A division of GYMNOSPERMS which look like palm trees (ARECACEAE) but are more closely related to PINUS. They have large cones and large pinnate leaves and are sometimes called cycads, a term which may also refer more narrowly to cycadales or CYCAS.
A plant family of the order Pinales, class Pinopsida, division Coniferophyta (conifers). They are mainly resinous, aromatic evergreen trees.
Seedless nonflowering plants of the class Filicinae. They reproduce by spores that appear as dots on the underside of feathery fronds. In earlier classifications the Pteridophyta included the club mosses, horsetails, ferns, and various fossil groups. In more recent classifications, pteridophytes and spermatophytes (seed-bearing plants) are classified in the Subkingdom Tracheobionta (also known as Tracheophyta).
Gymnosperms are a group of vascular plants whose seeds are not enclosed by a ripened ovary (fruit), in contrast to ANGIOSPERMS whose seeds are surrounded by an ovary wall. The seeds of many gymnosperms (literally, "naked seed") are borne in cones and are not visible. Taxonomists now recognize four distinct divisions of extant gymnospermous plants (CONIFEROPHYTA; CYCADOPHYTA; GINKGOPHYTA; and GNETOPHYTA).
Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)
A plant division. They are simple plants that lack vascular tissue and possess rudimentary rootlike organs (rhizoids). Like MOSSES, liverworts have alternation of generations between haploid gamete-bearing forms (gametophytes) and diploid spore-bearing forms (sporophytes).
The act of feeding on plants by animals.

In vivo expression of the nucleolar group I intron-encoded I-dirI homing endonuclease involves the removal of a spliceosomal intron. (1/10320)

The Didymium iridis DiSSU1 intron is located in the nuclear SSU rDNA and has an unusual twin-ribozyme organization. One of the ribozymes (DiGIR2) catalyses intron excision and exon ligation. The other ribozyme (DiGIR1), which along with the endonuclease-encoding I-DirI open reading frame (ORF) is inserted in DiGIR2, carries out hydrolysis at internal processing sites (IPS1 and IPS2) located at its 3' end. Examination of the in vivo expression of DiSSU1 shows that after excision, DiSSU1 is matured further into the I-DirI mRNA by internal DiGIR1-catalysed cleavage upstream of the ORF 5' end, as well as truncation and polyadenylation downstream of the ORF 3' end. A spliceosomal intron, the first to be reported within a group I intron and the rDNA, is removed before the I-DirI mRNA associates with the polysomes. Taken together, our results imply that DiSSU1 uses a unique combination of intron-supplied ribozyme activity and adaptation to the general RNA polymerase II pathway of mRNA expression to allow a protein to be produced from the RNA polymerase I-transcribed rDNA.  (+info)

p53 represses ribosomal gene transcription. (2/10320)

Induction of the tumor suppressor protein p53 restricts cellular proliferation. Since actively growing cells require the ongoing synthesis of ribosomal RNA to sustain cellular biosynthesis, we studied the effect of p53 on ribosomal gene transcription by RNA polymerase I (Pol I). We have measured rDNA transcriptional activity in different cell lines which either lack or overexpress p53 and demonstrate that wild-type but not mutant p53 inhibits cellular pre-rRNA synthesis. Conversely, pre-rRNA levels are elevated both in cells which express mutant p53 and in fibroblasts from p53 knock-out mice. Transient transfection assays with a set of rDNA deletion mutants demonstrate that intergenic spacer sequences are dispensable and the minimal rDNA promoter is sufficient for p53-mediated repression of Pol I transcription. However, in a cell-free transcription system, recombinant p53 does not inhibit rDNA transcription, indicating that p53 does not directly interfere with the basal Pol I transcriptional machinery. Thus, repression of Pol I transcription by p53 may be a consequence of p53-induced growth arrest.  (+info)

A new rapidly growing mycobacterial species, Mycobacterium murale sp. nov., isolated from the indoor walls of a children's day care centre. (3/10320)

Scotochromogenic mycobacterial isolates from water-damaged parts of indoor building materials of a children's day care centre represented a phenetically and genetically distinct group of strains. A 16S rDNA dendrogram (1243 bp) showed that the closest species to the new strain MA112/96T was Mycobacterium abscessus. Phylogenetic and phenetic analyses (100 characteristics) grouped the new isolates with M. abscessus, Mycobacterium vaccae, Mycobacterium aurum and Mycobacterium austroafricanum. Ribotyping with Pvull restriction distinguished the 5 isolates from the other 12 most closely related species by the major bands at 6.5-7 kb and 13-15 kb. The cell morphology of the new isolates was typical of mycobacteria, electron microscopy revealed a triple-layered cell wall with an irregular electron-dense outer layer. They grew at 10-37 degrees C, with no growth at 45 degrees C in 5 d. The gene encoding the secreted 32 kDa protein, specific to mycobacteria, was detected by PCR. The main whole-cell fatty acids were characterized by high tuberculostearic acid 10Me-C18:0 (17% at 28 degrees C), which increased with increasing growth temperature (22% at 37 degrees C). The other main fatty acids were C18:1 cis9 and C16:0 (21-20% each), followed by, C17:1 cis9 (14%), C16:1 cis10 (8%) and also a high amount of C20 alcohol (9%). alpha-Mycolic acids, keto-mycolates and wax esters were present (C60-C90), MK-9(H2) (90%) and MK-8(H2) were the main menaquinones. The cellular phospholipids were phosphatidylethanolamine, phosphatidylinositol, phosphatidyl inositolmannosides and diphosphatidylglycerol. Polyamine content was low. G+C content was 72.9 mol%. The new isolates are proposed as a new species, Mycobacterium murale sp. nov. The type strain is MA112/96T (= DSM 44340T).  (+info)

Treponema brennaborense sp. nov., a novel spirochaete isolated from a dairy cow suffering from digital dermatitis. (4/10320)

A novel Treponema species was isolated from an ulcerative lesion of a cow suffering from digital dermatitis (DD), a disease which causes painful ulcerations along the coronary band. Among other anaerobic bacteria, high numbers of spirochaetes have been regularly found in DD lesions. Here data are presented of a spirochaete isolated from a DD ulcer. By chemotaxonomy, protein analysis and comparative 16S rDNA sequence analysis this isolate was classified as a treponeme that differed from all Treponema species described previously. The only isolate, DD5/3T, for which the name Treponema brennaborense is proposed, is designated the type strain of the novel species. The strain is a small, highly motile spirochaete that has two periplasmic flagella, one flagellum being attached at each cell pole. Strain DD5/3T exhibits alpha-glucosidase and N-acetyl-beta-glucosaminidase activity and growth is inhibited by rabbit serum. T. brennaborense was phylogenetically most closely related (89.5% 16S rRNA similarity) to Treponema maltophilum, an oral spirochaete isolated from a periodontitis patient.  (+info)

RFLP of rRNA genes and sequencing of the 16S-23S rDNA intergenic spacer region of ammonia-oxidizing bacteria: a phylogenetic approach. (5/10320)

It has been established that 16S rRNA gene-based phylogeny gives a low resolution between members of the chemoautotrophic ammonia-oxidizing bacteria (AOB) belonging to the beta-subclass of the Proteobacteria. In this study, 12 isolates of AOB were ribotyped, and the sequences of the 16S-23S rDNA intergenic spacer region (ISR) were determined and used in a phylogenetic study. 16S and 23S rDNA ribotyping revealed that the AOB studied contain only one rrn operon per genome, in contrast to most bacteria, which have 5-10 copies of the rRNA genes per genome. It is likely that the presence of only one set of rRNA genes is related to the slow growth of the AOB. The 16S and 23S rRNA genes of the AOB were shown to be arranged in the classical way: a 16S rRNA gene, an ISR and a 23S rRNA gene. Despite the close phylogenetic relationship among the AOB, the relative location of the rRNA genes in the genome appears to vary considerably. The size of the ISR was approximately 400 bp in the Nitrosomonas isolates and 645-694 bp in the Nitrosospira isolates, suggesting a species-specific size difference in the ISR. The ISR contained two potential tRNA genes in the 5' end in all isolates studied. The similarity values between the ISR sequences of the AOB are low (42.9-96.2%) compared with the 16S rDNA sequence similarity values, and therefore the ISR sequences are valuable as a complementary phylogenetic tool in combination with 16S rRNA gene sequences. The phylogenetic analysis of the AOB based on ISR sequences confirms the 16S rRNA gene-based phylogeny but has the benefit of giving a higher resolution.  (+info)

New genus-specific primers for the PCR identification of members of the genera Pseudonocardia and Saccharopolyspora. (6/10320)

Members of the family Pseudonocardiaceae are difficult to identify on the basis of their micromorphology only. The biochemical characterization of each new isolate is a painstaking and time-consuming task which cannot always be undertaken when handling large numbers of strains as is the case in natural product screening programmes. In this study, two sets of genus-specific oligonucleotides were designed which allow rapid detection of members of the genera Pseudonocardia and Saccharopolyspora by means of PCR-specific amplification. The genus specificity of these primers was validated on a wide range of collection strains and the primers were subsequently used to study a group of 106 wild-type isolates that possessed morphological characteristics of the family. Out of this group, 51 strains could be identified as members of the genus Pseudonocardia and only nine isolates could be assigned to the genus Saccharopolyspora. The diversity indicated by whole-cell fatty acid profiles of both wild-type and reference strains was compared with that identified using the oligonucleotide primers. The partial 16S rDNA sequencing of representative wild-type strains was used to validate their genus assignment by PCR-specific amplification. This study shows the industrial usefulness of the application of these direct identification tools as well as the complementary use of two sources of data, PCR-specific amplification results and fatty acid composition, to assess the diversity of a microbial population.  (+info)

Reclassification of Brevibacterium oxydans (Chatelain and Second 1966) as Microbacterium oxydans comb. nov. (7/10320)

Phylogenetic and chemotaxonomic analyses indicate that Brevibacterium oxydans is closely related to species of the genus Microbacterium, namely Microbacterium liquefaciens, Microbacterium luteolum and Microbacterium saperdae. DNA-DNA reassociation values of less than 60% between Brevibacterium oxydans and these three Microbacterium species support the distinctness of this misclassified Brevibacterium species, which is reclassified as Microbacterium oxydans comb. nov.  (+info)

Reclassification of Brevibacterium incertum (Breed 1953) as Desemzia incerta gen. nov., comb. nov. (8/10320)

Phylogenetic analysis of 16S rDNA indicates that Brevibacterium incertum is not a member of the genus Brevibacterium but related to species of the genus Carnobacterium. Hence, Brevibacterium incertum is not a member of the class Actinobacteria but belongs to the phylogenetically defined broad Bacillus-Lactobacillus cluster. Based upon properties that taxonomically clearly distinguishes Brevibacterium incertum from species of the phylogenetic sister genus Carnobacterium, Brevibacterium incertum is reclassified as Desemzia incerta gen. nov., comb. nov.  (+info)

Cycadophyta, also known as cycads, is a division of plants that includes several species of mostly tropical and subtropical gymnosperms. These plants are characterized by a large crown of compound leaves, a stout trunk often undergrown by other plants, and a cone-like reproductive structure. Cycads are considered to be living fossils because they have remained relatively unchanged for millions of years and are thought to resemble some of the earliest seed plants. They are found in scattered locations around the world, particularly in the Americas, Africa, Asia, and the Pacific Islands. Some cycad species are endangered due to habitat loss and overcollection for ornamental purposes.

Cupressaceae is a family of coniferous plants, also known as the cypress family. It includes a variety of genera such as *Cupressus* (cypress), *Juniperus* (juniper), *Thuja* (arborvitae or cedar), and *Chamaecyparis* (false cypress or Port Orford cedar). These plants are characterized by their small, scale-like leaves, and many produce cones that contain seeds. Some species in this family have economic importance as timber, ornamental plants, or for their essential oils.

Ferns are a group of vascular plants that reproduce by means of spores rather than seeds. They are characterized by their frond-like leaves and lack of flowers or fruits. Ferns have been around for millions of years, with some fossilized ferns dating back to the Devonian period, over 360 million years ago.

Ferns are an important part of many ecosystems, particularly in tropical rainforests where they provide habitat and food for a variety of animals. They also play a role in soil erosion control and nutrient cycling.

Medically, some ferns have been used in traditional medicine to treat various ailments, such as bracken fern which has been used to treat wounds, burns, and skin diseases. However, it is important to note that not all ferns are safe for consumption or use as medicines, and some can be toxic if ingested or applied topically. It is always recommended to consult with a healthcare professional before using any plant-based remedies.

Gymnosperms are a group of seed-producing plants that include conifers, cycads, Ginkgo, and gnetophytes. The name "gymnosperm" comes from the Greek words "gymnos," meaning naked, and "sperma," meaning seed. This refers to the fact that the seeds of gymnosperms are not enclosed within an ovary or fruit, but are exposed on the surface of modified leaves called cones or strobili.

Gymnosperms are vascular plants, which means they have specialized tissues for transporting water and nutrients throughout the plant. They are also heterosporous, meaning that they produce two types of spores: male microspores and female megaspores. The microspores develop into male gametophytes, which produce sperm cells, while the megaspores develop into female gametophytes, which produce egg cells.

Gymnosperms are an important group of plants that have been around for millions of years. They are adapted to a wide range of environments, from temperate forests to deserts and high mountain ranges. Many gymnosperms are evergreen, with needle-like or scale-like leaves that are able to resist drought and cold temperatures.

Conifers, which include trees such as pines, firs, spruces, and redwoods, are the most diverse and widespread group of gymnosperms. They are characterized by their woody cones and needle-shaped leaves. Cycads are another group of gymnosperms that are found in tropical and subtropical regions. They have large, stiff leaves and produce large seeds that are enclosed in a fleshy covering. Ginkgo is a unique gymnosperm that has been around for over 200 million years. It is a deciduous tree with fan-shaped leaves and large, naked seeds.

Gnetophytes are a small group of gymnosperms that include the ephedra, welwitschia, and gnetum. They have unique features such as vessels in their wood and motile sperm cells, which are not found in other gymnosperms.

Overall, gymnosperms are an important group of plants that have adapted to a wide range of environments and play a crucial role in many ecosystems.

I believe there may be a slight misunderstanding in your question. "Plant leaves" are not a medical term, but rather a general biological term referring to a specific organ found in plants.

Leaves are organs that are typically flat and broad, and they are the primary site of photosynthesis in most plants. They are usually green due to the presence of chlorophyll, which is essential for capturing sunlight and converting it into chemical energy through photosynthesis.

While leaves do not have a direct medical definition, understanding their structure and function can be important in various medical fields, such as pharmacognosy (the study of medicinal plants) or environmental health. For example, certain plant leaves may contain bioactive compounds that have therapeutic potential, while others may produce allergens or toxins that can impact human health.

I'm sorry for any confusion, but "Hepatophyta" is not a valid medical or scientific term in modern usage. It appears to be a combination of the Greek word "hepar" meaning "liver" and the suffix "-phyta" which is used to denote a plant or group of plants in taxonomy. However, it is not a term that is recognized or used in modern biology or medicine.

It's possible that you may be thinking of "Hepatica," which is a genus of flowering plants in the family Ranunculaceae. These plants are also known as liverworts, although they should not be confused with actual liverworts, which are non-vascular plants in the division Marchantiophyta.

If you have any further questions or if there is another term you would like me to define, please let me know!

Herbivory is not a medical term, but rather a term used in biology and ecology. It refers to the practice of consuming plants or plant matter for food. Herbivores are animals that eat only plants, and their diet can include leaves, stems, roots, flowers, fruits, seeds, and other parts of plants.

While herbivory is not a medical term, it is still relevant to the field of medicine in certain contexts. For example, understanding the diets and behaviors of herbivores can help inform public health initiatives related to food safety and disease transmission. Additionally, research on herbivory has contributed to our understanding of the evolution of plant-animal interactions and the development of ecosystems.

... (rDNA) is a DNA sequence that codes for ribosomal RNA. These sequences regulate transcription initiation and ... Various types of cancers can also be born from mutations of the tandem repeats in the ribosomal DNA. Cell lines can become ... Keil RL, Roeder GS (December 1984). "Cis-acting, recombination-stimulating activity in a fragment of the ribosomal DNA of S. ... Weisburg WG, Barns SM, Pelletier DA, Lane DJ (January 1991). "16S ribosomal DNA amplification for phylogenetic study". Journal ...
Amplified rDNA (Ribosomal DNA) Restriction Analysis is the extension of the technique of RFLP (restriction fragment length ... Identification of Acinetobacter Genomic Species by Amplified Ribosomal DNA Restriction Analysis. J. Clin. Microbiol. 33:11-15. ... Overnight digestion (10-16 hours) of about 300-500 ng of amplicon DNA in a 20 μL system with 4-5 units of Restriction Enzyme ... of more than 4 bp would be irrelevant with respect to a gene of approximately 1500 bp such as that coding for the 16s ribosomal ...
The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1". DNA Res ... 39S ribosomal protein L19, mitochondrial is a protein that in humans is encoded by the MRPL19 gene. Mammalian mitochondrial ... "Entrez Gene: MRPL19 mitochondrial ribosomal protein L19". Nagase T, Miyajima N, Tanaka A, et al. (1995). "Prediction of the ... Graack HR, Bryant ML, O'Brien TW (2000). "Identification of mammalian mitochondrial ribosomal proteins (MRPs) by N-terminal ...
DNA Cell Biol. 15 (12): 1009-1023. doi:10.1089/dna.1996.15.1009. PMID 8985115. Daidone MG, Silvestrini R, Benini E, Grigioni WF ... 40S ribosomal protein SA is a ribosomal protein that in humans is encoded by the RPSA gene. It also acts as a cell surface ... i) Yeast two-hybrid screens have shown that RPSA binds to Ribosomal protein S21 of the 40S small ribosomal subunit. (ii) Serial ... "A region in the C-terminal domain of ribosomal protein SA required for binding of SA to the human 40S ribosomal subunit". ...
DNA Cell Biol. 17 (7): 591-602. doi:10.1089/dna.1998.17.591. PMID 9703018. Lalli E, Ohe K, Hindelang C, Sassone-Corsi P (2000 ... "Entrez Gene: RPL7A ribosomal protein L7a". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 60S ribosomal protein L7a is a protein that in humans is encoded by the RPL7A gene. Cytoplasmic ribosomes, organelles that ... This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L7AE family of ...
"Primers, 16S ribosomal DNA - François Lutzoni's Lab". lutzonilab.net. Archived from the original on 2012-12-27. Eden PA, ... Weisburg WG, Barns SM, Pelletier DA, Lane DJ (January 1991). "16S ribosomal DNA amplification for phylogenetic study". Journal ... Kolbert CP, Persing DH (June 1999). "Ribosomal DNA sequencing as a tool for identification of bacterial pathogens". Current ... Like the large (23S) ribosomal RNA, it has a structural role, acting as a scaffold defining the positions of the ribosomal ...
"The DNA sequence of human chromosome 22". Nature. 402 (6761): 489-95. Bibcode:1999Natur.402..489D. doi:10.1038/990031. PMID ... "Entrez Gene: RPL3 ribosomal protein L3". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 60S ribosomal protein L3 is a protein that in humans is encoded by the RPL3 gene. Ribosomes, the complexes that catalyze ... The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV ...
"Entrez Gene: MRPL18 mitochondrial ribosomal protein L18". Hartley JL, Temple GF, Brasch MA (2001). "DNA cloning using in vitro ... 39S ribosomal protein L18, mitochondrial is a protein that in humans is encoded by the MRPL18 gene. Mammalian mitochondrial ... This gene encodes a 39S subunit protein that belongs to the L18P ribosomal protein family. Three polymorphic sites exist in ... Analysis of the complement of ribosomal proteins present". J Biol Chem. 276 (47): 43958-69. doi:10.1074/jbc.M106510200. PMID ...
RPS3A has been shown to interact with DNA damage-inducible transcript 3. GRCh38: Ensembl release 89: ENSG00000145425 - Ensembl ... 40S ribosomal protein S3a is a protein that in humans is encoded by the RPS3A gene. Ribosomes, the organelles that catalyze ... "Entrez Gene: RPS3A ribosomal protein S3A". Cui, K; Coutts M; Stahl J; Sytkowski A J (March 2000). "Novel interaction between ... This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ...
2003). "Human chromosome 7: DNA sequence and biology". Science. 300 (5620): 767-72. Bibcode:2003Sci...300..767S. doi:10.1126/ ... 39S ribosomal protein L32, mitochondrial is a protein that in humans is encoded by the MRPL32 gene. Mammalian mitochondrial ... This gene encodes a 39S subunit protein that belongs to the L32 ribosomal protein family. A pseudogene corresponding to this ... Analysis of the complement of ribosomal proteins present". J. Biol. Chem. 276 (47): 43958-69. doi:10.1074/jbc.M106510200. PMID ...
2003). "Human chromosome 7: DNA sequence and biology". Science. 300 (5620): 767-72. Bibcode:2003Sci...300..767S. doi:10.1126/ ... "Entrez Gene: RPL21 ribosomal protein L21". Zhou C, Zang D, Jin Y, et al. (March 2011). "Mutation in ribosomal protein L21 ... 60S ribosomal protein L21 is a protein that in humans is encoded by the RPL21 gene. Ribosomes, the organelles that catalyze ... This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L21E family of ...
Hartley JL, Temple GF, Brasch MA (November 2000). "DNA cloning using in vitro site-specific recombination". Genome Research. 10 ... 60S ribosomal protein L10-like is a protein that in humans is encoded by the RPL10L gene. This gene encodes a protein sharing ... "Entrez Gene: RPL10L ribosomal protein L10-like". Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, ... Overview of all the structural information available in the PDB for UniProt: Q96L21 (Human 60S ribosomal protein L10-like) at ...
Hartley JL, Temple GF, Brasch MA (2001). "DNA cloning using in vitro site-specific recombination". Genome Res. 10 (11): 1788-95 ... 60S ribosomal protein L36 is a protein that in humans is encoded by the RPL36 gene. Ribosomes, the organelles that catalyze ... "Entrez Gene: RPL36 ribosomal protein L36". Overview of all the structural information available in the PDB for UniProt: Q9Y3U8 ... This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L36E family of ...
Hartley JL, Temple GF, Brasch MA (2001). "DNA Cloning Using In Vitro Site-Specific Recombination". Genome Res. 10 (11): 1788-95 ... 39S ribosomal protein L15, mitochondrial is a protein that in humans is encoded by the MRPL15 gene. Mammalian mitochondrial ... This gene encodes a 39S subunit protein that belongs to the EcoL15 ribosomal protein family. A pseudogene corresponding to this ... 2000). "Mammalian mitochondrial ribosomal proteins (2). Amino acid sequencing, characterization, and identification of ...
Hartley JL, Temple GF, Brasch MA (2001). "DNA Cloning Using In Vitro Site-Specific Recombination". Genome Res. 10 (11): 1788-95 ... 60S ribosomal protein L10 is a protein that in humans is encoded by the RPL10 gene. Ribosomes, the organelles that catalyze ... "Entrez Gene: RPL10 ribosomal protein L10". Oh HS, Kwon H, Sun SK, Yang CH (September 2002). "QM, a putative tumor suppressor, ... Kenmochi N, Kawaguchi T, Rozen S, Davis E, Goodman N, Hudson TJ, Tanaka T, Page DC (Aug 1998). "A map of 75 human ribosomal ...
Hartley JL, Temple GF, Brasch MA (2001). "DNA Cloning Using In Vitro Site-Specific Recombination". Genome Res. 10 (11): 1788-95 ... "Entrez Gene: RPS24 ribosomal protein S24". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 40S ribosomal protein S24 is a protein that in humans is encoded by the RPS24 gene. Ribosomes, the organelles that catalyze ... Kenmochi N, Kawaguchi T, Rozen S, Davis E, Goodman N, Hudson TJ, Tanaka T, Page DC (Aug 1998). "A map of 75 human ribosomal ...
2004). "DNA sequence and analysis of human chromosome 9". Nature. 429 (6990): 369-74. Bibcode:2004Natur.429..369H. doi:10.1038/ ... 39S ribosomal protein L41, mitochondrial is a protein that in humans is encoded by the MRPL41 gene. Mammalian mitochondrial ... 2005). "Mitochondrial ribosomal protein L41 suppresses cell growth in association with p53 and p27Kip1". Mol. Cell. Biol. 25 ( ... 2006). "Mitochondrial ribosomal protein L41 mediates serum starvation-induced cell-cycle arrest through an increase of p21(WAF1 ...
2004). "DNA sequence and analysis of human chromosome 9". Nature. 429 (6990): 369-74. Bibcode:2004Natur.429..369H. doi:10.1038/ ... 60S ribosomal protein L35 is a protein that in humans is encoded by the RPL35 gene. Ribosomes, the organelles that catalyze ... "Entrez Gene: RPL35 ribosomal protein L35". Human RPL35 genome location and RPL35 gene details page in the UCSC Genome Browser. ... This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ...
2005). "The DNA sequence of the human X chromosome". Nature. 434 (7031): 325-37. Bibcode:2005Natur.434..325R. doi:10.1038/ ... "Entrez Gene: RPL36A ribosomal protein L36a". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... Although this gene has been referred to as ribosomal protein L44 (RPL44), its official name is ribosomal protein L36a (RPL36A ... The protein, which shares sequence similarity with yeast ribosomal protein L44, belongs to the L44E (L36AE) family of ribosomal ...
Cross SH, Charlton JA, Nan X, Bird AP (1994). "Purification of CpG islands using a methylated DNA binding column". Nat. Genet. ... "Entrez Gene: RPL24 ribosomal protein L24". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... its official name is ribosomal protein L24. As is typical for genes encoding ribosomal proteins, there are multiple processed ... 60S ribosomal protein L24 is a protein that in humans is encoded by the RPL24 gene. Ribosomes, the organelles that catalyze ...
2004). "The DNA sequence and biology of human chromosome 19". Nature. 428 (6982): 529-35. Bibcode:2004Natur.428..529G. doi: ... "Entrez Gene: RPL18A ribosomal protein L18a". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 60S ribosomal protein L18a is a protein that in humans is encoded by the RPL18A gene. Ribosomes, the organelles that catalyze ... Kenmochi N, Kawaguchi T, Rozen S, Davis E, Goodman N, Hudson TJ, Tanaka T, Page DC (Aug 1998). "A map of 75 human ribosomal ...
2003). "The DNA sequence and analysis of human chromosome 6". Nature. 425 (6960): 805-11. Bibcode:2003Natur.425..805M. doi: ... "Entrez Gene: RPL10A ribosomal protein L10a". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... ribosomal protein 10a). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this ... 60S ribosomal protein L10a is a protein that in humans is encoded by the RPL10A gene. Ribosomes, the organelles that catalyze ...
Cross SH, Charlton JA, Nan X, Bird AP (March 1994). "Purification of CpG islands using a methylated DNA binding column". Nature ... "Entrez Gene: RPL32 ribosomal protein L32". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 60S ribosomal protein L32 is a protein that in humans is encoded by the RPL32 gene. Ribosomes, the organelles that catalyze ... This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ...
2005). "Myc represses transcription through recruitment of DNA methyltransferase corepressor". EMBO J. 24 (2): 336-46. doi: ... "Entrez Gene: RPS8 ribosomal protein S8". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 40S ribosomal protein S8 is a protein that in humans is encoded by the RPS8 gene. Ribosomes, the organelles that catalyze ... 1991). "Ribosomal protein genes are overexpressed in colorectal cancer: isolation of a cDNA clone encoding the human S3 ...
2003). "The DNA sequence and analysis of human chromosome 6". Nature. 425 (6960): 805-11. Bibcode:2003Natur.425..805M. doi: ... "Entrez Gene: RPS18 ribosomal protein S18". Wool IG, Chan YL, Glück A (1996). "Structure and evolution of mammalian ribosomal ... 40S ribosomal protein S18 is a protein that in humans is encoded by the RPS18 gene. Ribosomes, the organelles that catalyze ... The protein belongs to the S13P family of ribosomal proteins. It is located in the cytoplasm. The gene product of the E. coli ...
Cross SH, Charlton JA, Nan X, Bird AP (1994). "Purification of CpG islands using a methylated DNA binding column". Nat. Genet. ... 60S ribosomal protein L40 (RPL40) is a protein that in humans is encoded by the UBA52 gene. Ubiquitin is a highly conserved ... This gene encodes a fusion protein consisting of ubiquitin at the N-terminus and ribosomal protein L40 at the C-terminus, a C- ... 2002). "The human ribosomal protein genes: sequencing and comparative analysis of 73 genes". Genome Res. 12 (3): 379-90. doi: ...
https://www.sciencedirect.com/science/article/pii/S1876162323000330) Keywords: DNA replication; DNA replication stress; Genome ... Ribosomal protein; p53; MDM2; p14-ARF Abdol-Hossein Rezaeian, Hiroyuki Inuzuka, Wenyi Wei, Chapter Six - Insights into the ... Chromatin regulators in DNA replication and genome stability maintenance during S-phase, Editor(s): Rossen Donev, Advances in ... Ribosomal protein inhibiting CDKs; Therapeutics Ashna Gupta, Gunjan Dagar, Ravi Chauhan, Hana Q. Sadida, Sara K. Almarzooqi, ...
2006). "The DNA sequence and biological annotation of human chromosome 1". Nature. 441 (7091): 315-21. Bibcode:2006Natur.441.. ... 39S ribosomal protein L24, mitochondrial is a protein that in humans is encoded by the MRPL24 gene. Mammalian mitochondrial ... "Entrez Gene: MRPL24 mitochondrial ribosomal protein L24". Maruyama K, Sugano S (1994). "Oligo-capping: a simple method to ... 2000). "Mammalian mitochondrial ribosomal proteins (4). Amino acid sequencing, characterization, and identification of ...
"Entrez Gene: MRPL37 mitochondrial ribosomal protein L37". Gregory SG, Barlow KF, McLay KE, et al. (2006). "The DNA sequence and ... 39S ribosomal protein L37, mitochondrial is a protein that in humans is encoded by the MRPL37 gene. Mammalian mitochondrial ... Overview of all the structural information available in the PDB for UniProt: Q9BZE1 (39S ribosomal protein L37, mitochondrial) ... Graack HR, Bryant ML, O'Brien TW (Jan 2000). "Identification of mammalian mitochondrial ribosomal proteins (MRPs) by N-terminal ...
2006). "The DNA sequence and biological annotation of human chromosome 1". Nature. 441 (7091): 315-21. Bibcode:2006Natur.441.. ... 39S ribosomal protein L20, mitochondrial is a protein that in humans is encoded by the MRPL20 gene. Mammalian mitochondrial ... "Entrez Gene: MRPL20 mitochondrial ribosomal protein L20". Venter JC, Adams MD, Myers EW, et al. (2001). "The sequence of the ... Analysis of the complement of ribosomal proteins present". J. Biol. Chem. 276 (47): 43958-69. doi:10.1074/jbc.M106510200. PMID ...
Ribosomal DNA (rDNA) is a DNA sequence that codes for ribosomal RNA. These sequences regulate transcription initiation and ... Various types of cancers can also be born from mutations of the tandem repeats in the ribosomal DNA. Cell lines can become ... Keil RL, Roeder GS (December 1984). "Cis-acting, recombination-stimulating activity in a fragment of the ribosomal DNA of S. ... Weisburg WG, Barns SM, Pelletier DA, Lane DJ (January 1991). "16S ribosomal DNA amplification for phylogenetic study". Journal ...
Antibodies / Assay Kits / Biology Cells / cDNA / Clia Kits / Culture Cells / Devices / DNA / DNA Templates / DNA Testing / ... Copyright © 2024 Primers, 16s Ribosomal DNA - François Lutzonis Lab - OnePress theme by FameThemes ...
... Publication , Journal ... Wilson, K. H. "Detection of culture-resistant bacterial pathogens by amplification and sequencing of ribosomal DNA." Clin ... Wilson, K. H. "Detection of culture-resistant bacterial pathogens by amplification and sequencing of ribosomal DNA." Clin ... Wilson, K. H. (1994). Detection of culture-resistant bacterial pathogens by amplification and sequencing of ribosomal DNA. Clin ...
It is therefore assumed that HG12 is the first mammalian homolog of yeast ribosomal protein YL41. Transcription of DNA ... Characterization by cDNA cloning of the mRNA of a highly basic human protein homologous to the yeast ribosomal protein YL41 ... was also observed for yeast ribosomal protein YL41. Southern analysis revealed that HG12 is not specified by a single copy gene ... which was identical in 22 residues with yeast ribosomal protein YL41. ...
... which suggests intense evolutionary dynamics of this repetitive DNA family and highlights rapid chromosomal evolution in these ... Chromosomal regions enriched in repetitive DNA sequences have a predisposition to instability, resulting in a propensity to ... Cytogenetics of warrior wasps (Vespidae: Synoeca) reveals intense evolutionary dynamics of ribosomal DNA clusters and an ... Cytogenetics of warrior wasps (Vespidae: Synoeca) reveals intense evolutionary dynamics of ribosomal DNA clusters and an ...
DNA Res, 2001 Aug 31. PMID 11572479 GeneRIFs: Gene References Into Functions Whats a GeneRIF? Submit: New GeneRIF Correction ... 16S ribosomal RNA methyltransferase A. Locus tag. STK_RS02610. Gene type. protein coding. Organism. Sulfurisphaera tokodaii str ... STK_RS02610 16S ribosomal RNA methyltransferase A [ Sulfurisphaera tokodaii str. 7 ] Gene ID: 1458393, updated on 10-Mar-2023 ... WP_010978429.1 16S ribosomal RNA methyltransferase A [Sulfurisphaera tokodaii]. See identical proteins and their annotated ...
Two primer pairs, one for amplification of D1/D2- 26Sr DNA and another for the ITS1 region were used in PCR. The PCR products ... "A New Isolate Of The Genus Malassezia Based On The Sequence Analysis Of 26S And ITS1 In Ribosomal DNA". Cell Journal (Yakhteh) ... A New Isolate Of The Genus Malassezia Based On The Sequence Analysis Of 26S And ITS1 In Ribosomal DNA. ... A New Isolate Of The Genus Malassezia Based On The Sequence Analysis Of 26S And ITS1 In Ribosomal DNA. Cell Journal (Yakhteh), ...
DNA, RNA, cDNA, mRNA, tRNA, or rDNA (Note: c, complementary; m, messenger; t, transfer; r, ribosomal) ... RNA, DNA, cDNA, mRNA, tRNA, or rDNA (Note: c, complementary; m, messenger; t, transfer; r, ribosomal) ... DNA, RT-PCR). For the purposes of this section, "abbreviation" will refer to all of these. ...
Sequence analysis of the ribosomal DNA intergenic spacer 1 regions of Trichosporon species. J Clin Microbiol 2002;40:1826-1830. ... Dermatophyte primers (amplify the ribosomal ITS region of dermatophytes). Trichophyton species DNA is amplified very poorly by ... This tool assumes that fungal DNA already exists; it does not describe the procedure for purification of fungal DNA. ... D1-D2 region of large ribosomal subunit. Although the ITS primers are universal for fungi, the D1D2 region of the large ...
The early history of modern birds inferred from DNA sequences of nuclear and mitochondrial ribosomal genes. / Tuinen, Marcel ... The early history of modern birds inferred from DNA sequences of nuclear and mitochondrial ribosomal genes. In: Molecular ... The early history of modern birds inferred from DNA sequences of nuclear and mitochondrial ribosomal genes. Molecular Biology ... title = "The early history of modern birds inferred from DNA sequences of nuclear and mitochondrial ribosomal genes", ...
The HindIII polymorphism of the ribosomal DNA in the German cockroach (Blattella germanica L.). Mukha DV, Lazebnaia IV, ...
Application of the 5 fluorogenic exonuclease assay (TaqMan) for quantitative ribosomal DNA and rRNA analysis in sediments.. ... Deltaproteobacteria, DNA, Ribosomal, Fluorescent Dyes, Geologic Sediments, Polymerase Chain Reaction, Reproducibility of ... Application of the 5 fluorogenic exonuclease assay (TaqMan) for quantitative ribosomal DNA and rRNA analysis in sediments.. ... The lower detection limit of each assay was 5 to 50 fg of genomic DNA or , or =2 pg of 16S rRNA. TaqMan PCR spectral traces ...
DNA replication, and. *ribosomal RNA formation.. The effects include CNS depression and cardiopulmonary and renal failure (Bove ...
Instead, a molecule called a noncoding RNA, a chemical cousin of DNA, is produced from the RMRP gene. This RNA attaches (binds ... The RNase MRP enzyme probably also processes ribosomal RNA. , which is required for assembling protein building blocks (amino ... For example, it likely helps copy (replicate) the DNA found in the energy-producing centers of cells (mitochondria. ). ... Ganapathi KA, Shimamura A. Ribosomal dysfunction and inherited marrow failure. Br J Haematol. 2008 May;141(3):376-87. doi: ...
2011), for nuclear ribosomal DNA, see Wicke et al. (2011). F.-W. Li et al. (2015: e.g. Fig. 1) outline phytochrome (red/far red ... 2002) looked at the distribution of ribosomal DNA in somatic chromosomes.. Chemistry, Morphology, etc.. For stomatal morphology ... In general, DNA variation in plastomes and chondromes is lower than that of nuclear genes. Plastome transmission in most seed ... with duplicated ribosomal RNA operons; chondrome with second intron in the rps3 gene [group II, rps3i2]. 4 orders, 12 families ...
Microbial genomic DNA was extracted from each fecal sample (0.1 g) using a Genomic DNA Isolation Kit (Sangon Biotech Co. Ltd., ... Taxonomic annotation was conducted using a ribosomal database project (RDP) classifier. Based on the results of the OTU ... were amplified using DNA as a template. Sequence analysis was performed using VSEARCH (1.9.6) software. Sequences with ≥97% ... The concentration of DNA samples was measured using a Qubit 2.0 fluorometer (Invitrogen, Carlsbad, CA). The sequencing ...
18S ribosomal DNA-based PCR for diagnosis of Trichomonas vaginalis. J Clin Microbiol. 2000 Jul. 38(7):2683-7. [QxMD MEDLINE ... Improved detection by DNA amplification of Trichomonas vaginalis in males. J Clin Microbiol. 2002 Oct. 40(10):3681-3. [QxMD ...
LR: 20081121; JID: 8412849; 0 (DNA, Ribosomal); 0 (RNA, Ribosomal, 16S); 2007/04/17 [received]; 2007/11/30 [revised]; 2007/12/ ... Ribosomal, 16S/analysis, Random Amplified Polymorphic DNA Technique/methods, Sequence Analysis, DNA, Soy Foods/microbiology, ... DNA, Ribosomal/chemistry/genetics, Fermentation, Gene Amplification, Genetic Variation, Hydrogen-Ion Concentration, ... Through random amplified polymorphic DNA (RAPD) analysis for typing and 16S rDNA sequencing, 136 representative strains were ...
... using ITS sequences of nuclear ribosomal DNA". American Journal of Botany. 88 (1): 150-160. doi:10.2307/2657135. JSTOR 2657135 ... According to the Kazusa DNA Research Institute, detailed DNA research has shown that the Prunus itosakura and the Prunus ... modern theories based on detailed DNA research reject the theory that the Himalayan cherry tree is the root of the Japanese ... According to the results of DNA analysis of 215 cultivars carried out by Japans Forestry and Forest Products Research ...
... also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses ... Fhl1p is involved in regulating the expression of ribosomal protein (RP) genes by RNA polymerase II. Its FHA domain is required ... Download DNA or protein sequence, view genomic context and coordinates. Click "Sequence Details" to view all sequence ... Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits ...
Ribosomal DNA and chloroplast DNA polymorphisms in a mixed stand of Quercus robur and Q petraea RJ Petit, DB Wagner and A ...
Isoetes delilei internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene and internal transcribed spacer 2, ... complete sequence; and 28S ribosomal RNA gene, partial sequence. 738 bp linear DNA ...
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, ... Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins). ... d1fjgq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie ...
Fine structure and transcription dynamics of bread wheat ribosomal DNA loci deciphered by a multi-omics approach. Tulpová, Z., ...
First phylogenetic analysis of Dryophthorinae (Coleoptera, Curculionidae) based on structural alignment of ribosomal DNA ... First phylogenetic analysis of Dryophthorinae (Coleoptera, Curculionidae) based on structural alignment of ribosomal DNA ... Enhancing DNA barcode reference libraries by harvesting terrestrial arthropods at the National Museum of Natural History - ( ... Enhancing DNA barcode reference libraries by harvesting terrestrial arthropods at the National Museum of Natural History. ...
... region of nuclear ribosomal DNA. - Syst. Bot. 27: 127-137. Google Scholar ... Lamiaceae) on the Canary Islands as inferred from chloroplast and nuclear DNA sequences and ISSR fingerprint data. - Mol. ...
Phylogenetic relationships among cirrate octopods (Mollusca: Cephalopoda) resolved using mitochondrial 16S ribosomal DNA ...
A subsequent analysis of mitochondrial, nuclear and ribosomal DNA only solidified this relationship. ...
Super-resolution in situ analysis of active ribosomal DNA chromatin organization in the nucleolus. Sci. Rep. 2020, 10, 7462. [ ...
  • The process involved consists of either amplification or cloning of ribosomal DNA from a bacterial population, sequencing of this ribosomal DNA, and phylogenetic analysis of the sequences obtained. (duke.edu)
  • Chromosomal regions enriched in repetitive DNA sequences have a predisposition to instability, resulting in a propensity to undergo structural rearrangements. (unesp.br)
  • Tuinen, MV , Sibley, CG & Hedges, SB 2000, ' The early history of modern birds inferred from DNA sequences of nuclear and mitochondrial ribosomal genes ', Molecular Biology and Evolution , vol. 17, no. 3, pp. 451-457. (rug.nl)
  • DNA sequences [ 4-6 ]. (who.int)
  • DNA sequences were identified to genus level and submitted to oral microbiota diversity analyses. (lu.se)
  • Although the ITS primers are universal for fungi, the D1D2 region of the large ribosomal subunit has better discrimination for yeasts, with primers NL-1 and NL-4. (cdc.gov)
  • The GEN-PROBE TMA reaction replicates a specific region of the small ribosomal subunit from trichomonas vaginalis via DNA and RNA intermediates and generates RNA amplicon molecules. (cdc.gov)
  • All inhibit protein synthesis by binding to the 50S ribosomal subunit. (msdmanuals.com)
  • A subsequent analysis of mitochondrial, nuclear and ribosomal DNA only solidified this relationship. (innovations-report.com)
  • In Bacteria, Archaea, and chloroplasts the rRNA is composed of different (smaller) units, the large (23S) ribosomal RNA, 16S ribosomal RNA and 5S rRNA. (wikipedia.org)
  • HOT1 includes an RNA polymerase I (PolI) transcription promoter that catalyzes 35S ribosomal rRNA gene transcription. (wikipedia.org)
  • Application of the 5' fluorogenic exonuclease assay (TaqMan) for quantitative ribosomal DNA and rRNA analysis in sediments. (umass.edu)
  • Assay accuracy was significantly improved by employing a system of replicate dilutions and replicate analyses for both DNA and rRNA quantitation. (umass.edu)
  • A phylogenetic analysis of the composition of the human GI microbiota of 23 healthy adult subjects was performed from a pooled faecal bacterial DNA sample by combining genomic %G+C -based profiling and fractioning with 16S rRNA gene cloning and sequencing. (springer.com)
  • To facilitate identification of R. mannitolilytica and R. pickettii , we developed 16S ribosomal DNA-based polymerase chain reaction assays that allow sensitive and specific identification of these species. (cdc.gov)
  • Mycobacterial DNA was not detected with quantitative polymerase chain reaction. (cdc.gov)
  • it inhibits RNA polymerase by binding to the DNA template-RNA polymerase complex. (msdmanuals.com)
  • This document describes some of the target genes and primers that can be used for DNA sequence-based identification of fungi and the PCR conditions with which to use those primers. (cdc.gov)
  • Methods: DNAs from 92 oral washings from 52 participants were subject to metabarcoding of ribosomal genes. (lu.se)
  • Ribosomal DNA (rDNA) is a DNA sequence that codes for ribosomal RNA. (wikipedia.org)
  • From the first open reading frame of pHG12 the amino acid sequence for a polypeptide of 25 amino acid residues (designated HG12) was derived, which was identical in 22 residues with yeast ribosomal protein YL41. (nih.gov)
  • Download DNA or protein sequence, view genomic context and coordinates. (yeastgenome.org)
  • Erratum: Sequence of 16S Ribosomal from Halobacterium volcanii, an Archaebacterium. (lu.se)
  • These primers amplify approximately 600 basepairs of the ITS1-5.8S-ITS2 region of the ribosomal cistron. (cdc.gov)
  • These primers amplify approximately 620 basepairs of the 28S region of the ribosomal cistron. (cdc.gov)
  • These primers amplify a section of the intergenic spacer in the ribosomal cistron. (cdc.gov)
  • Transcription of DNA fragments containing the coding region of pHG12 cloned into BluescriptM13, followed by cell-free translation, yielded a polypeptide with an apparent mol.wt. (nih.gov)
  • do not use an en dash between reverse transcription and PCR. (cdc.gov)
  • use a hyphen in the term real-time, but do not use an en dash between reverse transcription and PCR. (cdc.gov)
  • Scholars@Duke publication: Detection of culture-resistant bacterial pathogens by amplification and sequencing of ribosomal DNA. (duke.edu)
  • Ribosomal RNA analyses demonstrated presence of additional bacterial and fungal species not identified with culture. (cdc.gov)
  • Two primer pairs, one for amplification of D1/D2- 26Sr DNA and another for the ITS1 region were used in PCR. (celljournal.org)
  • RESUME Une PCR (amplification en chaîne par polymérase) diagnostique avec des amorces spécifiques d'espèces et un séquençage direct ont été utilisés pour la détermination des membres du complexe Ano- pheles maculipennis dans les régions du nord-ouest et du centre de la République islamique d'Iran. (who.int)
  • A fragment of yeast rDNA containing the 5S gene, non-transcribed spacer DNA, and part of the 35S gene has localized cis-acting mitotic recombination stimulating activity. (wikipedia.org)
  • As a result, this DNA can provide phylogenetic information of species belonging to wide systematic levels. (wikipedia.org)
  • First phylogenetic analysis of Dryophthorinae (Coleoptera, Curculionidae) based on structural alignment of ribosomal DNA reveals Cenozoic diversification. (usda.gov)
  • For identification of Trichosporon species, the intergenic region of the ribosomal cistron is used (Sugita, 2002). (cdc.gov)
  • They could occur by slippage of the newly synthesized strand during DNA replication or by gene conversion. (wikipedia.org)
  • In addition, whole genome sequencing (WGS)-based digital DNA-DNA hybridization (dDDH) was used as a reference method for strain identification, and surprised with the detection of a novel W. chitiniclastica subspecies. (frontiersin.org)
  • However, our FISH results revealed striking variability in the number and chromosomal position of rDNA clusters among the three species studied, as well as intraspecific variations in S. cyanea and S. ilheensis, which suggests intense evolutionary dynamics of this repetitive DNA family and highlights rapid chromosomal evolution in these insects. (unesp.br)
  • Trichophyton species DNA is amplified very poorly by the ITS primer set used for most other molds. (cdc.gov)
  • It is therefore assumed that HG12 is the first mammalian homolog of yeast ribosomal protein YL41. (nih.gov)
  • was also observed for yeast ribosomal protein YL41. (nih.gov)
  • Instead, a molecule called a noncoding RNA, a chemical cousin of DNA, is produced from the RMRP gene. (medlineplus.gov)
  • A single-stranded chemiluminescent DNA probe, which is complementary to a region of the target amplicon, is labeled with different acridinium ester molecule. (cdc.gov)
  • Shotgun metagenomics sequencing of the fecal DNA in the pediatric subjects revealed diminished coverage of the butanoate pathway (abundance normalized to controls of 1 ± 0.48 versus 0.72 ± 0.33 in ERA, p = 0.037). (medscape.com)
  • The rDNA repeats have many regulatory mechanisms that keep the DNA from undergoing mutations, thus keeping the rDNA conserved. (wikipedia.org)
  • it does not describe the procedure for purification of fungal DNA. (cdc.gov)
  • For example, it likely helps copy (replicate) the DNA found in the energy-producing centers of cells ( mitochondria ). (medlineplus.gov)
  • DNA regions that are repetitive often undergo recombination events. (wikipedia.org)
  • All of the samples underwent sequencing of the 16S ribosomal DNA. (medscape.com)
  • Second, C. auris is challenging to identify, requiring specialized methods like MALDI-TOF or ribosomal DNA sequencing. (cdc.gov)
  • Enhancing DNA barcode reference libraries by harvesting terrestrial arthropods at the National Museum of Natural History. (usda.gov)