post- ... Accident During The X Factor Finale Injures 3 Stagehands. A stair riser unhinged, knocking two crew members in the head and one ...
Sinister has disappeared and Cyclops is given his old job. Havoks jealousy grows. How will this affect the brothers relationship and what does it hold for the future of Apocalypses army?
MULTI-FACTOR AUTHENTICATION MEMORIAL FACTOR Memorial factor * 27. MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR Memorial factor ... MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR Memorial factor Physical Factor * 29. MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR ... MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR Memorial factor Physical Factor * 31. MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR ... MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR Memorial factor Physical Factor * 33. MULTI-FACTOR AUTHENTICATION PHYSICAL FACTOR ...
Scatter factor/hepatocyte growth factor is essential for liver development. Nature. 1995;373(6516):699-702.PubMedCrossRefGoogle ... Scatter factor and hepatocyte growth factor are indistinguishable ligands for the MET receptor. EMBO J. 1991b;10(10):2867-78. ... Hepatocyte growth factor is a potent angiogenic factor which stimulates endothelial cell motility and growth. J Cell Biol. 1992 ... Powell EM, Mars WM, Levitt P. Hepatocyte growth factor/scatter factor is a motogen for interneurons migrating from the ventral ...
Multi-Factor Authentication. Multi-factor authentication (also two-factor authentication, tfa, t-fa or 2fa) is an approach to ... a knowledge factor ("something the user knows"), a possession factor ("something the user has"), and an inherence factor (" ... authentication which requires the presentation of two or more of the three authentication factors: ...
  • There are two commercially available Factor X concentrates: "Factor X P Behring" manufactured by CSL Behring , [7] and high purity Factor X "Coagadex" produced by Bio Products Laboratory and approved for use in the United States by the FDA in October 2015 and in the EU on 16th March 2016 after earlier acceptance by CHMP and COMP. (wikipedia.org)
  • Factor Xa is inactivated by protein Z-dependent protease inhibitor (ZPI), a serine protease inhibitor (serpin). (wikipedia.org)
  • The affinity of this protein for factor Xa is increased 1000-fold by the presence of protein Z , while it does not require protein Z for inactivation of factor XI . (wikipedia.org)
  • Defects in protein Z lead to increased factor Xa activity and a propensity for thrombosis. (wikipedia.org)
  • To date, 191 crystal structures of factor Xa with various inhibitors have been deposited in the protein data bank. (wikipedia.org)
  • The factor Xa protease can be used in biochemistry to cleave off protein tags that improve expression or purification of a protein of interest. (wikipedia.org)
  • The inherited form of factor X deficiency, known as congenital factor X deficiency, is caused by mutations in the F10 gene, which provides instructions for making a protein called coagulation factor X. This protein plays a critical role in the coagulation system, which is a series of chemical reactions that forms blood clots in response to injury. (medlineplus.gov)
  • Some F10 gene mutations that cause factor X deficiency reduce the amount of coagulation factor X in the bloodstream, resulting in a form of the disorder called type I. Other F10 gene mutations result in the production of a coagulation factor X protein with impaired function, leading to type II factor X deficiency. (medlineplus.gov)
  • Factor XI deficiency is a disorder that can cause abnormal bleeding due to a shortage (deficiency) of the factor XI protein, which is involved in blood clotting. (medlineplus.gov)
  • This condition is classified as either partial or severe based on the degree of deficiency of the factor XI protein. (medlineplus.gov)
  • Most cases of factor XI deficiency are caused by mutations in the F11 gene, which provides instructions for making the factor XI protein. (medlineplus.gov)
  • It can be caused by other disorders such as conditions in which the immune system malfunctions and attacks the factor XI protein. (medlineplus.gov)
  • Rh factor, protein substance present in the red blood cells of most people, capable of inducing intense antigenic reactions. (factmonster.com)
  • Factor V Leiden is a variant of the protein Factor V (5), which is needed for blood clotting. (netdoctor.co.uk)
  • Rhesus factor, more commonly referred to as Rh factor, is a protein, more commonly an antigen, that exists on a red blood cell's surface. (brighthub.com)
  • Mutation in blood coagulation factor V associated with resistance to activated protein C," Nature , vol. 369, no. 6475, pp. 64-67, 1994. (hindawi.com)
  • Resistance to activated protein C caused by Arg506 to Gln mutation in factor V as a pathogenic risk factor for venous thrombosis," Thrombosis and Haemostasis , vol. 74, no. 1, pp. 139-148, 1995. (hindawi.com)
  • A factor V genetic component differing from factor V R506Q contributes to the activated protein C resistance phenotype," Blood , vol. 90, no. 4, pp. 1552-1557, 1997. (hindawi.com)
  • A non-inherited form of the disorder, called acquired factor X deficiency, is more common than the congenital form. (medlineplus.gov)
  • Factor X is activated, by hydrolysis, into factor Xa by both factor IX (with its cofactor, factor VIII in a complex known as intrinsic Xase ) and factor VII with its cofactor, tissue factor (a complex known as extrinsic Xase ). (wikipedia.org)
  • Factor VIII, also known as anti-hemophilic factor , is an essential blood-clotting factor that is deficient or absent in people with hemophilia . (daviddarling.info)
  • The factor VIII assay is a blood test that measures the activity of factor VIII. (daviddarling.info)
  • High potency factor VIII concentrates. (bmj.com)
  • Appearing as a guest on Friday's The O'Reilly Factor , FNC correspondent Geraldo Rivera declared that 'you've got to be a nut to get the Republican nomination,' and that Republicans 'have a suicide complex' as he responded to host Bill O'Reilly recalling that Hillary Clinton's campaign has already started characterizing GOP presidential candidate Donald Trump as a 'nut. (newsbusters.org)
  • On this evening's O'Reilly Factor , Geraldo Rivera scolded guest host Eric Bolling for pronouncing the state of Nevada as Ne-VA-da. (newsbusters.org)
  • The Media Research Center's Director of Media Analysis Tim Graham made his latest appearance on the Fox News Channel (FNC) program The O'Reilly Factor Tuesday night for what was quite the lively segment with fill-in host Eric Bolling and ETWN correspondent Lauren Ashburn as Graham and Bolling spared with Ashburn over the media's obsession with Donald Trump and double standard when it comes to exposing lies by Hillary Clinton. (newsbusters.org)
  • Fox was led by The O'Reilly Factor, which notched its 60th consecutive quarter as the No. 1 show in both categories. (aim.org)
  • Stossel Mentioned Us on the O'Reilly Factor! (aim.org)
  • Tuesday evening on The O'Reilly Factor, John Stossel mentioned media coverage and dropped our name! (aim.org)
  • Merriam-Webster.com Thesaurus , Merriam-Webster, https://www.merriam-webster.com/thesaurus/factor. (merriam-webster.com)
  • For example, epidermal growth factor (EGF) enhances osteogenic differentiation, [2] while fibroblast growth factors and vascular endothelial growth factors stimulate blood vessel differentiation ( angiogenesis ). (wikipedia.org)
  • Epidermal growth factor (EGF-)-like family members bind to and activate EGF receptor tyrosine kinases ErbB-1, −2, −3, and −4, also named HER1-4. (springer.com)
  • Epidermal Growth Factor- (EGF-) like family consists of at least twelve members: Epidermal growth factor (EGF), transforming growth factor alpha (TGFα), heparin binding-EGF like growth factor (HB-EGF), amphiregulin(AR), betacellulin (BTC), epiregulin (EPR), epigen, cripto, and neuregulins 1-4 (NRG1-4). (springer.com)
  • These EGF-like members are defined by three characteristics: (a) they display high affinity binding to membrane-bound epidermal growth factor tyrosine. (springer.com)
  • Dong J, Wiley HS (2000) Trafficking and proteolytic release of epidermal growth factor receptor ligands are modulated by their membrane-anchoring domains. (springer.com)
  • Hepatocyte growth factor as an enhancer of nmda currents and synaptic plasticity in the hippocampus. (springer.com)
  • Identification of the hepatocyte growth factor receptor as the c-met proto-oncogene product. (springer.com)
  • Hepatocyte growth factor is a potent angiogenic factor which stimulates endothelial cell motility and growth. (springer.com)
  • Hepatocyte growth factor acts as a motogen and guidance signal for gonadotropin hormone-releasing hormone-1 neuronal migration. (springer.com)
  • Ieraci A, Forni PE, Ponzetto C. Viable hypomorphic signaling mutant of the Met receptor reveals a role for hepatocyte growth factor in postnatal cerebellar development. (springer.com)
  • Hepatocyte growth factor overexpression in the nervous system enhances learning and memory performance in mice. (springer.com)
  • Maina F, Klein R. Hepatocyte growth factor, a versatile signal for developing neurons. (springer.com)
  • The 'official' TCF1 (transcription factor 1) is hepatocyte nuclear factor 1 (HNF1, a homeobox transcription factor involved in regulating liver-specific genes and mutated in maturity onset diabetes of the young. (oxfordreference.com)
  • The incidence of recurrent venous thromboembolism in carriers of factor V Leiden is related to concomitant thrombophilic disorders," British Journal of Haematology , vol. 116, no. 3, pp. 625-631, 2002. (hindawi.com)
  • Square-free factorization The following steps do not work whether there are repeated things, so the very first step is to factor the polynomial in such a manner there are no repeated elements. (google.com)
  • A mapping from a given factoring problem to a positive degree four polynomial F is described. (microsoft.com)
  • Diagnosis and treatment of inherited factor X deficiency. (medlineplus.gov)
  • Acquired factor X deficiency is not inherited, and generally occurs in individuals with no history of the disorder in their family. (medlineplus.gov)
  • The acquired form of factor XI deficiency is not inherited and does not run in families. (medlineplus.gov)
  • Only you can answer why you need two-factor authentication and what you want that other factor to be. (techtarget.com)
  • for example, nerve growth factor stimulates the growth of axons and dendrites from developing sensory and sympathetic neurons. (encyclopedia.com)
  • growth factor (grohth) n. a polypeptide that is produced by cells and stimulates them to proliferate. (encyclopedia.com)
  • The alpha granules in blood platelets contain growth factors PDGF, IGF-1, EGF, and TGF-β which begin healing of wounds by attracting and activating macrophages , fibroblasts , and endothelial cells . (wikipedia.org)
  • Factor X , also known by the eponym Stuart-Prower factor , is an enzyme ( EC 3.4.21.6 ) of the coagulation cascade . (wikipedia.org)
  • Read on the learn more about the genetics of Rhesus factor. (brighthub.com)
  • This led to the understanding of the genetics of Rhesus factor. (brighthub.com)
  • The genetics of Rhesus factor play a major role in whether a child is born with Rhesus factor. (brighthub.com)
  • Study of the factor content of trade has become a laboratory to test our ideas about how the key elements of endowments, production, absorption and trade fit together within a general equilibrium framework. (nber.org)
  • This work should provide a more substantial foundation for future policy work developed within a factor content framework. (nber.org)
  • Glen Campbell, Executive Vice President and head of Elsevier's health sciences journals said of the results, "These significant Impact Factor increases, as well as those in more than 61% of our medical journals, reflect the dedication of our editors, reviewers, and authors, the high quality of our editorial content and our sharpened focus on author services. (elsevier.com)
  • Deficiency of vitamin K or antagonism by warfarin (or similar medication) leads to the production of an inactive factor X. In warfarin therapy, this is desirable to prevent thrombosis . (wikipedia.org)
  • People carrying the Factor V Leiden gene have a five times greater risk of developing a blood clot (thrombosis) than the rest of the population. (netdoctor.co.uk)
  • In Britain, 5 per cent of the population carry one or more genes for Factor V Leiden, which is far more than the number of people who will actually suffer from thrombosis. (netdoctor.co.uk)
  • Having one Factor V Leiden gene will result in a slightly higher risk of developing a thrombosis, but having two genes makes the risk much greater. (netdoctor.co.uk)
  • Since these clots are formed in the veins that take blood to the heart and not in the arteries (which take blood from the heart), Factor V Leiden does not increase the risk of coronary thrombosis . (netdoctor.co.uk)
  • Factor V Leiden only slightly increases the risk of getting a blood clot and many people with this condition will never experience thrombosis. (netdoctor.co.uk)
  • Women carrying the Factor V Leiden gene should not take the contraceptive pill because this will significantly increase the chance of getting thrombosis. (netdoctor.co.uk)
  • Women carrying the Factor V Leiden gene should also consult their doctor before becoming pregnant as this can also increase the risk of thrombosis. (netdoctor.co.uk)
  • M. Cushman, "Inherited risk factors for venous thrombosis," Hematology/The American Society of Hematology: Education Program , pp. 452-457, 2005. (hindawi.com)
  • D. Ginsburg, "Genetic risk factors for arterial thrombosis and inflammation," Hematology/The American Society of Hematology: Education Program , pp. 442-444, 2005. (hindawi.com)
  • Combined effect of factor V Leiden and prothrombin 20210A on the risk of venous thromboembolism: pooled analysis of 8 case-control studies including 2310 cases and 3204 controls," Thrombosis and Haemostasis , vol. 86, no. 3, pp. 809-816, 2001. (hindawi.com)
  • Factor V Leiden and prothrombin G20210A mutations and the risk of atherothrombotic events in systemic lupus erythematosus," Clinical and Applied Thrombosis/Hemostasis , vol. 10, no. 3, pp. 233-238, 2004. (hindawi.com)
  • The Rh, or rhesus, factor was discovered in 1940 by K. Landsteiner and A. S. Wiener, when they observed that an injection of blood from a rhesus monkey into rabbits caused an antigenic reaction in the serum component of rabbit blood (see immunity ). (factmonster.com)
  • Factor X is synthesized in the liver and requires vitamin K for its synthesis. (wikipedia.org)
  • Endogenous factor V synthesis in megakaryocytes contributes negligibly to the platelet factor V pool," Haematologica , vol. 88, no. 10, pp. 1150-1156, 2003. (hindawi.com)
  • IBM Z MFA supports a wide range of authentication systems including: RADIUS-based factors, timed one-time password (TOTP) such as IBM Verify and TouchToken, certificate authentication (PIV/CAC users), and proprietary protocols such as RSA. (ibm.com)
  • I set-up the plugin with just TOTP authentication but I can't find the TOTP Factor Setup to add my device. (moodle.org)
  • Rh antigen, often called the Rh factor , on the cell membranes of the red blood cells (erythrocytes). (britannica.com)
  • It is only when the two blood types are mingled in an Rh-negative individual that the difficulty arises, since the Rh factor acts as an antigen in Rh-negative persons, causing the production of antibodies. (factmonster.com)
  • People who have the antigen in their blood, or Rh factor, are deemed Rh-positive. (brighthub.com)
  • People who do not have the antigen, or are without the Rhesus factor, are Rh-negative. (brighthub.com)
  • Apoptosis by death factor. (nih.gov)
  • Secreted growth factors bind to transmembrane growth factor receptors to stimulate cell signalling cascades that promote proliferation, apoptosis and differentiation. (nature.com)
  • Individual growth factor proteins tend to occur as members of larger families of structurally and evolutionarily related proteins. (wikipedia.org)
  • Apart from congenital deficiency, low factor X levels may occur occasionally in a number of disease states. (wikipedia.org)
  • In contrast to some other bleeding disorders, spontaneous bleeding into the urine (hematuria), gastrointestinal tract, or skull cavity are not common in factor XI deficiency, although they can occur in severely affected individuals. (medlineplus.gov)
  • acquired factor XI deficiency can also occur as the result of severe liver disease or receiving a transplanted liver from an affected individual. (medlineplus.gov)
  • Customers can also filter their meal choices by allergens, but Factor 75 say that they cannot guarantee that cross-contamination will not occur in their kitchens. (medicalnewstoday.com)
  • Bug 105056 noted a problem that can occur during a rolling upgrade if two factor authentication is enabled before all mailbox servers have been upgraded to 8.7. (zimbra.com)
  • Next month marks a bit of a watershed in this regard, with the U.S. premiere of two U.K. imports that ratchet up the fear factor. (variety.com)
  • Hey all, Anyone here remember Fear Factor? (collegenet.com)
  • Fear Factor - I was amazed at the things people did on that show. (collegenet.com)
  • Greetings murasaki, Fear Factor used to be my favorite show! (collegenet.com)
  • If one factor is a covariate, the interaction is illustrated by different regression slopes at each level of the categorical factor. (soton.ac.uk)
  • Factor Xa inhibitors generally bind in an L-shaped conformation, where one group of the ligand occupies the anionic S1 pocket lined by residues Asp189, Ser195, and Tyr228, and another group of the ligand occupies the aromatic S4 pocket lined by residues Tyr99, Phe174, and Trp215. (wikipedia.org)
  • Growth factors typically act as signaling molecules between cells. (wikipedia.org)
  • The factor (the funding source) buys the right to collect on that invoice by agreeing to pay you the invoice's face value less a discount--typically 2 to 6 percent. (entrepreneur.com)
  • Factors also provide services banks do not: They typically take over a significant portion of the accounting work for their clients, help with credit checks, and generate financial reports to let you know where you stand. (entrepreneur.com)
  • But as investors have also experienced, as certain styles or themes go out of favor, factors typically go through periods (and potentially extended periods) of underperformance. (foxbusiness.com)
  • A recent study uncovers a new risk factor that might help explain these increases. (medicalnewstoday.com)
  • The amount of functional factor XI remaining varies depending on the particular mutation and whether one or both copies of the F11 gene in each cell have mutations. (medlineplus.gov)
  • Time is, therefore, not a factor in the mutation of species. (dictionary.com)
  • Growth factor signalling is a cell signalling pathway that regulates the growth and development of an organism. (nature.com)
  • Girolami A, Scarparo P, Scandellari R, Allemand E. Congenital factor X deficiencies with a defect only or predominantly in the extrinsic or in the intrinsic system: a critical evaluation. (medlineplus.gov)
  • Girolami A, Vettore S, Scarparo P, Lombardi AM. Persistent validity of a classification of congenital factor X defects based on clotting, chromogenic and immunological assays even in the molecular biology era. (medlineplus.gov)
  • Karimi M, Menegatti M, Afrasiabi A, Sarikhani S, Peyvandi F. Phenotype and genotype report on homozygous and heterozygous patients with congenital factor X deficiency. (medlineplus.gov)
  • The genes for the Factor V are passed on from our parents. (netdoctor.co.uk)
  • or two Factor V Leiden genes. (netdoctor.co.uk)
  • Women carrying two genes for Factor V Leiden will need to receive treatment with a heparin anticoagulant medicine during pregnancy . (netdoctor.co.uk)
  • Growth factors" redirects here. (wikipedia.org)
  • For the journal, see Growth Factors (journal) . (wikipedia.org)
  • Growth factors are important for regulating a variety of cellular processes. (wikipedia.org)
  • They often promote cell differentiation and maturation, which varies between growth factors. (wikipedia.org)
  • While some cytokines can be growth factors, such as G-CSF and GM-CSF , others have an inhibitory effect on cell growth or proliferation. (wikipedia.org)
  • It is thought that some growth factors are involved in the abnormal regulation of growth seen in cancer when produced in excessive amounts. (encyclopedia.com)
  • Therefore in our view we need to talk about our wood management before any other factor in the maturation of The Macallan. (dictionary.com)
  • Other genetic and environmental factors likely play a role in determining the severity of this condition. (medlineplus.gov)
  • These factors include polysaccharide capsules and M proteins that impede phagocytosis, enzymes that degrade host tissues, and toxins that overstimulate the immune system, causing fever and shock. (britannica.com)
  • Acquired factor X deficiency can be caused by other disorders such as severe liver disease or systemic amyloidosis, a condition involving the accumulation of abnormal proteins called amyloids. (medlineplus.gov)
  • Cell , the flagship journal of Cell Press, remains the number one research journal in the Cell Biology and Biochemistry & Molecular Biology subject categories, with an Impact Factor of 31.152. (elsevier.com)
  • A family of transcription factors (lymphoid enhancer-binding factor (LEF), LEF/TCFs) that are important in the wnt/β-*catenin signalling cascade. (oxfordreference.com)
  • IBM Z MFA works with the RACF Security Server infrastructure to create a layered defense by requiring selected z/OS users to logon with multiple authentication factors. (ibm.com)
  • Researchers suggest that the actual prevalence of factor XI deficiency may be higher than reported, because mild cases of the disorder often do not come to medical attention. (medlineplus.gov)
  • Carotid web may be an underappreciated risk factor for stroke," the researchers say. (medscape.com)
  • In the JAMA study, researchers looked at the survival and mortality rates of 542,008 heart attack patients and discovered that half of patients presented with less than two of the five major risk factors: high-blood pressure, smoking, high cholesterol, a family history, and diabetes. (menshealth.com)
  • In an alarming reveal, researchers found patients who with few or no risk factors had higher rates of death after the first heart attack. (menshealth.com)
  • Inborn deficiency of factor X is very rare (1:1,000,000), and may present with epistaxis (nosebleeds), hemarthrosis (bleeding into joints) and gastrointestinal blood loss. (wikipedia.org)
  • The determination of the Rh (from rhesus) factor in human blood involves reaction with the blood of this monkey, and a rhesus was the first monkey to be rocketed into the stratosphere. (britannica.com)
  • Factor X deficiency commonly causes nosebleeds, easy bruising, bleeding under the skin, bleeding of the gums, blood in the urine (hematuria), and prolonged or excessive bleeding following surgery or trauma. (medlineplus.gov)
  • Reduced quantity or function of coagulation factor X prevents blood from clotting normally, causing episodes of abnormal bleeding that can be severe. (medlineplus.gov)
  • The blood of the remaining 15% lacked the factor and was typed Rh negative. (factmonster.com)
  • People who have a Factor V deficiency are more likely to bleed badly while people with Factor V Leiden have blood that has an increased tendency to clot. (netdoctor.co.uk)
  • The gene for Factor V Leiden can be found in a blood sample . (netdoctor.co.uk)
  • People with Factor V Leiden do not need treatment unless their blood starts to clot, in which case the doctor will prescribe blood-thinning (anticoagulant) medicines, such as warfarin (eg Marevan) or heparin, to prevent further clots. (netdoctor.co.uk)
  • The same applies to women carrying just one gene for Factor V Leiden who have previously had a blood clot themselves or who have a family history of blood clots. (netdoctor.co.uk)
  • The Rhesus factor is what determines whether our blood is classified as positive or negative. (brighthub.com)
  • Each of these blood types is further classified as negative or positive, which is a reference to the blood's Rhesus factor. (brighthub.com)
  • TCF4 (T-cell transcription factor 4, TCF7-like 2) is implicated in blood glucose homeostasis. (oxfordreference.com)
  • Patients who didn't have any of the five major risk factors might have had a different risk factor (like elevated calcium score or insulin resistance and metabolic syndrome) or a risk that was below detection, Dr. Canto explains. (menshealth.com)
  • Founded in 1982, FACTOR has been administering public money since 1986. (wikipedia.org)
  • Inui S, Higashiyama S, Hashimoto K, Higashiyama M, Yoshikawa K, Taniguchi N (1997) Possible role of coexpression of CD9 with membrane-anchored heparin-binding EGF-like growth factor and amphiregulin in cultured human keratinocyte growth. (springer.com)
  • The first crystal structure of human factor Xa was deposited in May 1993. (wikipedia.org)
  • The other major difference is that we support multiple authentication factor types as sub plugins, eg IP Range, Email, TOPT and in future others such as SMS or hardware tokens or anything else as new sub-plugins. (moodle.org)
  • The money factor can be translated into the more common annual percentage rate (APR) by multiplying the money factor by 2,400. (investopedia.com)
  • While the decimal version is more common, a money factor that is a whole number can still be converted to an APR by multiplying it by 2.4. (investopedia.com)
  • Some common macroeconomic factors include credit, inflation, and liquidity whereas style factors embrace style, value, and momentum, just to name a few. (investopedia.com)
  • Factoring is very common in certain industries, such as the clothing industry, where long receivables are part of the business cycle. (entrepreneur.com)
  • The sole general rule is to attempt to group and attempt to discover common factors so to more group and simplify. (google.com)
  • The best common factor of a set of numbers is the greatest factor that is normal to every one of the numbers. (google.com)
  • Diabetes was more common in cases (10 of 53 [19.2%]) than controls (7 of 102 [6.9%]), but there was no difference in prevalence of 3 other atherosclerotic risk factors (hypertension, dyslipidemia, and coronary artery disease). (medscape.com)
  • See our FAQ for answers to common questions about Multi-Factor Authentication at UVM. (uvm.edu)
  • Research suggests that other factors such as smoking, being exposed to chemicals that can cause cancer, and changes in other hormones due to night shift working also may increase breast cancer risk. (cdc.gov)
  • The factoring of biprimes is proposed as a framework for exploring unconstrained optimization algorithms. (microsoft.com)
  • What Are the Risk Factors for Breast Cancer? (cdc.gov)
  • Being a woman and getting older are the main risk factors for breast cancer. (cdc.gov)
  • Studies have shown that your risk for breast cancer is due to a combination of factors. (cdc.gov)
  • The main factors that influence your risk include being a woman and getting older. (cdc.gov)
  • Some women will get breast cancer even without any other risk factors that they know of. (cdc.gov)
  • Having a risk factor does not mean you will get the disease, and not all risk factors have the same effect. (cdc.gov)
  • Most women have some risk factors, but most women do not get breast cancer. (cdc.gov)
  • If you have breast cancer risk factors, talk with your doctor about ways you can lower your risk and about screening for breast cancer. (cdc.gov)
  • These are called risk factors. (cdc.gov)
  • Many risk factors can be changed or modified to help prevent falls. (cdc.gov)
  • Most falls are caused by a combination of risk factors. (cdc.gov)
  • The more risk factors a person has, the greater their chances of falling. (cdc.gov)
  • Healthcare providers can help cut down a person's risk by reducing the fall risk factors listed above. (cdc.gov)
  • Incidence of and risk factors for falls and injurious falls among the community-dwelling elderly. (cdc.gov)
  • From basic information about cancer and its causes to in-depth information on specific cancer types - including risk factors, early detection, diagnosis, and treatment options - you'll find it here. (cancer.org)
  • Some risk factors have a direct role in causing cancer, but in other cases the risk may be due to something else that goes along with the risk factor. (cancer.org)
  • Different cancers have different risk factors. (cancer.org)
  • Some risk factors, such as smoking, can be controlled. (cancer.org)
  • Factor investing, from a theoretical standpoint, is designed to enhance diversification, generate above-market returns and manage risk. (investopedia.com)
  • Rather than look at complex attributes, such as momentum, beginners to factor investing can focus on simpler elements, such as style (growth vs. value), size (large cap vs. small cap), and risk (beta). (investopedia.com)
  • Women with factor X deficiency can have heavy or prolonged menstrual bleeding (menorrhagia) or excessive bleeding in childbirth, and may be at increased risk of pregnancy loss (miscarriage). (medlineplus.gov)
  • Only women who are Rh-negative are at risk for giving birth to a child with Rhesus factor disease. (brighthub.com)
  • A recent study investigates a new risk factor for mouth cancer. (medicalnewstoday.com)
  • Although scientists have confirmed some risk factors, there is still much to learn about how and why mouth cancer affects certain individuals and not others. (medicalnewstoday.com)
  • Recently, scientists set out to investigate another potential risk factor: air pollution. (medicalnewstoday.com)
  • After taking a range of influencing factors into account, the scientists demonstrated that exposure to PM2.5 also increased mouth cancer risk. (medicalnewstoday.com)
  • You're probably wondering why obesity wasn't considered a risk factor. (menshealth.com)
  • If you have any risk factors for heart disease, make sure to get them under control. (menshealth.com)
  • See the new Intel® SSD form factor that's in perfect harmony with the data center and brings a new standard of drive capacity, scalability, and operational efficiency while being free from legacy drive constraints. (intel.com)
  • A payment device, method, and apparatus configured to determine the form factor of the payment device used in a financial transaction, without requiring a different primary account number for each payment device form factor. (freepatentsonline.com)
  • and a device indicator configured to indicate a form factor of the payment device. (freepatentsonline.com)
  • and either transmitting the form factor indicator to a payment processor or storing the form factor indicator in a form factor log database. (freepatentsonline.com)
  • a data processor configured to either transmit the form factor indicator to a payment processor via a network interface or to store the form factor indicator in a form factor log database. (freepatentsonline.com)
  • The human factor X gene is located on chromosome 13 (13q34). (wikipedia.org)
  • Here are some tips to help you successfully navigate the unforeseen human factor that all too-often comes into play when trying to make and close a deal. (thenextweb.com)
  • Who is IBM Z Multi-Factor Authentication for? (ibm.com)
  • How does IBM Z Multi-Factor Authentication work with RACF? (ibm.com)
  • What additional factors does IBM Z Multi-Factor Authentication work with? (ibm.com)
  • What are the system requirements for IBM Z Multi-Factor Authentication? (ibm.com)
  • What is multi-factor authentication (MFA) or 2FA? (ibm.com)
  • Duo Security is a multi-factor authentication tool used by the University of Vermont to protect sensitive information. (uvm.edu)
  • At this point you should be able to use Duo to access multi-factor protected services. (uvm.edu)
  • A treatment main effect can be interpreted independently of its interactions with other factors only if the others are random factors. (soton.ac.uk)
  • A fully replicated design with two cross factors can have eight alternative outcomes in terms of the significance of its main effects and interactions. (soton.ac.uk)
  • Factor 75 enter their meals into apps such as MyFitnessPal and Carb Manager, which may make it easy for customers to track their nutrient intake. (medicalnewstoday.com)
  • In this course, join Frank Moley as he walks through the twelve factors that go into building agile, highly-scalable, and resilient web apps. (lynda.com)
  • The Two Factor authentication wizard will show a Wiki link with the OTP Apps Zimbra recommends to use. (zimbra.com)