Four new 3,5-cyclosteroidal saponins from Dracaena surculosa. (1/2)

Further search for steroidal compounds contained in Dracaena surculosa (Agavaceae) led to the isolation of two new 3,5-cyclospirostanol saponins (1, 2) and two new 3,5-cyclofurostanol saponins (3, 4). Their structural assignment was established by spectroscopic analysis and a few chemical transformations as (24S,25R)-1beta-[(beta-D-fucopyranosyl)oxy]-6beta-hydroxy-3alpha,5alpha-cyclospir ostan-24-yl beta-D-glucopyranoside (1), (24S,25R)-1beta-[(beta-D-glucopyranosyl)oxy]-6beta-hydroxy-3alpha,5alpha-cyclospi rostan-24-yl beta-D-glucopyranoside (2), (25S)-1beta-[(beta-D-glucopyranosyl)oxy]-6beta-hydroxy-22alpha-methoxy-3alpha,5al pha-cyclofurostan-26-yl beta-D-glucopyranoside (3), and (25S)-1beta-[(beta-D-fucopyranosyl)oxy]-6beta-hydroxy-22alpha-methoxy-3alpha,5alp ha-cyclofurostan-26-yl beta-D-glucopyranoside (4), respectively.  (+info)

S-adenosyl-L-methionine-cycloartenol methyltransferase activity in cell-free systems from Trebouxia sp. and Scenedesmus obliquus. (2/2)

1. Homogenates prepared from Trebouxia sp. 213/3 and Scenedesmus obliquus exhibited S-adenosyl-l-methionine-cycloartenol methyltransferase activity. 2. The products of the reaction, with cycloartenol as the substrate, were 24-methylenecycloartanol and cyclolaudenol. 3. Optimal enzyme activity was found in homogenates prepared at pH7.6 and the transmethylase was distributed between the supernatant and microsomal fractions of the Trebouxia homogenate. 4. The relevance of these results is discussed in relation to C(28) and C(29) sterol production in the algae.  (+info)

Algae Detail UTEX Number: SNO154Class: ChlorophyceaeStrain: Trebouxia sp.Media: Soil Extract MediumOrigin: Mt Mansfield, Connecticut, USADescription of Location
The scenedesmus obliquus mitochondrial code (translation table 22) is a genetic code found in the mitochondria of Scenedesmus obliquus. AAs = FFLLSS*SYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Starts = -----------------------------------M---------------------------- Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U). Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V) Scenedesmus obliquus List ...
Biodiesel from microalgae seems to be the only renewable biofuel that has the potential to completely replace the petroleum-derived transport fuels. Theref
After considerable fiddling, Ive finally managed to update the phylogeny and host-association matrix for the most common lichen photobiont, Trebouxia. The methods are similar to those used in my previous post on Nostoc rbcX sequences, to the extent that the same script can used to run both analyses. It was modified to use algal species names rather than host names when analysing Trebouxia, to colour the clades in the tree, and to count the number of times each photobiont lineage has been sampled from each lichen genus. All the steps required for this analysis can be see here. All of the files that were generated are available here.. I had previously built a tree from 1840 ITS sequences and identified lineages corresponding to ten named species and five unnamed species. Since then, there have been a number of important papers that have expanded the known diversity of the group and begun to codify the novel lineages. My current ITS tree (PDF version here) has 2335 sequences and includes 12 named ...
Compiled by a diverse team of experts, with experience in scientific and industrial fields, the Comprehensive Report for Wastewater Treatment Using Algae is the first report that provides in-depth analysis and insights on this important field. It uses innumerable data and information from a wide variety of expert sources and market studies, and distills these inputs and data into intelligence and a roadmap that you can use. More » ...
where nitrogen and phosphorus concentrations were at its maximum level (+1). On the other hand, with treatments 9 (N0) and 11 (P0), the lowest AFDW, 0.80 and 0.62 g∙L−1, respectively, were obtained. Therewith, the maximum biomass value obtained was 2.3 times higher than the reports of [1] , which reported a biomass concentration of 0.54 g∙L−1 when cultivating Scenedesmus obliquus with ambient CO2, and when cultivated at 35% of CO2 supply, it was reported a maximum biomass value of 1.39 g∙L−1. The maximum biomass of 1.24 g∙L−1 obtained with the Scenedesmus sp. SCIB-01 strain, without CO2 supply, was comparable to reports of [3] who obtained biomass concentration of 1.34 g∙L−1 using S. obliquus cultivated at 2.5% CO2 feeding concentration. [8] reported S. obliquus cultivation at 30% CO2 concentration, and obtained a biomass concentration of 1.03 g∙L−1. [18] obtained a maximum biomass production of 0.41 g∙L−1 using Desmodesmus sp. phototrophically cultivated, also lower ...
Matsuura T, Kawai M, Makashima R, Butsugan Y (1970). "Structures of physalin A and physalin B, 13,14-seco-16,24-cyclo-steroids ...
24-cyclo-steroids from Physalis alkekengi var. Francheti.", Journal of the Chemical Society, Perkin Transactions 1, 5 (5): 664- ...
Matsuura T, Kawai M, Makashima R, Butsugan Y (1970). "Structures of physalin A and physalin B, 13,14-seco-16,24-cyclo-steroids ...
24-cyclo-steroids from Physalis alkekengi var. Francheti.", Journal of the Chemical Society, Perkin Transactions 1, 5 (5): 664- ...
5,7-Cyclosteroids. IV. Synthesis of 2,3-disubstituted 5β,7β-cyclosteroids. 1968, Vol. 33, Issue 10, pp. 3356-3365 [Abstract] ... 5,7-Cyclosteroids. II. Solvolytic reactions of the epimeric 3-methanesulphonyloxy-5,7-cyclosteroids. 1968, Vol. 33, Issue 10, ... 5,7-Cyclosteroids. I. The Simmons-Smith methylenation of Δ5-B-norsteroids. 1968, Vol. 33, Issue 7, pp. 2049-2058 [Abstract] ... 5,7-Cyclosteroids. V. Synthesis of 5,7β-cyclo-5β-pregnane derivatives. 1969, Vol. 34, Issue 8, pp. 2429-2438 [Abstract] ...
Synthesis of B-Ring-Modified Steroids through BF3-Promoted Rearrangement/Substitution of 6β-Hydroxy-5,19-cyclosteroids ...
A group of polycyclic compounds closely related biochemically to TERPENES. They include cholesterol, numerous hormones, precursors of certain vitamins, bile acids, alcohols (STEROLS), and certain natural drugs and poisons. Steroids have a common nucleus, a fused, reduced 17-carbon atom ring system, cyclopentanoperhydrophenanthrene. Most steroids also have two methyl groups and an aliphatic side-chain attached to the nucleus. (From Hawleys Condensed Chemical Dictionary, 11th ed ...
Cyclosteroids D4.808.294 D4.210.500.294 Cymarine D4.808.155.580.130.750.250 D4.210.500.155.580.130.750.250 Cynanchum B1.650. ...
This graph shows the total number of publications written about "Steroids, Heterocyclic" by people in this website by year, and whether "Steroids, Heterocyclic" was a major or minor topic of these publications ...
Descritores em Ciências da Saúde

No FAQ available that match "cyclosteroids"