The most common and most biologically active of the mammalian prostaglandins. It exhibits most biological activities characteristic of prostaglandins and has been used extensively as an oxytocic agent. The compound also displays a protective effect on the intestinal mucosa.
Drugs that stimulate contraction of the myometrium. They are used to induce LABOR, OBSTETRIC at term, to prevent or control postpartum or postabortion hemorrhage, and to assess fetal status in high risk pregnancies. They may also be used alone or with other drugs to induce abortions (ABORTIFACIENTS). Oxytocics used clinically include the neurohypophyseal hormone OXYTOCIN and certain prostaglandins and ergot alkaloids. (From AMA Drug Evaluations, 1994, p1157)
Artificially induced UTERINE CONTRACTION. Generally, LABOR, OBSTETRIC is induced with the intent to cause delivery of the fetus and termination of pregnancy.
The insertion of drugs into the vagina to treat local infections, neoplasms, or to induce labor. The dosage forms may include medicated pessaries, irrigation fluids, and suppositories.
A synthetic analog of natural prostaglandin E1. It produces a dose-related inhibition of gastric acid and pepsin secretion, and enhances mucosal resistance to injury. It is an effective anti-ulcer agent and also has oxytocic properties.
CHILDBIRTH at the end of a normal duration of PREGNANCY, between 37 to 40 weeks of gestation or about 280 days from the first day of the mother's last menstrual period.
Medicated dosage forms that are designed to be inserted into the rectal, vaginal, or urethral orifice of the body for absorption. Generally, the active ingredients are packaged in dosage forms containing fatty bases such as cocoa butter, hydrogenated oil, or glycerogelatin that are solid at room temperature but melt or dissolve at body temperature.
The status during which female mammals carry their developing young (EMBRYOS or FETUSES) in utero before birth, beginning from FERTILIZATION to BIRTH.
A group of diseases arising from pregnancy that are commonly associated with hyperplasia of trophoblasts (TROPHOBLAST) and markedly elevated human CHORIONIC GONADOTROPIN. They include HYDATIDIFORM MOLE, invasive mole (HYDATIDIFORM MOLE, INVASIVE), placental-site trophoblastic tumor (TROPHOBLASTIC TUMOR, PLACENTAL SITE), and CHORIOCARCINOMA. These neoplasms have varying propensities for invasion and spread.
Trophoblastic growth, which may be gestational or nongestational in origin. Trophoblastic neoplasia resulting from pregnancy is often described as gestational trophoblastic disease to distinguish it from germ cell tumors which frequently show trophoblastic elements, and from the trophoblastic differentiation which sometimes occurs in a wide variety of epithelial cancers. Gestational trophoblastic growth has several forms, including HYDATIDIFORM MOLE and CHORIOCARCINOMA. (From Holland et al., Cancer Medicine, 3d ed, p1691)
Trophoblastic hyperplasia associated with normal gestation, or molar pregnancy. It is characterized by the swelling of the CHORIONIC VILLI and elevated human CHORIONIC GONADOTROPIN. Hydatidiform moles or molar pregnancy may be categorized as complete or partial based on their gross morphology, histopathology, and karyotype.
Endoscopy of the small intestines accomplished while advancing the endoscope into the intestines from the stomach by alternating the inflation of two balloons, one on an innertube of the endoscope and the other on an overtube.
The repetitive uterine contraction during childbirth which is associated with the progressive dilation of the uterine cervix (CERVIX UTERI). Successful labor results in the expulsion of the FETUS and PLACENTA. Obstetric labor can be spontaneous or induced (LABOR, INDUCED).
Use or insertion of a tubular device into a duct, blood vessel, hollow organ, or body cavity for injecting or withdrawing fluids for diagnostic or therapeutic purposes. It differs from INTUBATION in that the tube here is used to restore or maintain patency in obstructions.
Instruments for the visual examination of the interior of the gastrointestinal tract.
Accidental or deliberate use of a medication or street drug in excess of normal dosage.
Tumors or cancer of the UTERUS.
A uterine tumor derived from persistent gestational TROPHOBLASTS, most likely after a molar pregnancy (HYDATIDIFORM MOLE). Invasive hyadatiform mole develops in about 15% of patients after evacuation of a complete mole and less frequently after other types of gestation. It may perforate the MYOMETRIUM and erode uterine vessels causing hemorrhage.
A malignant metastatic form of trophoblastic tumors. Unlike the HYDATIDIFORM MOLE, choriocarcinoma contains no CHORIONIC VILLI but rather sheets of undifferentiated cytotrophoblasts and syncytiotrophoblasts (TROPHOBLASTS). It is characterized by the large amounts of CHORIONIC GONADOTROPIN produced. Tissue origins can be determined by DNA analyses: placental (fetal) origin or non-placental origin (CHORIOCARCINOMA, NON-GESTATIONAL).

Expression of both P1 and P2 purine receptor genes by human articular chondrocytes and profile of ligand-mediated prostaglandin E2 release. (1/6240)

OBJECTIVE: To assess the expression and function of purine receptors in articular chondrocytes. METHODS: Reverse transcriptase-polymerase chain reaction (RT-PCR) was used to screen human chondrocyte RNA for expression of P1 and P2 purine receptor subtypes. Purine-stimulated prostaglandin E2 (PGE2) release from chondrocytes, untreated or treated with recombinant human interleukin-1alpha (rHuIL-1alpha), was assessed by radioimmunoassay. RESULTS: RT-PCR demonstrated that human articular chondrocytes transcribe messenger RNA for the P1 receptor subtypes A2a and A2b and the P2 receptor subtype P2Y2, but not for the P1 receptor subtypes A1 and A3. The P1 receptor agonists adenosine and 5'-N-ethylcarboxamidoadenosine did not change PGE2 release from chondrocytes. The P2Y2 agonists ATP and UTP stimulated a small release of PGE2 that was potentiated after pretreatment with rHuIL-1alpha. PGE2 release in response to ATP and UTP cotreatment was not additive, but release in response to coaddition of ATP and bradykinin (BK) or UTP and BK was additive, consistent with ATP and UTP competition for the same receptor site. The potentiation of PGE2 release in response to ATP and UTP after rHuIL-1alpha pretreatment was mimicked by phorbol myristate acetate. CONCLUSION: Human chondrocytes express both P1 and P2 purine receptor subtypes. The function of the P1 receptor subtype is not yet known, but stimulation of the P2Y2 receptor increases IL-1-mediated PGE2 release.  (+info)

Cortisol in fetal fluids and the fetal adrenal at parturition in the tammar wallaby (Macropus eugenii). (2/6240)

Glucocorticoid hormones may play a critical role in initiating parturition in tammar wallabies. In this study, we investigated the concentration of cortisol in fetal fluids and cortisol production by fetal adrenals over the last 3 days of the 26-day pregnancy and within 24 h postpartum. The fetal adrenals almost doubled in size between Days 24 and 26 of pregnancy, and their cortisol content increased over 10-fold during this period, from 10 pg to over 100 pg per adrenal pair. After birth, neonatal adrenals continued to grow, but cortisol content fell dramatically to 20 pg. The prepartum increase in adrenal cortisol was reflected by a substantial rise in cortisol concentrations in yolk sac fluid, allantoic fluid, and fetal blood, which were below 10 ng/ml on Day 24 and rose to over 40 ng/ml by Day 26. Cortisol concentrations in neonatal blood decreased postpartum, mirroring decreased cortisol content in neonatal adrenals. Cortisol production by the fetal adrenal was stimulated in vitro by ACTH and prostaglandin E2, suggesting that the in vivo increase may be stimulated by release of ACTH from the fetal hypothalamic-pituitary axis and prostaglandin E2 from the placenta. These results indicate that increasing cortisol production by the fetal adrenal is a characteristic of late pregnancy in the tammar wallaby and support the suggestion that fetal cortisol may trigger the initiation of parturition in this marsupial species.  (+info)

Down-regulation of oxytocin-induced cyclooxygenase-2 and prostaglandin F synthase expression by interferon-tau in bovine endometrial cells. (3/6240)

Oxytocin (OT) is responsible for the episodic release of luteolytic prostaglandin (PG) F2alpha from the uterus in ruminants. The attenuation of OT-stimulated uterine PGF2alpha secretion by interferon-tau (IFN-tau) is essential for prevention of luteolysis during pregnancy in cows. To better understand the mechanisms involved, the effect of recombinant bovine IFN-tau (rbIFN-tau) on OT-induced PG production and cyclooxygenase-2 (COX-2) and PGF synthase (PGFS) expression in cultured endometrial epithelial cells was investigated. Cells were obtained from cows at Days 1-3 of the estrous cycle and cultured to confluence in RPMI medium supplemented with 5% steroid-free fetal calf serum. The cells were then incubated in the presence or absence of either 100 ng/ml OT or OT+100 ng/ml rbIFN-tau for 3, 6, 12, and 24 h. OT significantly increased PGF2alpha and PGE2 secretion at all time points (p < 0.01), while rbIFN-tau inhibited the OT-induced PG production and reduced OT receptor binding in a time-dependent manner. OT increased the steady-state level of COX-2 mRNA, measured by Northern blot, which was maximal at 3 h (9-fold increase) and then decreased with time (p < 0.01). OT also caused an increase in COX-2 protein, which peaked at 12 h (11-fold increase), as measured by Western blot. Addition of rbIFN-tau suppressed the induction of COX-2 mRNA (89%, p < 0.01) and COX-2 protein (50%, p < 0.01) by OT. OT also increased PGFS mRNA, and this stimulation was attenuated by rbIFN-tau (p < 0.01). To ensure that the decrease in COX-2 was not solely due to down-regulation of the OT receptor, cells were stimulated with a phorbol ester (phorbol 12-myristate 13-acetate; PMA) in the presence and absence of rbIFN-tau. The results showed that rbIFN-tau also decreased PMA-stimulated PG production and COX-2 protein. It can be concluded that rbIFN-tau inhibition of OT-stimulated PG production is due to down-regulation of OT receptor, COX-2, and PGFS.  (+info)

Delay of preterm delivery in sheep by omega-3 long-chain polyunsaturates. (4/6240)

A positive correlation has been shown between dietary intake of long-chain omega-3 fatty acids in late pregnancy and gestation length in pregnant women and experimental animals. To determine whether omega-3 fatty acids have an effect on preterm labor in sheep, a fish oil concentrate emulsion was continuously infused to six pregnant ewes from 124 days gestational age. At 125 days, betamethasone was administered to the fetus to produce preterm labor. Both the onset of labor and the time of delivery were delayed by the fish oil emulsion. Two of the omega-3-infused ewes reverted from contractions to nonlabor, an effect never previously observed for experimental glucocorticoid-induced preterm labor in sheep. Maternal plasma estradiol and maternal and fetal prostaglandin E2 rose in control ewes but not in those infused with omega-3 fatty acid. The ability of omega-3 fatty acids to delay premature delivery in sheep indicates their possible use as tocolytics in humans. Premature labor is the major cause of neonatal death and long-term disability, and these studies present information that may lead to a novel therapeutic regimen for the prevention of preterm delivery in human pregnancy.  (+info)

Mechanisms of prostaglandin E2 release by intact cells expressing cyclooxygenase-2: evidence for a 'two-component' model. (5/6240)

Prostaglandin (PG) release in cells expressing constitutive cyclooxygenase-1 is known to be regulated by liberation of arachidonic acid by phospholipase A2 followed by metabolism by cyclooxygenase. However, the relative contribution of phospholipase A2 to the release of PGs in cells expressing cyclooxygenase-2 is not clear. We addressed this question by using radioimmunoassay to measure PGE2 release by human cells (A549) induced to express cyclooxygenase-2 (measured by Western blot analysis) by interleukin-1beta. Cells were either unstimulated or stimulated with agents known to activate phospholipase A2 (bradykinin, Des-Arg10-kallidin, or the calcium ionophore A23187) or treated with exogenous arachidonic acid. When cells were treated to express cyclooxygenase-2, the levels of PGE2 released over 15 min were undetectable; however, in the same cells stimulated with bradykinin, A23187, or arachidonic acid, large amounts of prostanoid were produced. Using selective inhibitors/antagonists, we found that the effects of bradykinin were mediated by B2 receptor activation and that prostanoid release was due to cyclooxygenase-2, and not cyclooxygenase-1, activity. In addition, we show that the release of PGE2 stimulated by either bradykinin, A23187, or arachidonic acid was inhibited by the phospholipase A2 inhibitor arachidonate trifluoromethyl ketone. Hence, we have demonstrated that PGE2 is released by two components: induction of cyclooxygenase-2 and supply of substrate, probably via activation of phospholipase A2. This is illustrated in A549 cells by a clear synergy between the cytokine interleukin-1beta and the kinin bradykinin.  (+info)

The cyclo-oxygenase-dependent regulation of rabbit vein contraction: evidence for a prostaglandin E2-mediated relaxation. (6/6240)

1. Arachidonic acid (0.01-1 microM) induced relaxation of precontracted rings of rabbit saphenous vein, which was counteracted by contraction at concentrations higher than 1 microM. Concentrations higher than 1 microM were required to induce dose-dependent contraction of vena cava and thoracic aorta from the same animals. 2. Pretreatment with a TP receptor antagonist (GR32191B or SQ29548, 3 microM) potentiated the relaxant effect in the saphenous vein, revealed a vasorelaxant component in the vena cava response and did not affect the response of the aorta. 3. Removal of the endothelium from the venous rings, caused a 10 fold rightward shift in the concentration-relaxation curves to arachidonic acid. Whether or not the endothelium was present, the arachidonic acid-induced relaxations were prevented by indomethacin (10 microM) pretreatment. 4. In the saphenous vein, PGE2 was respectively a 50 and 100 fold more potent relaxant prostaglandin than PGI2 and PGD2. Pretreatment with the EP4 receptor antagonist, AH23848B, shifted the concentration-relaxation curves of this tissue to arachidonic acid in a dose-dependent manner. 5. In the presence of 1 microM arachidonic acid, venous rings produced 8-10 fold more PGE2 than did aorta whereas 6keto-PGF1alpha and TXB2 productions remained comparable. 6. Intact rings of saphenous vein relaxed in response to A23187. Pretreatment with L-NAME (100 microM) or indomethacin (10 microM) reduced this response by 50% whereas concomitant pretreatment totally suppressed it. After endothelium removal, the remaining relaxing response to A23187 was prevented by indomethacin but not affected by L-NAME. 7. We conclude that stimulation of the cyclo-oxygenase pathway by arachidonic acid induced endothelium-dependent, PGE2/EP4 mediated relaxation of the rabbit saphenous vein. This process might participate in the A23187-induced relaxation of the saphenous vein and account for a relaxing component in the response of the vena cava to arachidonic acid. It was not observed in thoracic aorta because of the lack of a vasodilatory receptor and/or the poorer ability of this tissue than veins to produce PGE2.  (+info)

Cytokine-mediated inflammatory hyperalgesia limited by interleukin-4. (7/6240)

1. The effect of IL-4 on responses to intraplantar (i.pl.) carrageenin, bradykinin, TNFalpha, IL-1beta, IL-8 and PGE2 was investigated in a model of mechanical hyperalgesia in rats. Also, the cellular source of the IL-4 was investigated. 2. IL-4, 30 min before the stimulus, inhibited responses to carrageenin, bradykinin, and TNFalpha, but not responses to IL-1beta, IL-8 and PGE2. 3. IL-4, 2 h before the injection of IL-1beta, did not affect the response to IL-1beta, whereas IL-4, 12 or 12+2 h before the IL-1beta, inhibited the hyperalgesia (-30%, -74%, respectively). 4. In murine peritoneal macrophages, murine IL-4 for 2 h before stimulation with LPS, inhibited (-40%) the production of IL-1beta but not PGE2. Murine IL-4 (for 16 h before stimulation with LPS) inhibited LPS-stimulated PGE2 but not IL-1beta. 5. Anti-murine IL-4 antibodies potentiated responses to carrageenin, bradykinin and TNFalpha, but not IL-1beta and IL-8, as well as responses to bradykinin in athymic rats but not in rats depleted of mast cells with compound 40/80. 6. These data suggest that IL-4 released by mast cells limits inflammatory hyperalgesia. During the early phase of the inflammatory response the mode of action of the IL-4 appears to be inhibition of the production TNFalpha, IL-1beta and IL-8. In the later phase of the response, in addition to inhibiting the production of pro-inflammatory cytokines, IL-4 also may inhibit the release of PGs.  (+info)

The effects of inflammation and inflammatory mediators on nociceptive behaviour induced by ATP analogues in the rat. (8/6240)

1. We have studied the behavioural effects of intraplantar injections of adenosine 5'-triphosphate (ATP) and related compounds in freely moving rats and investigated whether these nociceptive effects are augmented in the presence of inflammatory mediators. 2. We find that in normal animals ATP and analogues produce dose-dependent nocifensive behaviour (seen as bursts of elevation of the treated hindpaw), and localized thermal hyperalgesia. The rank order of potency was: alpha,beta-methyleneadenosine 5'-triphosphate (alpha,beta-methylene ATP) > 2-methylthioadenosine triphosphate (2-methylthio ATP) > ATP. After neonatal treatment with capsaicin, to destroy small calibre primary sensory neurones, nocifensive behaviour was largely absent. 3. The effects of ATP analogues were assessed in three models of peripheral sensitization: 2 h after dilute intraplantar carrageenan (0.25% w v(-1)); 24 h after irradiation of the hindpaw with ultraviolet (U.V.) B; immediately following prostaglandin E2 (PGE2) treatment. In all models the effect of alpha,beta-methylene ATP was greatly augmented. After carrageenan, significant hindpaw-lifting behaviour activity was induced by injection of only 0.05 nmol of alpha,beta-methylene ATP, some 100 times less than necessary in normal skin. 4. Our data suggest that it is much more likely that endogenous levels of ATP will reach levels capable of exciting nociceptors in inflamed versus normal skin. Our data also suggest the involvement of P2X3 receptor subunits in ATP-induced nociception.  (+info)

Pepicelli O, Fedele E, Bonanno G, Raiteri M, Ajmone-Cat MA, Greco A, Levi G, Minghetti L. In vivo activation of N-methyl-D-aspartate receptors in the rat hippocampus increases prostaglandin E2 extracellular levels and triggers lipid peroxidation through cyclooxygenase-mediated mechanisms. Journal of neurochemistry 2002;81(5):1028-1034 ...
Effect of Dietary β-1,3/1,6-glucan Supplementation on Growth Performance, Immune Response and Plasma Prostaglandin E2, Growth Hormone and Ghrelin in Weanling Piglets - ${\beta}$-1,3/1,6-glucan;Growth Performance;Immune Response;$PGE_2$;Ghrelin;Weanling Piglets;
Mucosal prostaglandin E2 levels in patients with the gastric ulcer before and after their ulcers were healed. Both the antral and duodenal PG E2 are significant
Dinoprostone - Get up-to-date information on Dinoprostone side effects, uses, dosage, overdose, pregnancy, alcohol and more. Learn more about Dinoprostone
Learn more about prostaglandin-e2. We enable science by offering product choice, services, process excellence and our people make it happen.
Principal Investigator:SUGIMURA Motoi, Project Period (FY):2007 - 2009, Research Category:Grant-in-Aid for Scientific Research (C), Section:一般, Research Field:Obstetrics and gynecology
Dinoprostone: The most common and most biologically active of the mammalian prostaglandins. It exhibits most biological activities characteristic of prostaglandins and has been used extensively as an oxytocic agent. The compound also displays a protective effect on the intestinal mucosa.
Prostin E2 with NDC 0009-0827 is a a human prescription drug product labeled by Pharmacia And Upjohn Company Llc. The generic name of Prostin E2 is dinoprostone.
Dinoprostone is used for several purposes, such as preparing the cervix for delivery or causing an abortion. This eMedTV page examines the various forms of this drug, along with the specific uses for each product. It also covers side effects and dosing.
Cyclooxygenase-2 (COX-2)-dependent prostaglandin E2 (PGE2) synthesis exacerbates occlusive and aneurysmal vascular disease by inducing macrophage proteinase and...
Inside a WBC we have a transcription factor called NFKB. In the cytosol, NFKB is normally inactivated by IKB. When a viral/bacteria protein stimulates an inflammatory response, the IKB is degraded and we have free NFKB. This translocates in the nucleus where is acts as a transcription factor, to increase cytokines, adhesion molecules, and COX-2. -Cytokines: fight pathogens but can also cause tissue damage. -Adhesion molecules: ICAM/VCAM: binds to the endothelial cells, which can then go into the tissue and fight the pathogen. -COX-2: AA is the subtrate for COX-2, which produces PGE. This causes dilation of the vessels, warmth, tenderness. ...
Prostaglandin E synthase (or PGE synthase) is an enzyme involved in eicosanoid and glutathione metabolism, a member of MAPEG family. It generates prostaglandin E (PGE) from prostaglandin H2. The synthase generating PGE2 is a membrane-associated protein. Humans express three prostaglandin-E synthase isozymes, each encoded by a separate gene: Jegerschold, C.; Pawelzik, S. -C.; Purhonen, P.; Bhakat, P.; Gheorghe, K. R.; Gyobu, N.; Mitsuoka, K.; Morgenstern, R.; Jakobsson, P. -J.; Hebert, H. (2008). Structural basis for induced formation of the inflammatory mediator prostaglandin E2. Proceedings of the National Academy of Sciences. 105 (32): 11110-11115. doi:10.1073/pnas.0802894105. PMC 2516235 . PMID 18682561. Murakami M, Nakatani Y, Tanioka T, Kudo I (August 2002). Prostaglandin E synthase. Prostaglandins Other Lipid Mediat. 68-69: 383-99. doi:10.1016/S0090-6980(02)00043-6. PMID 12432931. Park JY, Pillinger MH, Abramson SB (June 2006). Prostaglandin E2 synthesis and secretion: the role of ...
TY - JOUR. T1 - Diphlorethohydroxycarmalol, isolated from Ishige okamurae, increases prostaglandin E2 through the expression of cyclooxygenase-1 and -2 in HaCaT human keratinocytes. AU - Kang, Gyeoung Jin. AU - Han, Sang Chul. AU - Koh, Young Sang. AU - Kang, Hee Kyoung. AU - Jeon, You Jin. AU - Yoo, Eun Sook. N1 - Copyright: Copyright 2013 Elsevier B.V., All rights reserved.. PY - 2012. Y1 - 2012. N2 - Prostaglandin (PG) E2, the most abundant prostaglandin in the human body, is synthesized from arachidonic acid via the actions of cyclooxygenase (COX) enzymes. PGE2 exerts homeostatic, cytoprotective, inflammatory, and in some cases anti-inflammatory effects. Also, it has been reported that PGE2 is involved in hair growth. Diphlorethohydroxycarmalol (DPHC) is a phlorotannin compound isolated from the brown algae Ishige okamurae, with various biological activities in vitro and in vivo. In this study, the biological effect and mechanism of action of DPHC on prostaglandin synthesis in HaCaT human ...
Animal studies lasting several weeks at high doses have shown that prostaglandins of the E and F series can induce proliferation of bone. Such effects have also been noted in newborn infants who have received prostaglandin E1 during prolonged treatment. There is no evidence that short term administration of PROSTIN E2 Vaginal Suppository can cause similar bone effects.. As in spontaneous abortion, where the process is sometimes incomplete, abortion induced by PROSTIN E2 may sometimes be incomplete. In such cases, other measures should be taken to assure complete abortion.. In patients with a history of asthma, hypo-or hypertension, cardiovascular disease, renal disease, hepatic disease, anemia, jaundice, diabetes or history of epilepsy, dinoprostone should be used with caution.. Dinoprostone administered by the vaginal route should be used with caution in the presence of cervicitis, infected endocervical lesions, or acute vaginitis.. As with any oxytocic agent, dinoprostone should be used with ...
The commensal flora can promote both immunity to pathogens and mucosal inflammation. How commensal-driven inflammation is regulated in the context of infection remains poorly understood. Here, we show that during acute mucosal infection of mice with Toxoplasma gondii, inflammatory monocytes acquire a tissue-specific regulatory phenotype associated with production of the lipid mediator prostaglandin E2 (PGE2). Notably, in response to commensals, inflammatory monocytes can directly inhibit neutrophil activation in a PGE2-dependent manner. Further, in the absence of inflammatory monocytes, mice develop severe neutrophil-mediated pathology in response to pathogen challenge that can be controlled by PGE2 analog treatment. Complementing these findings, inhibition of PGE2 led to enhanced neutrophil activation and host mortality after infection. These data demonstrate a previously unappreciated dual action of inflammatory monocytes in controlling pathogen expansion while limiting commensal-mediated ...
Vaginal prostaglandin (PGE2 and PGF2a) for induction of labour at term - The Cochrane database of systematic reviews - Vol. 6 - p.CD003101
If you wish to reuse any or all of this article please use the link below which will take you to the Copyright Clearance Centers RightsLink service. You will be able to get a quick price and instant permission to reuse the content in many different ways.. ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
In our studies, we showed that inhibition of LPS-stimulated ROS production in BMDM also selectively inhibited the production of PGD2, but not its isomer PGE2. LPS-induced PGD2 production in BMDM was mediated via H-PGDS isomerase, but not L-PGDS. LPS-induced H-PGDS-mediated PGD2 production was sensitive to and dependent on the NOX-generated ROS in BMDM. In contrast, the LPS-induced PGE2 production in BMDM was ROS independent.. To our knowledge, this is the first report of the role of ROS in differential regulation of LPS-induced PGD2 and PGE2 production. The novel finding of our study is that the modulation of intracellular ROS levels in macrophages could selectively regulate LPS-induced production of PGD2, but not PGE2. Therefore, it is impossible that the ROS or any NOX/ROS inhibitors exert their selective effects on PGD2 production via the modification of COX-2 enzyme in BMDM. If there is any modifications of the COX-2 protein expression or its enzyme activity by the above inhibitors or H2O2, ...
The cyclooxygenase (COX) isoforms COX-1 and COX-2 convert arachidonic acid to prostaglandin (PG) precursors and are a limiting step in PG production. Interleukin-1beta (IL-1beta) treatment of type II A549 cells increases PGE2 synthesis via transcription- and translation-dependent induction of COX-2. …
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
Mgt: XALATAN is the first of a new class of glaucoma drugs called prostaglandins. Your body produces prostaglandins naturally for many things. In the eye, one particular prostaglandin has been shown to help the fluid in the eye flow out by opening alternative drainage canals, thus keeping the eye pressure from becoming elevated. Xalatan works similarly to this natural prostaglandin and is believed to increase the fluid outflow through this secondary drainage system ...
Aluminum enhances the stimulatory effect of NaF on prostaglandin E2 synthesis in a clonal osteoblast-like cell line, MOB 3-4, in vitro. (1989 ...
I went to my OB yesterday for my first weekly appointment and they did my GBS test. Ill get those results back on Friday so Ill update you next week. He asked me all the normal questions but, again, added a new shocking on in just to make sure I was paying attention. He asked if I would like to plan to have my membranes stripped to help speed up the end of my pregnancy. Stripping membranes is when a physician uses a finger to basically separate the water bag from the cervix which releases prostaglandins to help induce labor. This method is definitely not a sure way to start labor but if everything is progressing well, it shouldnt harm a pregnancy either. But either way, I freaked out. Im totally not ready for this baby to show up any earlier than we have planned ...
Complete information for PTGES3 gene (Protein Coding), Prostaglandin E Synthase 3, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Wielgos M, Szymusik I, Kosinska-Kaczynska K, Suchonska B, Kaminski P, Banaszek-Wysoczanska A, Bomba-Opon D, Szpotanska M. The influence of dinoprostone on uterine cervix ripening and the course of labor. Neuro Endocrinol Lett. 2007 Aug; 28(4): 513-517 ...
p,Hyperproduced prostaglandin E,sub,2,/sub, by cyclooxygenase-2 and microsomal prostaglandin E synthase-1 evokes several pathophysiological responses such as inflammation and carcinogenesis. Our recent study demonstrated that ,i,Dioscorea japonica,/i, extract suppressed the expression of cyclooxygenase-2 and microsomal prostaglandin E synthase-1 and induced apoptosis in lung carcinoma A549 cells. In the present study, we investigated the effects of ,i,Dioscorea japonica,/i, on squamous cell carcinoma of mouse skin. ,i,Dioscorea japonica,/i, feeding and ,i,Dioscorea japonica,/i, extract topical application suppressed the expression of cyclooxygenase-2, microsomal prostaglandin E synthase-1, interleukin-1β and interleukin-6 and inhibited tumor formation, hyperplasia and inflammatory cell infiltration. Immunohistochemical analyses showed the immunoreactivities of cyclooxygenase-2 and microsomal prostaglandin E synthase-1 in tumor keratinocytes and stronger immunoreactivities of cyclooxygenase-2 ...
hypothetical protein, gbf1, Anapl_04335, AS27_01565, AS28_01193, C79137, C9orf15, CB1_000576027, D623_10025025, gamma-interferon-activated transcriptional element-binding factor 1, GATE-binding factor 1, GBF-1, H920_19196, I79_014770, M91_12705, M959_12051, MDA_GLEAN10019304, membrane-associated prostaglandin E synthase 2, membrane-associated prostaglandin E synthase-2, microsomal prostaglandin E synthase 2, microsomal prostaglandin E synthase-2, Mpges2, MPGES-2, mPGE synthase-2, N300_09271, N301_12743, N302_13172, N303_06092, N305_09010, N306_14810, N307_02442, N308_10508, N311_11677, N312_00533, N320_07005, N321_11509, N322_00413, N324_09565, N325_00199, N326_00389, N327_11175, N328_09700, N329_10988, N330_00570, N331_03110, N332_07603, N333_00239, N334_00603, N335_09322, N336_03658, N339_06101, N340_07113, N341_11017, PAL_GLEAN10012478, PANDA_003194, pges2, prostaglandin E receptor 2, prostaglandin E synthase 2-like protein, prostaglandin-H(2) E-isomerase, TREES_T100004307, UY3_04702, ...
Microsomal prostaglandin E synthase-1 (mPGES-1) or Prostaglandin E synthase is an enzyme that in humans is encoded by the PTGES gene. The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53-induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. Prostaglandin E synthase GRCh38: Ensembl release 89: ENSG00000148344 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000050737 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Jakobsson PJ, Thorén S, Morgenstern R, et al. (1989). Identification of human prostaglandin E synthase: a microsomal glutathione-dependent, inducible enzyme, constituting a potential ...
Jegerschold, C.; Pawelzik, S. -C.; Purhonen, P.; Bhakat, P.; Gheorghe, K. R.; Gyobu, N.; Mitsuoka, K.; Morgenstern, R.; Jakobsson, P. -J.; Hebert, H. (2008). Structural basis for induced formation of the inflammatory mediator prostaglandin E2. Proceedings of the National Academy of Sciences. 105 (32): 11110-11115. doi:10.1073/pnas.0802894105. PMC 2516235. PMID 18682561 ...
Prostaglandin E synthase (PGES) including isoenzymes of membrane-associated PGES (mPGES)-1, mPGES-2, and cytosolic PGES (cPGES) is the recently identified terminal enzyme of the arachidonic acid cascade. PGES converts prostaglandin (PG)H2 to PGE2 downstream of cyclooxygenase (COX). We investigated the expression of PGES isoenzyme in articular chondrocytes from patients with osteoarthritis (OA). Chondrocytes were treated with various cytokines and the expression of PGES isoenzyme mRNA was analyzed by the reverse transcription-polymerase chain reaction and Northern blotting, whereas Western blotting was performed for protein expression. The subcellular localization of mPGES-1 was determined by immunofluorescent microscopy. Conversion of arachidonic acid or PGH2 to PGE2 was measured by enzyme-linked immunosorbent assay. Finally, the expression of mPGES-1 protein in OA articular cartilage was assessed by immunohistochemistry. Expression of mPGES-1 mRNA in chondrocytes was significantly induced by
Spinal prostaglandin E receptors of the EP2 subtype and the glycine receptor α3 subunit, which mediate central inflammatory hyperalgesia, do not contribute to pain after peripheral nerve injury or formalin ...
Many human cancers express elevated levels of cyclooxygenase-2 (COX-2), an enzyme responsible for the biosynthesis of prostaglandins. Available clinical data establish the protective effect of COX-2 inhibition on human cancer progression. According to the study by Medical College of Georgia, showed that the COX-2 product prostaglandin E(2) (PGE(2)) acts on cognate receptor EP4 to promote the migration of A549 lung cancer cells. Treatment with PGE(2) enhances tyrosine kinase c-Src activation, and blockade of c-Src activity represses the PGE(2)-mediated lung cancer cell migration. PGE(2) affects target cells by activating four receptors named EP1 to EP4. Use of EP subtype-selective ligand agonists suggested that EP4 mediates prostaglandin-induced A549 lung cancer cellmigration, and this conclusion was confirmed using a short hairpin RNA approach to specifically knock down EP4 expression(7 ...
Inflammation comprises the reaction of the body to injury, in which a series of changes of the terminal vascular bed, blood, and connective tissue tends to eliminate the injurious agent and to repair the damaged tissue. It is a complex process, which involves the release of diverse regulatory mediators. The current anti-inflammatory agents are challenged by multiple side effects and thus, new effective therapies are highly needed. The aim of this review is to summarize the described microsomal prostaglandin E synthase-1 (mPGES-1) inhibitors or transcriptional suppressors from medicinal plants, which could be an ideal approach in the management of inflammatory disorders, but need further clinical trials in order to be ultimately validated ...
Fungsi hormon prostaglandin dalam vesikula seminalis, prostaglandin e2 receptor antagonist, prostaglandin analogues mechanism of action, prostaglandin pill to induce labor, prostaglandin e1, prostaglandin f2 alpha side effects, prostaglandin action on kidney
N-(3,4-dichlorobiphenyl-4-yl)-4-hydroxy-2H-1,2-benzothiazine-3-carboxamide 1,1-dioxide: a microsomal prostaglandin E synthase-1 inhibitor; structure in first source
Ovulation is essential for successful reproduction. The ovulatory luteinizing hormone (LH) surge stimulates periovulatory follicles to produce prostaglandin E2...
Several lines of evidence show that production of PGE2 is enhanced during inflammation, and this lipid mediator can dramatically modulate the immune response (43). Given these observations and because myeloid-derived cells produce large amounts of proinflammatory lipid mediators, we investigated COX expression, PGE2 synthesis, and cytokine production by BM-DC. We reported that production of AA-derived metabolites did not require the addition of exogenous substrate, because BM-DC are able to produce PGE2 and LTB4 under the two experimental conditions, and these APC express cytosolic PLA2, which catalyzes the release of endogenous AA from the cell membrane. The expression of cPLA2 is up-regulated by LPS in a dose-dependent fashion, and an important liberation of AA was observed in LPS-treated BM-DC compared with control cells. These data are consistent with previous studies, which reported induction of cPLA2 by LPS in human leukocytes (44, 45). Analysis of COX expression shows that resting BM-DC ...
Welcome to the Prostaglandin E{1} Liposomal, PGE{1} information hub. Featuring active ingredients, dosages, related medications, and Prostaglandin E{1} Liposomal, PGE{1} forums.
CBR1_HUMAN RecName: Full=Carbonyl reductase [NADPH] 1; AltName: Full=15-hydroxyprostaglandin dehydrogenase [NADP(+)]; AltName: Full=NADPH-dependent carbonyl reductase 1; AltName: Full=Prostaglandin 9-ketoreductase; AltName: Full=Prostaglandin-E(2) 9-reductase ...
Serono was developing dual agonists of the prostaglandin E2 and E4 (EP2 and EP4) receptors for the treatment of asthma. The compounds are analogues of
SR GROUP - Exporter, Importer, Manufacturer, Distributor, Supplier, Trading Company of Hydroxy Prostaglandin E1 Chemical based in Delhi, India
[118 Pages Report] Check for Discount on Global Prostaglandin E2 Market Professional Survey Report 2017 report by QYResearch Group. Notes: Production, means the output of Prostaglandin E2 Revenue, means...
PTGES2 - PTGES2 (untagged)-Human prostaglandin E synthase 2 (PTGES2), transcript variant 1 available for purchase from OriGene - Your Gene Company.
deCODE genetics (a subsidiary of Amgen) was researching the potential for inhibitors of the EP3 receptor for prostaglandins E2 as novel, safer, non-opiate-based
We investigated the mechanisms by which inhibitors of prostaglandin G/H synthase-2 (PGHS-2; known colloquially as COX-2) increase… Expand ...
PROSTAGLANDIN-E2 LEVELS IN THE MEMBRANE SURROUNDING BULK AND PARTICULATE POLYMETHYLMETHACRYLATE IN THE RABBIT TIBIA - A PRELIMINARY-STUDY
BACKGROUND: Microsomal prostaglandin (PG) E(2) synthase-1 (mPGES-1) catalyzes isomerization of the cyclooxygenase product PGH(2) into PGE(2). Deletion of mPGES-1 modulates experimentally evoked pain and inflammation and retards atherogenesis. The role of mPGES-1 in abdominal aortic aneurysm is unknown. METHODS AND RESULTS: The impact of mPGES-1 deletion on formation of angiotensin ...
PGE2, 1 ml. Prostaglandin E2 (PGE2) is an extensively studied prostaglandin owing to its predominance in inflammation, cancer, atherosclerosis, autoimmune disease, and sepsis.
TY - JOUR. T1 - Effect of lithium on prostaglandin E1- stimulated adenylate cyclase activity of human platelets. AU - Yao-Chun, Wang. AU - Pandey, Ghanshyam N.. AU - Mendels, Joe. AU - Frazer, Alan. PY - 1974/2/15. Y1 - 1974/2/15. N2 - The effect of lithium (Li) on the stimulation of adenylate cyclase by prostaglandin E1(PGE1) was examined. In platelet sonicates, Li, as well as sodium (Na), potassium (K), and rubidium (Rb) significantly reduced the PGE1-induced stimulation of adenylate cyclase in a dose-dependent manner. The inhibition due to Rb was significantly less than that produced by the other cations; at a high concentration, 64 mM, Li was a more potent inhibitor than the other cations. In intact platelets, only Li reduced the PGE1-enhanced accumulation of [3H]cyclic AMP, K and Rb being ineffective. As little as 1 mM Li significantly reduced the stimulatory effect of PGE1 on [3H]cyclic AMP production in this sytem. The inhibition produced by Li was not blocked by phentolamine, whereas ...
Accepted name: 15-hydroxyprostaglandin dehydrogenase (NAD+). Reaction: (5Z,13E,15S)-11α,15-dihydroxy-9-oxoprost-5,13-dienoate + NAD+ = (5Z,13E)-11α-hydroxy-9,15-dioxoprost-5,13-dienoate + NADH + H+. Other name(s): NAD+-dependent 15-hydroxyprostaglandin dehydrogenase (type I); PGDH; 11α,15-dihydroxy-9-oxoprost-13-enoate:NAD+ 15-oxidoreductase; 15-OH-PGDH; 15-hydroxyprostaglandin dehydrogenase; 15-hydroxyprostanoic dehydrogenase; NAD-specific 15-hydroxyprostaglandin dehydrogenase; prostaglandin dehydrogenase; 15-hydroxyprostaglandin dehydrogenase (NAD). Systematic name: (5Z,13E,15S)-11α,15-dihydroxy-9-oxoprost-5,13-dienoate:NAD+ 15-oxidoreductase. Comments: Acts on prostaglandin E2, F2α and B1, but not on prostaglandin D2. cf. EC 1.1.1.196 15-hydroxyprostaglandin-D dehydrogenase (NADP+) and EC 1.1.1.197 15-hydroxyprostaglandin dehydrogenase (NADP+).. Links to other databases: BRENDA, EXPASY, GTD, KEGG, Metacyc, PDB, CAS registry number: 9030-87-9. References:. 1. Änggård, E. and Samuelsson, ...
TY - JOUR. T1 - mPGES-1 deletion impairs diuretic response to acute water loading. AU - Soodvilai, Sunhapas. AU - Jia, Zhanjun. AU - Wang, Mong Heng. AU - Dong, Zheng. AU - Yang, Tianxin. PY - 2009/5. Y1 - 2009/5. N2 - PGE2 has an established role in renal water handling. The present study was undertaken to examine the role of microsomal prostaglandin E synthase-1 (mPGES-1) in the diuretic response to acute and chronic water loading. Compared with wild-type (+/+) controls, mPGES-1 -/- mice exhibited impaired ability to excrete an acute, but not chronic water load. In response to acute water loading, urinary PGE2 excretion in the +/+ mice increased at 2 h, in parallel with increased urine flow. In contrast, the -/- mice exhibited a delayed increase in urinary PGE2 excretion, coinciding with the stimulation of renal medullary mRNA expression of cytosolic prostaglandin E synthase but not mPGES-2. At baseline, renal aquaporin-2 (AQP2) expression in mPGES-1 -/- mice was enhanced compared with the +/+ ...
Inhibition of neuronal cyclooxygenase-2 (COX-2) and hence prostaglandin E2 (PGE2) synthesis by non-steroidal anti-inflammatory drugs has been suggested to protect neuronal cells in a variety of pathophysiological situations including Alzheimers disease and ischemic stroke. Ascorbic acid (vitamin C) has also been shown to protect cerebral tissue in a variety of experimental conditions, which has been attributed to its antioxidant capacity. In the present study, we show that ascorbic acid dose-dependently inhibited interleukin-1beta (IL-1beta)-mediated PGE2 synthesis in the human neuronal cell line, SK-N-SH. Furthermore, in combination with aspirin, ascorbic acid augmented the inhibitory effect of aspirin on PGE2 synthesis. However, ascorbic acid had no synergistic effect along with other COX inhibitors (SC-58125 and indomethacin). The inhibition of IL-1beta-mediated PGE2 synthesis by ascorbic acid was not due to the inhibition of the expression of COX-2 or microsomal prostaglandin E synthase ...
Nonsteroidal anti-inflammatory drugs selective for inhibition of cyclooxygenase 2 (COX-2) were developed to conserve the analgesic and anti-inflammatory efficacy of older nonsteroidal anti-inflammatory drugs that inhibited cyclooxygenase 1 and COX-2, while reducing the likelihood of gastrointestinal adverse effects. Although this objective was broadly attained, COX-2 inhibitors, which turned out to include some older nonsteroidal anti-inflammatory drugs like diclofenac, also caused thrombotic events, hypertension, and cardiac failure attributable to suppression of COX-2-derived PGI2. The microsomal prostaglandin E synthase-1 (mPGES-1) enzyme is downstream of COX-2 and accounts for most of the prostaglandin E2 that is formed in humans. Some, but not all studies in mice lacking mPGES-1 suggest analgesic and anti-inflammatory efficacy similar to nonsteroidal anti-inflammatory drugs. Most, but not all studies suggest that unlike COX-2 disruption or inhibition, global mPGES-1 deletion does not ...
Microsomal prostaglandin E synthase-1 (mPGES-1) constitutes a drug target for inflammation, fever and pain. mPGES-1 catalyzes the biosynthesis of prostaglandin (PG) E2 from cyclooxygenase (Cox) -derived PGH2, which in turn is derived from arachidonic acid. mPGES-1 is mainly associated with inflammation and it is known to be up regulated by various pro-inflammatory cytokines like IL-1 beta and TNF-alpha. Mice devoid of mPGES-1 activity display resistance to development of experimental arthritis, fever, pain, symptoms following stroke, atherosclerosis and breathing anomalies induced by hypoxia. Conversely, the enzyme seems to have a protective role in wound healing and remodeling following myocardial infarction. Inhibitors of mPGES-1 have been developed by several groups. However, their characterization in animal models of inflammation, or other models previously used to study mPGES-1 knock-out mice, remains limited. One reason is the fact that a majority of the potent inhibitors of human mPGES-1 ...
Breast cancer is a major cause of death worldwide. Human cytochrome P450 (CYP) 1B1 is a key enzyme in the metabolism of 17β-estradiol, and CYP1B1-metabolized 4-hydroxyestradiol is a marker for breast cancer. Furthermore, overexpression of cyclooxygenase-2 (COX-2), which produces prostaglandin E2 (PGE2), has been detected in invasive breast carcinomas. However, the interaction between PGE2 and CYP1B1 expression in human breast cancer is unclear. Here, we investigated the effect of PGE2 on CYP1B1 expression and its mechanism in breast cancer cells. PGE2 significantly increased CYP1B1 protein and messenger RNA expression and dose dependently enhanced CYP1B1 promoter activity in human breast cancer MCF-7 cells. Transient transfection with human CYP1B1 (hCYP1B1) deletion promoter constructs and cotreatment with inhibitors revealed that the estrogen response element contributed to the effects of PGE2. CYP1B1 expression was not affected by PGE2 in estrogen receptor (ER) α-negative MDA-MB-231 breast ...
TY - JOUR. T1 - Prostaglandins and host defense in cancer. AU - Goodwin, J. S.. PY - 1981/1/1. Y1 - 1981/1/1. N2 - The whole relationship between prostaglandins and cancer has not received the attention it should from experimental oncologists. This may be because the whole area of prostaglandins is immensely confusing, with different cyclo-oxygenase metabolites having completely opposite results. Thus when one adds a cyclo-oxygenase inhibitor to a system, any result is possible. It is not even settled whether PGE has a physiologic role or is merely a metabolite of an unstable intermediate compound that is the real PG, or whether the effects of cyclo-oxygenase inhibitors are because of inhibition of production of the classic prostaglandins (PGE and PGF) or by inhibition of production of thromboxanes, prostacyclin, etc. This lack of precise definition of the system tends to discourage precision in experimentation, which in turn tends to keep careful investigators out of the area. The ...
Systemic inflammation, which results from the massive release of proinflammatory molecules into the circulatory system, is a major risk factor for severe illness, but the precise mechanisms underlying its control are not fully understood. We observed that prostaglandin E2 (PGE2), through its receptor EP4, is down-regulated in human systemic inflammatory disease. Mice with reduced PGE2 synthesis develop systemic inflammation, associated with translocation of gut bacteria, which can be prevented by treatment with EP4 agonists. Mechanistically, we demonstrate that PGE2-EP4 signaling acts directly on type 3 innate lymphoid cells (ILCs), promoting their homeostasis and driving them to produce interleukin-22 (IL-22). Disruption of the ILC-IL-22 axis impairs PGE2-mediated inhibition of systemic inflammation. Hence, the ILC-IL-22 axis is essential in protecting against gut barrier dysfunction, enabling PGE2-EP4 signaling to impede systemic inflammation. ...
Cancerous cells produce large quantities of prostaglandin E2 (PGE2) which enables the tumor to lower the immune systems normal attack response. Aspirin, which is a type of drug known as a COX inhibitor, blocks the production of PGE2.. Weve added to the growing evidence that some cancers produce PGE2 as a way of escaping the immune system, said team leader Professor Caetano Reis e Sousa. If you can take away cancer cells ability to make PGE2, you effectively lift this protective barrier and unleash the full power of the immune system.. The researchers from Francis Crick Institute in London were able to slow the growth of bowel and melanoma cancers in mice.. In their current form, immunotherapy drugs are very expensive. The possibility that a cheap, commonly used drug could boost their effectiveness gives hope that less drugs will be needed and the soaring costs of cancer treatment will be more manageable.. Once you stop the cancer cells from producing [PGE2], the immune system switches ...
Jung, A., Schlegel, W., Jackisch, R., Friedrich, E.J., Wendel, A., Rückrich, M.F.: Hoppe-Seylers Z. Physiol. Chem., 356, 787-798 (1975)PubMedCrossRefGoogle Scholar ...
Prirodni prostaglandin E2 (PGE2) je poznat u medicini kao dinoproston. On ima važnu ulogu pri porođaju, a isto tako stimuliše osteoblaste da otpuste faktore koji stimulišu koštanu resorpciju. PGE2 je prostaglandin koji indukuje groznicu.. On je dostupan na tržištu pod imenima Cervidil, Prostin E2, Propes i Glandin, kao vaginalni supozitorijum, kojim se priprema cerviks za porođaj.. Poput drugih prostaglandina, dinoproston se može koristiti kao abortifacijent. On je direktni vazodilatator, koji ralaksira glatke mišiće, i inhibira otpuštanje noradrenalina iz simpatetičkih nervih terminala. On ne inhibira agregaciju trombocita, za razliku od PGI2.. On deluje putem vezivanja i aktivacije prostaglandinskog E2 receptor.. ...
|p|Ki = 9.1, 4.9, 0.33, 0.79 nM for EP1, EP2, EP3, and EP4 receptors respectively [1]|/p||p|Prostaglandin E2 (PGE2) is lipid-derived autacoid which is the main effector prostanoid produced in the zebrafish, and it works by binding and activating the PGE2
Find out about the science and chemistry of Prostaglandin (Prostaglandin I2), see colourful images of Prostaglandin and explore interactive 3D molecules of Prostaglandin
Autocrine prostaglandin E2 signaling promotes promonocytic leukemia cell survival via COX-2 expression and MAPK pathway;kpubs;kpubs.org
Prostaglandin E1 (PGE1) and E2 (PGE2) are ligands for the prostaglandin E2 receptor (EP) family, which consists of four subtype receptors, designated as EP1, EP2, EP3 and EP4. Interestingly, PGE2 mediates inflammation ...
bom:102271174 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] , (RefSeq) PTGS2; prostaglandin-endoperoxide synthase 2 (A) MLARALLLCAAVALSGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL TRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKY QMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTRQRAGRV AGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL YGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV GFKIINTASIQSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER STEL ...
bom:102287995 K00509 prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1] , (RefSeq) PTGS1; prostaglandin-endoperoxide synthase 1 (A) MSRQGISLRFPLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT RTGYSGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE LTGEKEMAAELEELYGDINALEFYLGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC SPEYWKASTFGGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL ...
Academic Dissertations;Academic Dissertations--South Carolina;Endotoxins--physiology;GTP-binding proteins--physiology;Macrophages;Dinoprostone;Prostaglandins;Prostaglandins ...
DI-fusion, le Dépôt institutionnel numérique de lULB, est loutil de référencementde la production scientifique de lULB.Linterface de recherche DI-fusion permet de consulter les publications des chercheurs de lULB et les thèses qui y ont été défendues.
Prostaglandins have many functions in the body, sometimes having opposite effects to each other. Well discuss function, purpose, and what can go wrong.
PROSTAGLANDINS/ACM11000263 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
Gentaur molecular products has all kinds of products like :search , ATGen \ PTGES2, 1-186aa, Human, His tag, E.coli \ ATGP1059 for more molecular products just contact us
ab120295 NS 398, COX-2 inhibitor (CAS番号: 123653-11-2) 分子量: 314.36 化学式: C13H18N2O5S COX-2 阻害剤 アブカムの高純度な生理活性物質(アゴニスト・アンタゴニスト・アクティベーター・阻害剤)
Интерлеукин 17A је протеин који је код људи кодиран IL17A геном.[1][2][3] Протеин кодиран овим геном је проинфламаторни цитокин произведен активираним Т ћелијама.[4] Овај цитокин регулише активности НФ-капаБ и митоген активираних протеин киназа. Овај цитокин може да стимулише изражавање ИЛ-6 и циклооксигеназе-2 (PTGS2/COX-2), као и да појача продукцију нитрик оксида (NO). Високи нивои овог цитокина су асоцирани са неколико хроничних инфламаторних обољења укључујући реуматоидни артритис, псоријазу и мултиплу склерозу.[2] ...
"Dinoprostone". Drug Information Portal. U.S. National Library of Medicine. Prostaglandins+E at the US National Library of ... Types include: Prostaglandin E1 also known as alprostadil Prostaglandin E2 also known as dinoprostone Both types are on the ...
"Dinoprostone topical Use During Pregnancy". Drugs.com. 17 December 2019. Retrieved 27 July 2020. "Dinoprostone". The American ... The abortion should occur within 24 hours after the beginning of administration of dinoprostone; if it does not, dinoprostone ... Dinoprostone is used in labor induction, bleeding after delivery, termination of pregnancy, and in newborn babies to keep the ... Dinoprostone has important effects in labor by inducing softening of the cervix and causing uterine contraction, and also ...
"Dinoprostone". pubchem.ncbi.nlm.nih.gov. Retrieved 21 July 2020. "Dinoprostone (Vaginal Route) Proper Use - Mayo Clinic". www. ... Both synthetic oxytocin (Pitocin) and dinoprostone (Cervidil, Prepidil) are routinely used during healthy, term labor. Pitocin ...
Dinoprostone (Prostin E2) An alternative prostaglandin to misoprostol. After the medication is administered, the mother should ...
... is a synthetic prostaglandin designed to resemble dinoprostone. Enprostil was found to be a highly potent inhibitor ...
Dinoprostone. PGE2. labor induction. Iloprost. PGI2 analog. pulmonary artery hypertension Latanoprost. PGF2α analog. Glaucoma, ...
DINOPROSTONE 156. DIPHENOXYLATE, ITS SALTS 157. DIPIVEFRIN HYDROCHLORIDE 158. DI-SODIUM PAMIDRONATE ...
For example, prostamide E2 is the ethanolamide of prostaglandin E2 (dinoprostone). The anti-glaucoma drug bimatoprost is a ...
This article is about the pharmaceutical agent 'dinoprost'. For the drug 'dinoprostone', see Prostaglandin E2. ...
Prostaglandin E2 (dinoprostone). *Treprostinil. *Antagonists: AH-6809. *PF-04418948. *TG 4-155 ...
The US National Institute of Health's MedlinePlus lists medical conditions for which EPA (alone or in concert with other ω-3 sources) is known or thought to be an effective treatment.[18] Most of these involve its ability to lower inflammation. Intake of large doses (2.0 to 4.0 g/day) of long-chain omega-3 fatty acids as prescription drugs or dietary supplements are generally required to achieve significant (, 15%) lowering of triglycerides, and at those doses the effects can be significant (from 20% to 35% and even up to 45% in individuals with levels greater that 500 mg/dL). It appears that both EPA and DHA lower triglycerides; however, DHA appears to raise low-density lipoprotein (the variant which drives atherosclerosis, sometimes inaccurately called "bad cholesterol") and LDL-C values (always only a calculated estimate; not measured by labs from person's blood sample for technical and cost reasons), while EPA does not. EPA and DHA ethyl esters (all forms) may be absorbed less well, thus ...
Leukotriene B4 (i.e. LTB4) is an arachidonic acid metabolite made by the 5-lipoxygenase enzyme pathway. It activates cells through both its high affinity (Dissociation constant [Kd] of 0.5-1.5 nM) Leukotriene B4 receptor 1 (BLT1 receptor) and its low affinity BLT2 receptor (Kd=23 nM); both receptors are G protein coupled receptors that, when ligand-bound, activate cells by releasing the Gq alpha subunit and pertussis toxin-sensitive Gi alpha subunit from Heterotrimeric G proteins.[19][20] BLT1 receptor has a high degree of ligand-binding specificity: among a series of hydroxylated eicosanoid metabolites of arachidonic acid, it binds only LTB4, 20-hydroxy-LTB4, and 12-epi-LTB4; among this same series, BLT2 receptor has far less specificity in that it binds not only LTB4, 20-hydroxy-LTB4, and 12-epi-LTB4 but also 12(R)-HETE and 12(S)-HETE (i.e. the two stereoisomers of 12-Hydroxyeicosatetraenoic acid) and 15(S)-HpETE and 15(S)-HETE (i.e. the two stereoisomers of 15-Hydroxyicosatetraenoic ...
Prostaglandin E2 (dinoprostone). *Treprostinil. *Antagonists: AH-6809. *PF-04418948. *TG 4-155 ...
Pharmacological methods include dinoprostone (prostaglandin E2), misoprostol (a prostaglandin E1 analogue), and intravenous ... Intravaginal, endocervical or extra-amniotic administration of prostaglandin, such as dinoprostone or misoprostol. ...
It can be less expensive than the other commonly used ripening agent, dinoprostone. Oxytocin has long been used as the standard ...
Dinoprostone: commonly known as PGE2, has the ability to stimulate both contractility and relaxation in the uterus during ... Wang L, Zheng J, Wang W, Fu J, Hou L (2016). "Efficacy and safety of misoprostol compared with the dinoprostone for labor ...
Vukelić J (2001). "Second trimester pregnancy termination in primigravidas by double application of dinoprostone gel and ...
... of intermittent vaginal administration of two different doses of misoprostol suppositories with continuous dinoprostone for ...
വിവരങ്ങൾ ക്രിയേറ്റീവ് കോമൺസ് ആട്രിബ്യൂഷൻ-ഷെയർഎലൈക്ക് അനുമതിപത്ര പ്രകാരം ലഭ്യമാണ്; മേൽ നിബന്ധനകൾ ഉണ്ടായേക്കാം. കൂടുതൽ വിവരങ്ങൾക്ക് ഉപയോഗനിബന്ധനകൾ കാണുക ...
... or disrupt the vasopressin circuitry and feedback loops.Carbetocin may work synergistically with drugs such as dinoprostone and ...
... dinoprostone vaginal insert) for the initiation and/or continuation of cervical ripening in certain patients Combunox ( ...
There is less evidence supporting the usefulness chemical dissection (such as with mesna), vaginal insertion of dinoprostone, a ...
... dinoprostone (INN) dinsed (INN) diodone (INN) Dionosil Aqueous diosmin (INN) Diovan dioxadilol (INN) dioxadrol (INN) dioxamate ...
... namely oxytocin and dinoprostone. A small market and the high risk of medicolegal action, as exemplified by the Bendectin case ...
... dinoprostone MeSH D10.251.355.255.100.637.400 - prostaglandins f MeSH D10.251.355.255.100.637.400.200 - dinoprost MeSH D10.251. ... dinoprostone MeSH D10.251.355.255.550.400 - prostaglandins f MeSH D10.251.355.255.550.400.200 - dinoprost MeSH D10.251.355.255. ...
... combinations G02AC01 Methylergometrine and oxytocin QG02AC90 Ergometrine and oxytocin G02AD01 Dinoprost G02AD02 Dinoprostone ...
... dinoprostone MeSH D23.469.050.175.725.790 - prostaglandins f MeSH D23.469.050.175.725.790.185 - dinoprost MeSH D23.469.050.175. ...
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, you agree to the Terms of Use and Privacy Policy. Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc., a non-profit organization ...
Prostaglandin E2 (dinoprostone). *Treprostinil. *Antagonists: AH-6809. *PF-04418948. *TG 4-155 ...
Prostaglandin E2 (dinoprostone). *Treprostinil. *Antagonists: AH-6809. *PF-04418948. *TG 4-155 ...
Dinoprostone: learn about side effects, dosage, special precautions, and more on MedlinePlus ... Before taking dinoprostone,. *tell your doctor and pharmacist if you are allergic to dinoprostone or any other drugs. ... Dinoprostone comes as a vaginal insert and as a gel that is inserted high into the vagina. It is administered using a syringe, ... Side effects from dinoprostone are not common, but they can occur. Tell your doctor if any of these symptoms are severe or do ...
DINOPROSTONE(dye noe PROST one) is used to help dilate the cervix in pregnant women who are at or near term. ... Dinoprostone, Prostaglandin E2 vaginal insert. What is this medicine?. DINOPROSTONE(dye noe PROST one) is used to help dilate ... an unusual or allergic reaction to dinoprostone, prostaglandins, other medicines, foods, dyes, or preservatives ...
Dinoprostone topical is used in a pregnant woman to relax the muscles of the cervix (opening of the uterus) in preparation for ... Dinoprostone is a prostaglandin, a hormone-like substance that is naturally produced by tissues in the body. ... How is dinoprostone topical given?. Dinoprostone is a gel that is placed directly onto the cervix through the vagina using a ... What is dinoprostone topical?. Dinoprostone is a prostaglandin, a hormone-like substance that is naturally produced by tissues ...
Dinoprostone) may treat, uses, dosage, side effects, drug interactions, warnings, patient labeling, reviews, and related ... dinoprostone) Vaginal Insert. DESCRIPTION. Dinoprostone vaginal insert is a thin, flat, polymeric slab which is rectangular in ... The dosage of dinoprostone in the vaginal insert is 10 mg designed to be released at approximately 0.3 mg/hour over a 12 hour ... Dinoprostone occurs as a white to off-white crystalline powder. It has a melting point within the range of 65° to 69°C. ...
Detailed Dinoprostone Topical dosage information for adults. Includes dosages for Abortion, Labor Induction and Trophoblastic ... Labor Induction misoprostol, oxytocin, Cytotec, Pitocin, Cervidil, dinoprostone topical, Syntocinon, Prostin E2, More... ... Abortion misoprostol, oxytocin, Cytotec, Pitocin, mifepristone, Cervidil, Hemabate, dinoprostone topical, More.... ... Trophoblastic Disease methotrexate, Trexall, Cervidil, dinoprostone topical, dactinomycin, Prostin E2, Cosmegen, More... ...
Dinoprostone is a naturally occurring prostaglandin E2 (PGE2). It has important effects in labour. It also stimulates ... Dinoprostone. Accession Number. DB00917 (APRD00927) Type. Small Molecule. Groups. Approved. Description. Dinoprostone is a ... The excretion of Dinoprostone can be decreased when combined with Acetazolamide.. Acetylcholine. The risk or severity of ... Dinoprostone. Insert. 10 mg/241mg. Vaginal. Ferring Pharmaceuticals. 2014-02-01. Not applicable. US. ...
Dinoprostone Vaginal Suppository) may treat, side effects, dosage, drug interactions, warnings, patient labeling, reviews, and ... Dinoprostone occurs as a white crystalline powder. It has a melting point within the range of 64° to 71°C. Dinoprostone is ... Dinoprostone is not indicated if the fetus in utero has reached the stage of viability. Dinoprostone should not be considered a ... In laboratory animals, and also in man, dinoprostone can elevate body temperature. With the clinical doses of dinoprostone used ...
Intravaginal Misoprostol Versus Dinoprostone Before Diagnostik Hysteroscopy. The safety and scientific validity of this study ... Experimental: dinoprostone and control For the purpose of cervical ripening none procedure will be performed to Group 1, while ... Experimental: Dinoprostone and misoprostol For the purpose of cervical ripening none procedure will be performed to Group 1, ... Dinoprostone. Abortifacient Agents, Nonsteroidal. Abortifacient Agents. Reproductive Control Agents. Physiological Effects of ...
Dinoprostone topical syrup prepared with dinoprostone should be taken around changing the time of ovulation if you are trying ... Dinoprostone topical syrup prepared with dinoprostone should be taken around changing the time of ovulation if you are trying ... Dinoprostone shows had a marked affinity to tenofovir disoproxil and vultures the intensity of this is governed by the ph ... forest labs gains approval for Dinoprostone topical antidepressant * cadila settles patent litigation related to Simply beige ...
Dinoprostone: The most common and most biologically active of the mammalian prostaglandins. It exhibits most biological ... Dinoprostone (PGE2). Subscribe to New Research on Dinoprostone The most common and most biologically active of the mammalian ... 01/01/2012 - "The efficacy of dinoprostone vaginal insert for active management of premature rupture of membranes at term: a ... 05/01/2011 - "Induction of labor and pain: a randomized trial between two vaginal preparations of dinoprostone in nulliparous ...
Drug: Dinoprostone Application of Propess-vaginal-insert, (Dinoprostone 10mg - Ferring Arzneimittel Ges.m.b.H., 1100 Vienna, ... 2 times application of dinoprostone-vaginal-insert in therapy arm 1 and 3 times application of dinoprostone-vaginal-insert in ... Drug Information on Dinoprostone Publications: Martin JA, Hamilton BE, Sutton PD, Ventura SJ, Menacker F, Kirmeyer S. Births: ... Efficacy of Induction of Labor on Term Using a Double Balloon Catheter Compared to Dinoprostone Vaginal-insert. The safety and ...
... is used for several purposes, such as preparing the cervix for delivery or causing an abortion. This eMedTV page ... Interested in a Discount on Dinoprostone?. Our free DiscountRx savings card can help you and your family save money on your ... Click Dinoprostone Side Effects to learn more, including potentially serious side effects you should report immediately to your ... Dinoprostone. Drug Facts and Comparisons. Drug Facts and Comparisons 4.0 [online]. 2012. Available from Wolters Kluwer Health, ...
Get up-to-date information on Dinoprostone side effects, uses, dosage, overdose, pregnancy, alcohol and more. Learn more about ... How was your experience with Dinoprostone?. First, a little about yourself. Male Female ... Dinoprostone is used to prepare the cervix for the induction of labor in pregnant women who are at or near term. Can cause ... Dinoprostone comes as a vaginal insert, suppository, and as a gel that is inserted into the vagina. It is administered by a ...
... dinoprostone), frequency-based adverse effects, comprehensive interactions, contraindications, pregnancy & lactation schedules ... encoded search term (dinoprostone (Cervidil%2C Prepidil)) and dinoprostone (Cervidil, Prepidil) What to Read Next on Medscape ... dinoprostone (Rx). Brand and Other Names:Cervidil, Prepidil, more...Prostaglandin E2, Prostin E2 ... Use of dinoprostone-containing products may result in inadvertent disruption and subsequent embolization of antigenic tissue ...
dinoprostone (generic name). Cervidil (brand name). It is used to help dilate the cervix in pregnant women who are at or near ... DINOPROSTONE, PROSTAGLANDIN E2 (dye noe PROST one; pros tuh GLAN din) is used to help dilate the cervix in pregnant women who ... an unusual or allergic reaction to dinoprostone, prostaglandins, other medicines, foods, dyes, or preservatives ...
... s contain a synthetic hormone that helps prepare the cervix for childbirth. This eMedTV resource ... What Is the Dinoprostone Vaginal Insert?. The dinoprostone vaginal insert (Cervidil®) is a prescription medication approved to ... The active ingredient in this medication is dinoprostone. Dinoprostone is also available in gel form (Prepidil®). ... Dinoprostone Vaginal Insert. Women who are close to the time of delivery and have a medical need for labor to be induced may be ...
Aim To assess the safety and efficacy of a second 10 mg dinoprostone (Prostaglandin E2) pessary inserted 24 hours after initial ... Introduction There is no guideline advising on the management of women in whom induction of labour with first dinoprostone ... 12 women (63%) achieved active labour following insertion of the 2nd dinoprostone pessary, and 10 of these (83%) delivered ... Conclusion Successful induction of labour can be achieved safely with second dinoprostone pessary following failed initial ...
Dinoprostone (Into the vagina). Dinoprostone (dye-noe-PROST-one). Helps dilate the opening of the uterus (cervix) in a pregnant ... You should not receive this medicine if you have had an allergic reaction to dinoprostone.. How to Use This Medicine: Insert, ...
A model was developed to evaluate the resource use associated with misoprostol vaginal inserts (MVIs) and dinoprostone vaginal ... Reduction in resource use with the misoprostol vaginal insert vs the dinoprostone vaginal insert for labour induction: a model- ... A model was developed to evaluate the resource use associated with misoprostol vaginal inserts (MVIs) and dinoprostone vaginal ... compared to dinoprostone) can be achieved. However, misoprostol tablets are not licensed for use in labour induction [13-18] ...
Efficacy and safety of intravaginal misoprostol versus intracervical dinoprostone for labor induction at term: A systematic ... Aim: Recent studies suggest that misoprostol may be more effective than dinoprostone in pregnant women with unfavorable cervix ... Further high-quality studies assessing the possible effectiveness of misoprostol and dinoprostone in selected groups of ... Conclusion: Intravaginal misoprostol appears to be more efficient for labor induction than intracervical dinoprostone; however ...
... vaginal dinoprostone (delivered via a controlled-release vaginal insert containing 10 mg of dinoprostone, for up to 24 h); 2) ... Recent studies have compared treatment with various titrated doses of oral misoprostol with vaginal misoprostol or dinoprostone ... oral or vaginal misoprostol or vaginal dinoprostone) achieves the highest rate of vaginal delivery within the first 24 h of ... Vaginal dinoprostone. Dinoprostone, a synthetic analogue of prostaglandin E2, is available in various formulations, including ...
Misoprostol and dinoprostone are equally safe for the induction of labor in pregnancies that are at high risk of fetal distress ... The purpose of this study was to compare the safety and efficacy of misoprostol and dinoprostone in pregnancies at high risk of ... A randomized trial that compared intravaginal misoprostol and dinoprostone vaginal insert in pregnancies at high risk of fetal ... the trial was stopped because no significant difference was found in neonatal safety between misoprostol and dinoprostone, ...
Dinoprostone, oxytocin Primary outcome measure. Primary outcomes will be measured at or soon after delivery:. 1. Proportion ... Vaginal dinoprostone and oxytocin infusion versus vaginal placebo and oxytocin infusion to induce labour.. Women randomised to ... Concurrent vaginal dinoprostone and oxytocin infusion versus oxytocin infusion for labour induction in term nulliparous with ... Concurrent vaginal dinoprostone and oxytocin infusion compared to placebo and oxytocin infusion shortens the labour induction ...
... What is this medicine?. DINOPROSTONE (dye noe PROST one) is used to help dilate ... an unusual or allergic reaction to dinoprostone, prostaglandins, other medicines, foods, dyes, or preservatives ...
Dinoprostone is a natural substance (prostaglandin) that your body makes in preparation for labor. It softens and widens the ...
Dinoprostone, Prostaglandin E2 vaginal insert. What is this medicine?. DINOPROSTONE(dye noe PROST one) is used to help dilate ... an unusual or allergic reaction to dinoprostone, prostaglandins, other medicines, foods, dyes, or preservatives ...
The generic name of Prostin E2 is dinoprostone. ... Dinoprostone Dinoprostone is pronounced as (dye noe prost one) ... Dinoprostone occurs as a white crystalline powder. It has a melting point within the range of 64° to 71°C. Dinoprostone is ... Dinoprostone is not indicated if the fetus in utero has reached the stage of viability. Dinoprostone should not be considered a ... Why is dinoprostone medication prescribed?. Dinoprostone is used to prepare the cervix for the induction of labor in pregnant ...
Dinoprostone (Into the vagina). Dinoprostone (dye-noe-PROST-one). Helps dilate the opening of the uterus (cervix) in a pregnant ... You should not receive this medicine if you have had an allergic reaction to dinoprostone. ...
Dinoprostone Prostaglandin E2 fda sheet Dinoprostone Prostaglandin E2 msds (material safety sheet) Dinoprostone_Prostaglandin_ ... Dinoprostone Prostaglandin E2 LogP 1.949 Dinoprostone Prostaglandin E2 Dosage Forms Gel; Insert (suppository containing 20 mg ... Dinoprostone Prostaglandin E2 Synthesis Reference No information avaliable Dinoprostone Prostaglandin E2 Molecular Weight ... Dinoprostone Prostaglandin E2 Patient Information No information avaliable Dinoprostone Prostaglandin E2 Organisms Affected ...
Buy best quality of Primigyn Dinoprostone 0.5 mg Gel from us. ... Distributor of Primigyn Dinoprostone 0.5 mg Gel from Mumbai, ... Dinoprostone gel is a prostaglandin. It works by causing softening and dilation of the cervix. ... Dinoprostone gel is used for inducing labor in pregnant women at term or near term. ...
  • Dinoprostone is a naturally occurring prostaglandin E2 (PGE2). (drugbank.ca)
  • Dinoprostone is equivalent to prostaglandin E2 (PGE2). (drugbank.ca)
  • PROSTIN E2 Vaginal Suppository, an oxytocic, contains dinoprostone as the naturally occurring prostaglandin E2 (PGE2). (rxlist.com)
  • Aim To assess the safety and efficacy of a second 10 mg dinoprostone (Prostaglandin E2) pessary inserted 24 hours after initial failure of cervical ripening. (bmj.com)
  • Dinoprostone, a synthetic analogue of prostaglandin E2, is available in various formulations, including intracervical gel, controlled-release vaginal systems, and vaginal tablets. (biomedcentral.com)
  • Types include: Prostaglandin E1 also known as alprostadil Prostaglandin E2 also known as dinoprostone Both types are on the World Health Organization's List of Essential Medicines. (wikipedia.org)
  • Prostaglandin E2 (PGE2), also known as dinoprostone, is a naturally occurring prostaglandin with oxytocic properties that is used as a medication. (wikipedia.org)
  • Prostaglandin F2α (dinoprost) and prostaglandin E2 (dinoprostone) possess expressed influence on contractility of myometrium. (wikiversity.org)
  • Vaginally-administered dinoprostone is recommended for cervical ripening prior to labour induction in the UK, augmented with oxytocin as required [ 7 , 8 ]. (biomedcentral.com)
  • Concurrent vaginal dinoprostone and oxytocin infusion compared to placebo and oxytocin infusion shortens the labour induction to delivery interval and improves the women's satisfaction with the birth process. (isrctn.com)
  • Vaginal dinoprostone and oxytocin infusion versus vaginal placebo and oxytocin infusion to induce labour. (isrctn.com)
  • Women randomised to concurrent oxytocin infusion and prostaglandin will receive a single dose of prostaglandin (3 mg of dinoprostone as a vaginal tablet) vaginally at commencement of the labour induction process at the same time as the standard infusion regime of oxytocin (infusion regime starting at 2 mU/min and doubling every 30 minutes to a maximum of 32 mU/min or until 4 contractions in 10 minutes if achieved sooner). (isrctn.com)
  • OBJECTIVE: To compare the efficacy and safety of two prostaglandin analogs, misoprostol and dinoprostone, for labor induction of third trimester pregnancies with fetus and cervices unfavorable to oxytocin, as reported by recently published studies. (ufrgs.br)
  • In early pregnancy, the uterus is more responsive to dinoprostone than to oxytocin. (wikiversity.org)
  • Dinoprostone is given vaginally, oxytocin by a drip into a vein. (netdoctor.co.uk)
  • The misoprostol controlled-release vaginal insert offers advantages over the dinoprostone controlled-release vaginal insert in terms of substantially reduced time to vaginal or any delivery, and reduced need for oxytocin. (nice.org.uk)
  • Dinoprostone is a synthetic analogue of PGE2. (cmbc.bc.ca)
  • Vaginal preparations of Dinoprostone (PGE2 gels and vaginal inserts, including sustained release preparations), appear to be effective in cervical ripening and induction of labour. (cmbc.bc.ca)
  • Prepidil (dinoprostone topical) is a member of the uterotonic agents drug class and is commonly used for Abortion, Labor Induction and Trophoblastic Disease. (drugs.com)
  • It is not known whether these events were related to the administration of dinoprostone. (rxlist.com)
  • Nonetheless, the myometrial contractions induced by the vaginal administration of dinoprostone are sufficient to produce evacuation of the products of conception from the uterus in the majority of cases. (rxdrugsinfo.com)
  • The birth incidence of these rapidly life-threatening lesions is 1.0 - 1.8/1 000 3 and administration of dinoprostone is life-saving, 'buying time' for the baby to be transferred to a referral centre for definitive establishment of pulmonary or aortic blood flow by systemic-to-pulmonary shunt or arch repair, respectively. (scielo.org.za)
  • Dinoprostone comes as a vaginal insert and as a gel that is inserted high into the vagina. (medlineplus.gov)
  • Application of Propess-vaginal-insert, (Dinoprostone 10mg - Ferring Arzneimittel Ges.m.b.H., 1100 Vienna, Austria) for labor induction on day 1-3 in therapy arm 2. (clinicaltrials.gov)
  • A Randomised Controlled Trial Comparing Intravaginal Misoprostol and Intracervical Dinoprostone in Pre Induction Cervical Ripening. (bvsalud.org)
  • To compare the efficacy and safety of intravaginal misoprostol with intracervical dinoprostone for preinduction cervical ripening . (bvsalud.org)
  • 6, were assigned randomly to receive either intravaginal misoprostol 25 μg every four hours for four doses, and intracervical dinoprostone gel 0.5 mg every eight hours for two doses. (bvsalud.org)
  • The dosage of dinoprostone in the vaginal insert is 10 mg designed to be released at approximately 0.3 mg/hour over a 12 hour period. (rxlist.com)
  • Dinoprostone topical is used in a pregnant woman to relax the muscles of the cervix (opening of the uterus) in preparation for inducing labor at the end of a pregnancy. (cigna.com)
  • This activity may be responsible for the vomiting and/or diarrhea that is not uncommon when dinoprostone is used to terminate pregnancy. (drugbank.ca)
  • Prostin E2 (dinoprostone) Vaginal Suppository is a hormone-like substance ( prostaglandin ) that the body makes in preparation for labor used in a pregnant woman to relax the muscles of the cervix (opening of the uterus ) in preparation for inducing labor at the end of a pregnancy. (rxlist.com)
  • With the doses of dinoprostone used for terminating pregnancy this effect has not been clinically significant. (rxdrugsinfo.com)
  • With the clinical doses of dinoprostone used for the termination of pregnancy some patients do exhibit temperature increases. (rxdrugsinfo.com)
  • Therefore, any failed pregnancy termination with dinoprostone should be completed by some other means. (rxdrugsinfo.com)
  • Dinoprostone is used in labor induction, bleeding after delivery, termination of pregnancy, and in newborn babies to keep the ductus arteriosus open. (wikipedia.org)
  • Dinoprostone increases the amplitude and frequency of uterine contractions throughout pregnancy, but uterine response to the drug increases with the duration of pregnancy. (wikiversity.org)
  • Dinoprostone is used intravenously to induce abortion during the second trimester of pregnancy (beyond the 12th week of gestation) and to improve cervical inducibility (cervical "ripening") near or at term in pregnant women for labor induction. (wikiversity.org)
  • Dinoprostone administered intravaginally stimulates the myometrium of the gravid uterus to contract in a manner that is similar to the contractions seen in the term uterus during labor, resulting in the evacuation of the products of conception from the uterus. (drugbank.ca)
  • Whether or not this action results from a direct effect of dinoprostone on the myometrium has not been determined with certainty at this time. (rxdrugsinfo.com)
  • 12 women (63%) achieved active labour following insertion of the 2nd dinoprostone pessary, and 10 of these (83%) delivered vaginally. (bmj.com)
  • Among the vaginally induced Misoprostol group 56% women delivered vaginally within 12 hours, while in vaginally administered Dinoprostone group only 26% delivered within 12 hours. (bvsalud.org)
  • A suppository containing 20 mg of dinoprostone should be inserted high into the vagina . (rxlist.com)
  • For example, the dinoprostone controlled-release vaginal insert is licensed for the induction of labour from 38 weeks' gestation, whereas the misoprostol vaginal insert is licensed from 36 weeks' gestation. (nice.org.uk)
  • What are the possible side effects of dinoprostone topical? (cigna.com)
  • The purpose of the study is to determine the efficacy of a silicone-double-balloon-catheter for cervical ripening and labor induction in women with unfavorable cervix (Bishop Score not greater than 6) compared to medical treatment using a dinoprostone slow-release-vaginal-insert. (clinicaltrials.gov)
  • The purpose of this study was to compare the safety and efficacy of misoprostol and dinoprostone in pregnancies at high risk of fetal distress. (ovid.com)
  • To compare the efficacy of Misoprostol and Dinoprostone used as labour inducing agents. (bvsalud.org)
  • This study compared the efficacy and safety of the intracervical Foley catheter and dinoprostone insert for cervical ripening to achieve successful labor induction . (bvsalud.org)
  • Dinoprostone is well tolerated by most patients, but side effects can occur including strong or frequent uterine contractions. (rxwiki.com)
  • Dinoprostone-induced uterine contractions are usually sufficient to cause evacuation of both the fetus and the placenta. (wikiversity.org)
  • After you have received dinoprostone topical, tell your caregivers at once if your contractions slow down or become uneven, or if you have a fever, sudden vaginal bleeding, cough, wheezing, chest tightness, trouble breathing, pale skin, or blue colored lips. (cigna.com)
  • Cervidil Vaginal Insert (dinoprostone, 10 mg) is indicated for the initiation and/or continuation of cervical ripening in patients at or near term in whom there is a medical or obstetrical indication for the induction of labor. (rxlist.com)
  • Dinoprostone topical may be used for purposes not listed in this medication guide. (cigna.com)
  • Dinoprostone is a prescription medication used to soften and dilate the cervix (known medically as cervical ripening) for the induction of labor in pregnant women who are at or near term. (rxwiki.com)
  • The active ingredient in this medication is dinoprostone. (emedtv.com)
  • For these applications, dinoprostone is usually administered as an oral medication. (scielo.org.za)
  • Dinoprostone is used to prepare the cervix for the induction of labor in pregnant women who are at or near term. (medlineplus.gov)
  • DINOPROSTONE(dye noe PROST one) is used to help dilate the cervix in pregnant women who are at or near term. (nationwidechildrens.org)
  • Dinoprostone is a gel that is placed directly onto the cervix through the vagina using a special applicator. (cigna.com)
  • Dinoprostone is primarily used as an in-hospital method of ripening the cervix in preparation for labour or in the presence of a medical or obstetrical indication for the induction of labour. (cmbc.bc.ca)
  • Dinoprostone has important effects in labor by inducing softening of the cervix and causing uterine contraction, and also stimulates osteoblasts to release factors that stimulate bone resorption by osteoclasts. (wikipedia.org)
  • Two methods of cervix ripening: intracervical Foley catether and dinoprostone - which one is actually more efficient? (nel.edu)
  • Kosinska-Kaczynska K, Ciechanowicz P, Saletra A, Szymusik I, Wielgos M. Two methods of cervix ripening: intracervical Foley catether and dinoprostone - which one is actually more efficient? (nel.edu)
  • The influence of dinoprostone on uterine cervix ripening and the course of labor. (nel.edu)
  • The aim of the study was to estimate the influence of dinoprostone in two different forms on the ripening of uterine cervix an. (nel.edu)
  • Wielgos M, Szymusik I, Kosinska-Kaczynska K, Suchonska B, Kaminski P, Banaszek-Wysoczanska A, Bomba-Opon D, Szpotanska M. The influence of dinoprostone on uterine cervix ripening and the course of labor. (nel.edu)
  • Dinoprostone, as with other potent oxytocic agents, should be used only with strict adherence to recommended dosages. (rxwiki.com)
  • If your uterus does not respond to dinoprostone within 6 hours, your doctor may apply a second dose. (cigna.com)
  • Since dinoprostone topical is given by a healthcare professional, you are not likely to miss a dose. (cigna.com)
  • Recent studies have compared treatment with various titrated doses of oral misoprostol with vaginal misoprostol or dinoprostone, indicating that the use of an escalating dose of an oral misoprostol solution is associated with a lower rate of caesarean sections and a better safety profile. (biomedcentral.com)
  • Low dose misoprostol is as effective as dinoprostone in cervical ripening and demonstrates similar fetal and maternal safety profile. (bvsalud.org)
  • To compare effectiveness and safety of oral misoprostol (50 μg every four hours as needed), low dose vaginal misoprostol (25 to 50 μg every six hours as needed), and our established dinoprostone vaginal gel (one to two mg every six hours as needed) induction. (prelekara.sk)
  • A moderate balloon volume (30â mL) and higher dose of dinoprostone (≥6â mg) were related to shorter I-D intervals. (bvsalud.org)
  • The generic name of Prostin E2 is dinoprostone. (ndclist.com)
  • Introduction There is no guideline advising on the management of women in whom induction of labour with first dinoprostone pessary has failed. (bmj.com)
  • Conclusion Successful induction of labour can be achieved safely with second dinoprostone pessary following failed initial induction of labour if the Bishop score prior to insertion is ≥3. (bmj.com)
  • A model was developed to evaluate the resource use associated with misoprostol vaginal inserts (MVIs) and dinoprostone vaginal inserts (DVIs) for the induction of labour at term. (biomedcentral.com)
  • Misoprostol tablets are sometimes used off-label to induce labour as it is thought that a shorter time to delivery (compared to dinoprostone) can be achieved. (biomedcentral.com)
  • Although there is evidence that misoprostol reduces the median time to delivery compared with dinoprostone, it is not known whether this will confer economic benefits for obstetric units in terms of a reduction in the use of resources (for example, staffing) and the total cost of inducing labour, compared with current management. (nice.org.uk)
  • If induction of labour is clinically justified, NICE states that vaginal prostaglandin E 2 (dinoprostone gel, tablet or controlled-release insert) is the preferred method, unless there are specific clinical reasons for not using it (in particular the risk of uterine hyperstimulation). (nice.org.uk)
  • If no progression of labor (Bishop Score ≥ 9 and/or cervical opening ≥ 3 cm) continuing of standard treatment using dinoprostone vaginal-inserts on day 2 and if necessary on day 3. (clinicaltrials.gov)
  • Women who are close to the time of delivery and have a medical need for labor to be induced may be given a dinoprostone vaginal insert. (emedtv.com)
  • however, misoprostol allowed the earlier induction of labor than did dinoprostone. (ovid.com)
  • Dinoprostone is a natural substance (prostaglandin) that your body makes in preparation for labor. (webmd.com)
  • Dinoprostone gel is used for inducing labor in pregnant women at term or near term. (oncology-drugs.net)
  • CONCLUSIONS: For the labor induction in third trimester pregnacies, with live fetus and unfavorable cervices, misoprostol is as effective and as safe as dinoprostone. (ufrgs.br)
  • The most frequent adverse reactions observed with the use of dinoprostone for abortion are related to its contractile effect on smooth muscle . (rxlist.com)
  • tell your doctor and pharmacist if you are allergic to dinoprostone or any other drugs. (medlineplus.gov)
  • Dinoprostone vaginal suppository should be given only by trained personnel who adhere strictly to recommended dosages, in hospital that can provide immediate intensive care and acute surgical facilities. (thefreedictionary.com)
  • The controlled-release vaginal system available in our health system is an insert containing 10 mg of dinoprostone with a release rate of 0.3 mg/h that can be left in the vagina for up to 24 h. (biomedcentral.com)
  • An example is dinoprostone, marketed in South Africa as Prostin E2 by Pfizer South Africa (but curiously not listed on their website). (scielo.org.za)
  • METHODS: Seven randomized, controlled and prospective studies, comparing intravaginally applied misoprostol (n=500) with dinoprostone (n=498) were selected from Medline. (ufrgs.br)
  • Intracervical Foley catheter balloon versus dinoprostone insert for induction cervical ripening: A systematic review and meta-analysis of randomized controlled trials. (bvsalud.org)
  • Dinoprostone vaginal insert is a thin, flat, polymeric slab which is rectangular in shape with rounded corners contained within the pouch of an off-white knitted polyester retrieval system. (rxlist.com)
  • Each slab is buff colored, semitransparent and contains 10 mg of dinoprostone in a hydrogel insert. (rxlist.com)
  • Each insert contains 10 mg of dinoprostone in 241 mg of a cross-linked polyethylene oxide/urethane polymer which is a semiopaque, beige colored, flat rectangular slab measuring 29 mm by 9.5 mm and 0.8 mm in thickness. (rxlist.com)
  • The insert and its retrieval system, made of polyester yarn, are nontoxic and when placed in a moist environment , absorb water, swell, and release dinoprostone. (rxlist.com)
  • Care should be taken not to permit excess contact or coating with the lubricant which could prevent optimal swelling and release of dinoprostone from the vaginal insert. (rxlist.com)
  • Cervidil is a vaginal insert containing 10 mg dinoprostone. (rxlist.com)
  • Frustrating induction is defined as application of the cervical-ripening-balloon + 2 times application of dinoprostone-vaginal-insert in therapy arm 1 and 3 times application of dinoprostone-vaginal-insert in therapy arm 2. (clinicaltrials.gov)
  • What Is the Dinoprostone Vaginal Insert? (emedtv.com)
  • Currently, both a Foley catheter and a dinoprostone insert are used for effective cervical ripening . (bvsalud.org)
  • Only published randomized, controlled trials comparing the dinoprostone insert with the Foley catheter were included. (bvsalud.org)
  • Eight trials including 1191 women who received the intracervical Foley catheter balloon and 1199 who received the dinoprostone insert were used for this study. (bvsalud.org)
  • According to the cesarean delivery rate, the intracervical Foley catheter balloon was as efficient as the dinoprostone insert. (bvsalud.org)
  • The results of EXPEDITE suggest that the risk of uterine hyperstimulation is higher with the misoprostol vaginal insert than with the dinoprostone vaginal insert. (nice.org.uk)
  • It was planned that none procedure will be applied to group 1 for cervical ripening, vaginal misoprostol and vaginal dinoprostone will be practiced to Groups 2 and 3, respectively. (clinicaltrials.gov)
  • For the purpose of cervical ripening none procedure will be performed to Group 1, while vaginal misoprostole of 200 mg and vaginal dinoprostone will be applied to Group 2 and 3, respectively. (clinicaltrials.gov)
  • The molecular weight of dinoprostone is 352.5. (rxlist.com)
  • Therefore, the possibility does exist that the previable fetus aborted by dinoprostone could exhibit transient life signs. (rxdrugsinfo.com)
  • Dinoprostone is not indicated if the fetus in utero has reached the stage of viability. (rxdrugsinfo.com)
  • Dinoprostone may be used in the presence of rupture of membranes (ROM). (cmbc.bc.ca)
  • Dinoprostone is a prostaglandin, a hormone-like substance that is naturally produced by tissues in the body. (cigna.com)
  • Dinoprostone is a naturally occurring prostaglandin E 2 that binds and activates the PGE 2 receptor. (scielo.org.za)
  • In laboratory animals, and also in man, large doses of dinoprostone can lower blood pressure, probably as a consequence of its effect on the smooth muscle of the vascular system. (rxdrugsinfo.com)
  • Large doses of dinoprostone may cause vasodilation and hypotension. (wikiversity.org)
  • The objective of this study is to assess which of these three therapeutic options (oral or vaginal misoprostol or vaginal dinoprostone) achieves the highest rate of vaginal delivery within the first 24 h of drug administration. (biomedcentral.com)
  • Compared to placebo, vaginal dinoprostone is associated with a higher rate of vaginal delivery within the first 24 h of drug administration without decreasing the rate of caesarean sections, but also with a higher risk of uterine hyperstimulation with changes in foetal heart rate (FHR) [ 2 ]. (biomedcentral.com)
  • Since dinoprostone, like dinoprost, is metabolized rapidly, discontinuing administration of the drug and supportive therapy are usually adequate treatments for serious adverse effects. (wikiversity.org)
  • Adverse GI effects (e.g., diarrhea), phlebitis, fever are the most frequent adverse reactions of dinoprostone. (wikiversity.org)
  • You should not receive this medicine if you have had an allergic reaction to dinoprostone. (adam.com)
  • Side effects from dinoprostone are not common, but they can occur. (medlineplus.gov)
  • Just like any medicine, dinoprostone may cause side effects. (emedtv.com)
  • The specific side effects will depend on the particular dinoprostone product used. (emedtv.com)
  • Click Dinoprostone Side Effects to learn more, including potentially serious side effects you should report immediately to your healthcare provider. (emedtv.com)
  • Mean Bishop score change at the end of 16 hours was significantly higher in the misoprostol group, (2.57±0.59) compared to dinoprostone group (2.17±0.10, p=0.016). (bvsalud.org)