Cyclohexenes: Six-carbon alicyclic hydrocarbons which contain one or more double bonds in the ring. The cyclohexadienes are not aromatic, in contrast to BENZOQUINONES which are sometimes called 2,5-cyclohexadiene-1,4-diones.Nalorphine: A narcotic antagonist with some agonist properties. It is an antagonist at mu opioid receptors and an agonist at kappa opioid receptors. Given alone it produces a broad spectrum of unpleasant effects and it is considered to be clinically obsolete.Receptors, Opioid: Cell membrane proteins that bind opioids and trigger intracellular changes which influence the behavior of cells. The endogenous ligands for opioid receptors in mammals include three families of peptides, the enkephalins, endorphins, and dynorphins. The receptor classes include mu, delta, and kappa receptors. Sigma receptors bind several psychoactive substances, including certain opioids, but their endogenous ligands are not known.Analgesics, Opioid: Compounds with activity like OPIATE ALKALOIDS, acting at OPIOID RECEPTORS. Properties include induction of ANALGESIA or NARCOSIS.Narcotic Antagonists: Agents inhibiting the effect of narcotics on the central nervous system.Receptors, Opioid, mu: A class of opioid receptors recognized by its pharmacological profile. Mu opioid receptors bind, in decreasing order of affinity, endorphins, dynorphins, met-enkephalin, and leu-enkephalin. They have also been shown to be molecular receptors for morphine.Uvaria: A plant genus of the family ANNONACEAE. Members contain uvarigrin, uvarigrandin, chamuvaritin and other acetogenins and benzylisoquinoline alkaloids.2,6-Dichloroindophenol: A dye used as a reagent in the determination of vitamin C.Mentha spicata: A plant genus of the family LAMIACEAE having characteristic flavor.Rhodococcus: A bacterial genus of the order ACTINOMYCETALES.Monoterpenes: Compounds with a core of 10 carbons generally formed via the mevalonate pathway from the combination of 3,3-dimethylallyl pyrophosphate and isopentenyl pyrophosphate. They are cyclized and oxidized in a variety of ways. Due to the low molecular weight many of them exist in the form of essential oils (OILS, VOLATILE).Acetone: A colorless liquid used as a solvent and an antiseptic. It is one of the ketone bodies produced during ketoacidosis.Mixed Function Oxygenases: Widely distributed enzymes that carry out oxidation-reduction reactions in which one atom of the oxygen molecule is incorporated into the organic substrate; the other oxygen atom is reduced and combined with hydrogen ions to form water. They are also known as monooxygenases or hydroxylases. These reactions require two substrates as reductants for each of the two oxygen atoms. There are different classes of monooxygenases depending on the type of hydrogen-providing cosubstrate (COENZYMES) required in the mixed-function oxidation.Pharmacognosy: The science of drugs prepared from natural-sources including preparations from PLANTS, animals, and other organisms as well as MINERALS and other substances included in MATERIA MEDICA. The therapeutic usage of plants is PHYTOTHERAPY.SwedenCoitus Interruptus: A contraceptive method whereby coitus is purposely interrupted in order to prevent EJACULATION of SEMEN into the VAGINA.Nucleic Acid Conformation: The spatial arrangement of the atoms of a nucleic acid or polynucleotide that results in its characteristic 3-dimensional shape.Models, Molecular: Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.Thermodynamics: A rigorously mathematical analysis of energy relationships (heat, work, temperature, and equilibrium). It describes systems whose states are determined by thermal parameters, such as temperature, in addition to mechanical and electromagnetic parameters. (From Hawley's Condensed Chemical Dictionary, 12th ed)XyloseDNA: A deoxyribonucleotide polymer that is the primary genetic material of all cells. Eukaryotic and prokaryotic organisms normally contain DNA in a double-stranded state, yet several important biological processes transiently involve single-stranded regions. DNA, which consists of a polysugar-phosphate backbone possessing projections of purines (adenine and guanine) and pyrimidines (thymine and cytosine), forms a double helix that is held together by hydrogen bonds between these purines and pyrimidines (adenine to thymine and guanine to cytosine).Oligonucleotides: Polymers made up of a few (2-20) nucleotides. In molecular genetics, they refer to a short sequence synthesized to match a region where a mutation is known to occur, and then used as a probe (OLIGONUCLEOTIDE PROBES). (Dorland, 28th ed)Protein Conformation: The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).Monomethylhydrazine: Hydrazine substituted by one methyl group.Patents as Topic: Exclusive legal rights or privileges applied to inventions, plants, etc.Free Radicals: Highly reactive molecules with an unsatisfied electron valence pair. Free radicals are produced in both normal and pathological processes. They are proven or suspected agents of tissue damage in a wide variety of circumstances including radiation, damage from environment chemicals, and aging. Natural and pharmacological prevention of free radical damage is being actively investigated.Bicyclo CompoundsFlavoring Agents: Substances added to foods and medicine to improve the quality of taste.Carboxylic Acids: Organic compounds containing the carboxy group (-COOH). This group of compounds includes amino acids and fatty acids. Carboxylic acids can be saturated, unsaturated, or aromatic.Amino Acids, Cyclic: A class of amino acids characterized by a closed ring structure.Fellowships and Scholarships: Stipends or grants-in-aid granted by foundations or institutions to individuals for study.Nova Scotia: A province of eastern Canada, one of the Maritime Provinces with NEW BRUNSWICK; PRINCE EDWARD ISLAND; and sometimes NEWFOUNDLAND AND LABRADOR. Its capital is Halifax. The territory was granted in 1621 by James I to the Scotsman Sir William Alexander and was called Nova Scotia, the Latin for New Scotland. The territory had earlier belonged to the French, under the name of Acadia. (From Webster's New Geographical Dictionary, 1988, p871 & Room, Brewer's Dictionary of Names, 1992, p384)Asia, Southeastern: The geographical area of Asia comprising BORNEO; BRUNEI; CAMBODIA; INDONESIA; LAOS; MALAYSIA; the MEKONG VALLEY; MYANMAR (formerly Burma), the PHILIPPINES; SINGAPORE; THAILAND; and VIETNAM.Editorial Policies: The guidelines and policy statements set forth by the editor(s) or editorial board of a publication.History, 20th Century: Time period from 1901 through 2000 of the common era.Sister Mary Joseph's Nodule: Metastatic lesion of the UMBILICUS associated with intra-abdominal neoplasms especially of the GASTROINTESTINAL TRACT or OVARY.Umbilicus: The pit in the center of the ABDOMINAL WALL marking the point where the UMBILICAL CORD entered in the FETUS.Organosilicon Compounds: Organic compounds that contain silicon as an integral part of the molecule.Silanes: Compounds similar to hydrocarbons in which a tetravalent silicon atom replaces the carbon atom. They are very reactive, ignite in air, and form useful derivatives.Stereoisomerism: The phenomenon whereby compounds whose molecules have the same number and kind of atoms and the same atomic arrangement, but differ in their spatial relationships. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 5th ed)Alkenes: Unsaturated hydrocarbons of the type Cn-H2n, indicated by the suffix -ene. (Grant & Hackh's Chemical Dictionary, 5th ed, p408)KetonesCycloaddition Reaction: Synthetic organic reactions that use reactions between unsaturated molecules to form cyclical products.Encyclopedias as Topic: Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)EncyclopediasCycloparaffins: Alicyclic hydrocarbons in which three or more of the carbon atoms in each molecule are united in a ring structure and each of the ring carbon atoms is joined to two hydrogen atoms or alkyl groups. The simplest members are cyclopropane (C3H6), cyclobutane (C4H8), cyclohexane (C6H12), and derivatives of these such as methylcyclohexane (C6H11CH3). (From Sax, et al., Hawley's Condensed Chemical Dictionary, 11th ed)Gene Library: A large collection of DNA fragments cloned (CLONING, MOLECULAR) from a given organism, tissue, organ, or cell type. It may contain complete genomic sequences (GENOMIC LIBRARY) or complementary DNA sequences, the latter being formed from messenger RNA and lacking intron sequences.Ruthenium: A hard, brittle, grayish-white rare earth metal with an atomic symbol Ru, atomic number 44, and atomic weight 101.07. It is used as a catalyst and hardener for PLATINUM and PALLADIUM.Quantitative Structure-Activity Relationship: A quantitative prediction of the biological, ecotoxicological or pharmaceutical activity of a molecule. It is based upon structure and activity information gathered from a series of similar compounds.Fluorine: A nonmetallic, diatomic gas that is a trace element and member of the halogen family. It is used in dentistry as flouride (FLUORIDES) to prevent dental caries.Structure-Activity Relationship: The relationship between the chemical structure of a compound and its biological or pharmacological activity. Compounds are often classed together because they have structural characteristics in common including shape, size, stereochemical arrangement, and distribution of functional groups.HIV-1: The type species of LENTIVIRUS and the etiologic agent of AIDS. It is characterized by its cytopathic effect and affinity for the T4-lymphocyte.Disease Progression: The worsening of a disease over time. This concept is most often used for chronic and incurable diseases where the stage of the disease is an important determinant of therapy and prognosis.HIV Protease: Enzyme of the human immunodeficiency virus that is required for post-translational cleavage of gag and gag-pol precursor polyproteins into functional products needed for viral assembly. HIV protease is an aspartic protease encoded by the amino terminus of the pol gene.Aspartic Acid Proteases: A subclass of peptide hydrolases that depend on an ASPARTIC ACID residue for their activity.

Prevention and therapy of cancer by dietary monoterpenes. (1/379)

Monoterpenes are nonnutritive dietary components found in the essential oils of citrus fruits and other plants. A number of these dietary monoterpenes have antitumor activity. For example, d-limonene, which comprises >90% of orange peel oil, has chemopreventive activity against rodent mammary, skin, liver, lung and forestomach cancers. Similarly, other dietary monoterpenes have chemopreventive activity against rat mammary, lung and forestomach cancers when fed during the initiation phase. In addition, perillyl alcohol has promotion phase chemopreventive activity against rat liver cancer, and geraniol has in vivo antitumor activity against murine leukemia cells. Perillyl alcohol and d-limonene also have chemotherapeutic activity against rodent mammary and pancreatic tumors. As a result, their cancer chemotherapeutic activities are under evaluation in Phase I clinical trials. Several mechanisms of action may account for the antitumor activities of monoterpenes. The blocking chemopreventive effects of limonene and other monoterpenes during the initiation phase of mammary carcinogenesis are likely due to the induction of Phase II carcinogen-metabolizing enzymes, resulting in carcinogen detoxification. The post-initiation phase, tumor suppressive chemopreventive activity of monoterpenes may be due to the induction of apoptosis and/or to inhibition of the post-translational isoprenylation of cell growth-regulating proteins. Chemotherapy of chemically induced mammary tumors with monoterpenes results in tumor redifferentiation concomitant with increased expression of the mannose-6-phosphate/insulin-like growth factor II receptor and transforming growth factor beta1. Thus, monoterpenes would appear to act through multiple mechanisms in the chemoprevention and chemotherapy of cancer.  (+info)

Biosynthesis of 3-acetyldeoxynivalenol and sambucinol. Identification of the two oxygenation steps after trichodiene. (2/379)

The first two oxygenation steps post-trichodiene in the biosyntheses of the trichothecenes 3-acetyldeoxynivalenol and sambucinol were investigated. The plausible intermediates 2-hydroxytrichodiene (2alpha- and 2beta-) and 12,13-epoxytrichodiene and the dioxygenated compounds 12,13-epoxy-9,10-trichoene-2-ol (2alpha- and 2beta-) were prepared specifically labeled with stable isotopes. They were then fed separately and/or together to Fusarium culmorum cultures, and the derived trichothecenes were isolated, purified, and analyzed. The stable isotopes enable easy localization of the labels in the products by 2H NMR, 13C NMR, and mass spectrometry. We found that 2alpha-hydroxytrichodiene is the first oxygenated step in the biosynthesis of both 3-acetyldeoxynivalenol and sambucinol. The stereoisomer 2beta-hydroxytrichodiene and 12,13-epoxytrichodiene are not biosynthetic intermediates and have not been isolated as metabolites. We also demonstrated that the dioxygenated 12, 13-epoxy-9,10-trichoene-2alpha-ol is a biosynthetic precursor to trichothecenes as had been suggested in a preliminary work. Its stereoisomer was not found in the pathway. A further confirmation of our results was the isolation of both oxygenated trichodiene derivatives 2alpha-hydroxytrichodiene and 12,13-epoxy-9, 10-trichoene-2alpha-ol as natural metabolites in F. culmorum cultures.  (+info)

Adenosylcobalamin-mediated methyl transfer by toluate cis-dihydrodiol dehydrogenase of the TOL plasmid pWW0. (3/379)

We identified and characterized a methyl transfer activity of the toluate cis-dihydrodiol (4-methyl-3,5-cyclohexadiene-cis-1, 2-diol-1-carboxylic acid) dehydrogenase of the TOL plasmid pWW0 towards toluene cis-dihydrodiol (3-methyl-4,5-cyclohexadiene-cis-1, 2-diol). When the purified enzyme from the recombinant Escherichia coli containing the xylL gene was incubated with toluene cis-dihydrodiol in the presence of NAD+, the end products differed depending on the presence of adenosylcobalamin (coenzyme B12). The enzyme yielded catechol in the presence of adenosylcobalamin, while it gave 3-methylcatechol in the absence of the cofactor. Adenosylcobalamin was transformed to methylcobalamin as a result of the enzyme reaction, which indicates that the methyl group of the substrate was transferred to adenosylcobalamin. Other derivatives of the cobalamin such as aquo (hydroxy)- and cyanocobalamin did not mediate the methyl transfer reaction. The dehydrogenation and methyl transfer reactions were assumed to occur concomitantly, and the methyl transfer reaction seemed to depend on the dehydrogenation. To our knowledge, the enzyme is the first dehydrogenase that shows a methyl transfer activity as well.  (+info)

Rhodococcus erythropolis DCL14 contains a novel degradation pathway for limonene. (4/379)

Strain DCL14, which is able to grow on limonene as a sole source of carbon and energy, was isolated from a freshwater sediment sample. This organism was identified as a strain of Rhodococcus erythropolis by chemotaxonomic and genetic studies. R. erythropolis DCL14 also assimilated the terpenes limonene-1,2-epoxide, limonene-1,2-diol, carveol, carvone, and (-)-menthol, while perillyl alcohol was not utilized as a carbon and energy source. Induction tests with cells grown on limonene revealed that the oxygen consumption rates with limonene-1,2-epoxide, limonene-1,2-diol, 1-hydroxy-2-oxolimonene, and carveol were high. Limonene-induced cells of R. erythropolis DCL14 contained the following four novel enzymatic activities involved in the limonene degradation pathway of this microorganism: a flavin adenine dinucleotide- and NADH-dependent limonene 1, 2-monooxygenase activity, a cofactor-independent limonene-1, 2-epoxide hydrolase activity, a dichlorophenolindophenol-dependent limonene-1,2-diol dehydrogenase activity, and an NADPH-dependent 1-hydroxy-2-oxolimonene 1,2-monooxygenase activity. Product accumulation studies showed that (1S,2S,4R)-limonene-1,2-diol, (1S, 4R)-1-hydroxy-2-oxolimonene, and (3R)-3-isopropenyl-6-oxoheptanoate were intermediates in the (4R)-limonene degradation pathway. The opposite enantiomers [(1R,2R,4S)-limonene-1,2-diol, (1R, 4S)-1-hydroxy-2-oxolimonene, and (3S)-3-isopropenyl-6-oxoheptanoate] were found in the (4S)-limonene degradation pathway, while accumulation of (1R,2S,4S)-limonene-1,2-diol from (4S)-limonene was also observed. These results show that R. erythropolis DCL14 metabolizes both enantiomers of limonene via a novel degradation pathway that starts with epoxidation at the 1,2 double bond forming limonene-1,2-epoxide. This epoxide is subsequently converted to limonene-1,2-diol, 1-hydroxy-2-oxolimonene, and 7-hydroxy-4-isopropenyl-7-methyl-2-oxo-oxepanone. This lactone spontaneously rearranges to form 3-isopropenyl-6-oxoheptanoate. In the presence of coenzyme A and ATP this acid is converted further, and this finding, together with the high levels of isocitrate lyase activity in extracts of limonene-grown cells, suggests that further degradation takes place via the beta-oxidation pathway.  (+info)

Olfactory discrimination ability of human subjects for ten pairs of enantiomers. (5/379)

We tested the ability of human subjects to distinguish between enantiomers, i.e. odorants which are identical except for chirality. In a forced-choice triangular test procedure 20 subjects were repeatedly presented with 10 enantiomeric odor pairs and asked to identify the bottle containing the odd stimulus. We found (i) that as a group, the subjects were only able to significantly discriminate the optical isomers of alpha-pinene, carvone and limonene, whereas they failed to distinguish between the (+)- and (-)-forms of menthol, fenchone, rose oxide, camphor, alpha-terpineol, beta-citronellol and 2-butanol; (ii) marked individual differences in discrimination performance, ranging from subjects who were able to significantly discriminate between 6 of the 10 odor pairs to subjects who failed to do so with 9 of the 10 tasks; (iii) that with none of the 10 odor pairs were the antipodes reported to differ significantly in subjective intensity when presented at equal concentrations; and (iv) that error rates were quite stable and did not differ significantly between sessions, and thus, we observed a lack of learning or training effects. Additional tests of the degree of trigeminality and threshold measurements of the optical isomers of alpha-pinene, carvone and limonene suggest that the discriminability of these three enantiomeric odor pairs is indeed due to differences in odor quality. These findings support the assumption that enantioselective molecular odor receptors may only exist for some but not all volatile enantiomers and thus that chiral recognition of odorants may not be a general phenomenon but is restricted to some substances.  (+info)

Odor response properties of rat olfactory receptor neurons. (6/379)

Molecular biology studies of olfaction have identified a multigene family of molecular receptors that are likely to be involved in odor transduction mechanisms. However, because previous functional data on peripheral coding were mainly collected from inferior vertebrates, it has been difficult to document the degree of specificity of odor interaction mechanisms. As a matter of fact, studies of the functional expression of olfactory receptors have not demonstrated the low or high specificity of olfactory receptors. In this study, the selectivity of olfactory receptor neurons was investigated in the rat at the cellular level under physiological conditions by unitary extracellular recordings. Individual olfactory receptor neurons were broadly responsive to qualitatively distinct odor compounds. We conclude that peripheral coding is based on activated arrays of olfactory receptor cells with overlapping tuning profiles.  (+info)

Biosynthesis of bitter acids in hops. A (13)C-NMR and (2)H-NMR study on the building blocks of humulone. (7/379)

The biosynthesis of humulone, an antibacterial bitter acid from hops, was studied by isotope-incorporation experiments using (13)C-labelled glucose or (2)H(2)O. (13)C enrichments, (2)H enrichments and (13)C(13)C coupling patterns identify isovaleryl-CoA, malonyl-CoA and dimethylallyl pyrophosphate as precursors for humulone. Dimethylallyl pyrophosphate, which serves as a building block for the bitter acid, is generated via the deoxyxylulose pathway of terpenoid biosynthesis. The data confirm that a symmetrical intermediate is involved in humulone formation.  (+info)

Induction by adozelesin and hydroxyurea of origin recognition complex-dependent DNA damage and DNA replication checkpoints in Saccharomyces cerevisiae. (8/379)

DNA damaging agents induce a conserved intra-S-phase checkpoint that inhibits DNA replication in eukaryotic cells. To better understand this checkpoint and its role in determining the efficacy of antitumor drugs that damage DNA, we examined the effects of adozelesin, a DNA-alkylating antitumor agent that has a profound inhibitory effect on initiation of DNA replication in mammals, on the replication of Saccharomyces cerevisiae chromosomes. Adozelesin inhibited initiation of S. cerevisiae DNA replication by inducing an intra-S-phase DNA damage checkpoint. This inhibitory effect was abrogated in orc2-1 cells containing a temperature-sensitive mutation in a component of the origin recognition complex (ORC) that also causes a defect in initiation. The orc2-1 mutation also caused a defect in a checkpoint that regulates the activation of origins in late S phase in cells treated with hydroxyurea. Defects in both initiation and checkpoint regulation in the orc2-1 strain were suppressed by deletion of a gene encoding a putative acetyltransferase, SAS2. Adozelesin also induced a cellular response that requires a function of ORC in G(1). A similar G(1)-specific response in mammals may contribute to the cytotoxic and antitumor properties of this and other DNA-damaging drugs.  (+info)

*Mass spectral interpretation

Cyclohexenes often undergo retro Diels-Alder reactions. Alkynes[edit]. Similar to alkenes, alkynes often show strong molecular ... This reaction occurs mainly in cyclohexene and its derivatives. Upon ionization, the pi electrons are excited and generate a ...

*Elimination reaction

E1cB-elimination reaction Coleman, G. H.; Johnstone, H. F. (1925). "Cyclohexene". Organic Syntheses. 5: 33. doi:10.15227/orgsyn ...

*Mass spectral interpretation

Cyclohexenes often undergo retro Diels-Alder reactions. Similar to alkenes, alkynes often show strong molecular ion peak. ... This reaction occurs mainly in cyclohexene and its derivatives. Upon ionization, the pi electrons are excited and generate a ...

*Cyanamide

S. Hünig, E. Lücke, and W. Brenninger (1961). "1-Morpholino-1-Cyclohexene". Organic Syntheses: 65. doi:10.15227/orgsyn.041.0065 ...

*Aliphatic compound

Cyclohexene. Cycloalkene C5H12. n-pentane. Alkane C7H14. Cycloheptane. Cycloalkane ...

*Norbornene

The molecule consists of a cyclohexene ring with a methylene bridge between C-3 and C-6. The molecule carries a double bond ... "2-Cyclohexene-1,4-dione". Organic Syntheses. CS1 maint: Multiple names: authors list (link) ; Collective Volume, 9, p. 186 ...

*1,4-Benzoquinone

Oda, M.; Kawase, T.; Okada, T.; Enomoto, T. (1996). "2-Cyclohexene-1,4-dione". Organic Syntheses. 73: 253. doi:10.15227/orgsyn. ...

*Rhodoplanes

Q. Ashton Acton (2013). Cyclohexenes-Advances in Research and Application: 2013 Edition: ScholarlyBrief. ScholarlyEditions. ...

*Ozonolysis

Claus, Ronald E.; Schreiber, Stuart L. (1990). "Ozonolytic Cleavage of Cyclohexene to Terminally Differentiated Products". ...

*Limonene

1-Methyl-4-(1-methylethenyl)cyclohexene. 4-Isopropenyl-1-methylcyclohexene. p-Menth-1,8-diene. Racemic: DL-Limonene; Dipentene ...

*Limonene

1-Methyl-4-(1-methylethenyl)cyclohexene. 4-Isopropenyl-1-methylcyclohexene. p-Menth-1,8-diene. Racemic: DL-Limonene; Dipentene ...

*Hydroformylation

Recipes have beed developed for the hydroformylation on a laboratory scale, e.g. of cyclohexene.[2][11] ...

*Oxymercuration reaction

Pasto, D. J.; Gontarz, J. A. "Studies on the Mechanism of the Oxymercuration of Substituted Cyclohexenes.". Journal of the ... below is an example of regioselectivity and stereospecificity of the oxymercuration reaction with substituted cyclohexenes. A ...

*Xeno nucleic acid

With cyclohexene nucleic acid, research has shown that CeNAs with stereochemistry similar to the D form can create stable ... Types of synthetic 'XNA' created so far include 1,5-anhydrohexitol nucleic acid (HNA) and cyclohexene nucleic acid (CeNA). ... "Base Pairing Properties of D- and L-Cyclohexene Nucleic Acids (CeNA)". Oligonucleotides. 13 (6): 479-489. doi:10.1089/ ...

*Menitrazepam

"A spectrophotometric and polarographic investigation of three new cyclohexene-substituted benzodiazepines". Talanta. 25 (4): ...

*1,3-Cyclohexadiene

4-Cyclohexadiene Cyclohexene John P. Schaefer and Leland Endres (1967). "1,3-Cyclohexadiene". Organic Syntheses. 47: 31. ; ...

*Cyclohexanol

Heating in the presence of acid catalysts converts cyclohexanol to cyclohexene. Cyclohexanol has at least two solid phases. One ...

*Adipic acid

... direct oxidation of cyclohexenes with 30 percent hydrogen peroxide". Science. 281 (5383): 1646-47. Bibcode:1998Sci...281.1646S ... 4CO2H Another method is oxidative cleavage of cyclohexene using hydrogen peroxide. The waste product is water. Historically, ...

*Alicyclic compound

Monocyclic cycloalkenes are cyclopropene, cyclobutene, cyclopentene, cyclohexene, cycloheptene, cyclooctene, and so on. ...

*Transfer hydrogenation

Two hydrocarbons that can serve as hydrogen donors are cyclohexene or cyclohexadiene. In this case, an alkane is formed, along ...

*Hexene

cyclohexene Hexene, Merriam-Webster Dictionary "Chapter 3: Physical Constants of Organic Compounds". CRC Handbook (90th ed.). ...

*Phellandrene

Cyclohexenes. *Cyclohexadienes. Hidden categories: *Chemical articles with multiple compound IDs. *Multiple chemicals in an ...

*Pimelic acid

In other syntheses, pimelic acid is made from cyclohexene-4-carboxylic acid, and a fourth method also exists based on the 1,4 ... Werber, Frank X.; Jansen, J. E.; Gresham, T. L. (1952). "The Synthesis of Pimelic Acid from Cyclohexene-4-carboxylic Acid and ...

*Cyclohexanone

In some cases, purified cyclohexanol, obtained by hydration of cyclohexene, is the precursor. Alternatively, cyclohexanone can ...

*Cyclohexylmethanol

... can be produced in two step starting with the hydroformylation of cyclohexene. This process also give ... "The Unmodified Homogeneous Rhodium-Catalyzed Hydroformylation of Cyclohexene and the Search for Monometallic Catalytic ...

*Meta-Chloroperoxybenzoic acid

The following scheme shows the reaction of cyclohexene with mCPBA to give an epoxide. The epoxidation mechanism is concerted: ...
The report generally describes 3,3,6,6-tetramethoxy-1,4-cyclohexadiene, examines its uses, production methods, patents. 3,3,6,6-Tetramethoxy-1,4-cyclohexadiene
E coli 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase: a thiamine diphosphate and metal-ion-dependent enzyme that catalyzes the Stetter-like conjugate addition of alpha-ketoglutarate with isochorismate to release 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate and carbon dioxide; has been sequenced
Headline: Bitcoin & Blockchain Searches Exceed Trump! Blockchain Stocks Are Next!. The Cyclohexene Market research report is a professional and in-depth study on the current state of the Cyclohexene Industry.. The Report provides a basic overview of the Cyclohexene Market including definitions, classifications, applications and chain structure. The Cyclohexene Industry analysis is provided for the international market including development history, competitive landscape analysis, and major regions development status.. To begin with, the report elaborates the Cyclohexene Market overview. Various definitions and classification of the industry, applications of the industry and chain structure are given. Present day status of the Cyclohexene Market in key regions is stated and industry policies and news are analysed.. Browse Detailed TOC, Tables, Figures, Charts and Companies Mentioned in Cyclohexene Market @http://www.360marketupdates.com/united-states-cyclohexene-market-report-2016-10321865 Next ...
This thesis describes the development of diastereotopic group selective processes allowing the desymmetrisation of 1,4-cyclohexadiene derivatives and their application to target synthesis. Chapter 1 discusses some of the benefits that may be derived by the use of desymmetrisation, and demonstrates some of the ways in which it has recently been applied in compounds based on 1,4-cyclohexadiene. Chapter 2 describes a novel use of the Prins reaction to desymmetrise cyclohexadiene derivatives with high diastereoselectivity, and the optimisation of this resulting in an effective, practical and straightforward procedure. Chapter 3 details the investigation into desymmetrisation through diastereoselective iodocyclisation reactions, much higher stereoselectivity is observed than found previously in cyclohexadiene based substrates and an explanation is suggested by examination of structural differences. Chapter 4 reviews some of the previous synthetic approaches to members of the fawcettimine group of ...
1-(3-(methyl thio)-butyryl)-2,6,6-trimethyl cyclohexene, 1-(3-(methyl thio)-butyryl)-2,6,6-trimethyl cyclohexene supplier, 1-(3-(methyl thio)-butyryl)-2,6,6-trimethyl cyclohexene distributor, CAS 68697-67-6, 1-(3-(methyl thio)-butyryl)-2,6,6-trimethyl cyclohexene manufacturer, 1-(3-(methyl thio)-butyryl)-2,6,6-trimethyl cyclohexene wholesale
Technical Grade d-Limonene Food Grade d-Limonene EPA Registered Grade d-Limonene High Purity d-Limonene Ultra High Purity d-Limonene Fragrance Grade d...
Nominated Substances: Cyclohexene oxide. Nomination Date: 09/15/1993 Nominator: NCI Rationale: High annual production volume; potential for human exposure based on its use as a research and industrial chemical; environmental contaminant; representative cycloalkene monoepoxide; suspicion of carcinogenicity as a member of the epoxides chemical class. NTP Principles: not specified ...
Nalorphine (INN) (brand names Lethidrone, Nalline), also known as N-allylnormorphine, is a mixed opioid agonist-antagonist with opioid antagonist and analgesic properties. It was introduced in 1954 and was used as an antidote to reverse opioid overdose and in a challenge test to determine opioid dependence. It acts at two opioid receptors - the μ-opioid receptor (MOR) where it has antagonistic effects, and at the κ-opioid receptor (KOR) (Ki = 1.6 nM; EC50 = 483 nM; Emax = 95%) where it exerts high-efficacy partial agonist/near-full agonist characteristics ...
Limonene is a cyclic terpene and a major constituent of several citrus oils (orange, lemon, mandarin, lime and grapefruit). It is a chiral molecule; citrus fruits contain the (R)-enantiomer. The (R)-enantiomer smells like oranges, while the (S)-enantionmer has a piney, turpentine-like odor. D-Limonene is used as a component of flavorings and fragrances. It has been shown to inhibit rat mammary and other tumor development (Tsuda et al. 2004). Being an excellent solvent of cholesterol, d-limonene also has been used clinically to dissolve cholesterol-containing gallstones. Because of its gastric acid neutralizing effect and its support of normal peristalsis, it has also been used for relief of heartburn (Sun 2007). Producing the flavoring substance limonene in our beer might result in a fresh, lemon-like taste on the one hand. On the other hand, we might have beneficial effects on health such as preventive activity against cancer, dissolution of gallstones and relief of heartburn. ...
d-Limonene (Citrus Terpenes) for sale at Botanic Universe. FREE SHIPPING on orders above $100 to Canada & USA. Worldwide Shipping. Shop now!
d-Limonene is a very effective, naturally occurring, biodegradable solvent and degreaser extracted from the peel of oranges. It is 100% natural, envir...
Integrative Therapeutics D-Limonene provides relief of occasional heartburn, acid indigestion, and upset stomach.Ships for free (USA only).
TY - JOUR. T1 - Limonene in expired lung air of patients with liver disease. AU - Friedman, Mark I.. AU - Preti, George. AU - Deems, Rhonda O.. AU - Friedman, Lawrence S.. AU - Munoz, Santiago J.. AU - Maddrey, Willis C.. PY - 1994/8. Y1 - 1994/8. N2 - As part of an effort to examine the relationship between chemosensory disturbance and oral chemistry, we analyzed expired lung air samples from a series of 24 patients with liver disease and 24 healthy controls using gas chromatography-mass spectrometry. Compared to samples from controls, lung air from patients with liver disease contained unusually high levels of limonene, a monoterpene that is a major component of the essential oil of citrus fruits (0.1 vs 7.0 μg/20 liters for controls and patients). Only half the patients showed high levels of limonene. Patients with noncholestatic liver disease were significantly more likely to have elevated lung air limonene levels than those with cholestatic liver disease (0.2 vs 13.8 μg/20 liters). ...
In individuals, d-limonene has shown lower toxicity soon after one and repeated dosing for up to 1 year. Remaining a solvent of cholesterol, d-limonene has actually been used clinically to dissolve cholesterol-containing gallstones. As a consequence of its gastric acid neutralizing impact and its support of standard peristalsis, its also been used for aid of heartburn and gastroesophageal reflux (GERD). D-limonene has perfectly-recognized chemopreventive action in opposition to lots of sorts of cancer. Evidence from a stage I medical demo demonstrated a partial reaction within a individual with breast cancer and secure ailment for much more than 6 months in three patients with colorectal most cancers ...
San Francisco, July 07, 2016--. Limonene Industry report provides detailed analysis of worldwide markets for Limonene from 2011-2016, and provides extensive market forecasts by region/country and subsectors. It covers the key technological and market trends in the Limonene market and further lays out an analysis of the factors influencing the...
The protein sample obtained was concentrated using a centrifugation concentrator with a molecular size limit of 30 kDa subsequent filtration. 250μl of the solution were applied to an analytical gel filtration column Superdex 200 10/30 with 1x PBS as running buffer at a flow rate of 0.5 ml/min. In the chromatogram (shown in the figure on the right in section B), there is an aggregate peak at the exclusion limit that may be caused by the preceding concentration and a major peak at an elution volume of 13.580 ml. The calibration line that was obtained from the calibration proteins b-amylase, alcohol dehydrogenase, BSA, ovalbumine, carboanhydrase, cytochrome C and aprotinin filtrated with the same experimental setup resulted in a regression line with the formula y = -39206 x + 3.3463. Using this formula and the elution volume of the limonene synthase, an apparent molecular mass of 70.1 kDa could be determined for the produced limonene synthase. This fits quite well the theoretical molecular mass ...
D-limonene epoxidation generates (+)-limonene epoxide, an understudied compound in the pharmacologically point of view. Herein, we investigated the anti-inflammatory and antinociceptive potentialities
Recent successful examples for synthesis of new polyolefins containing (polar) functionalities by adopting the approaches by controlled incorporation of reactive functionalities (and the subsequent introduction of polar functionalities under mild conditions) by coordination polymerization in the presence of transition metal complex catalysts have been described. Related methods (such as direct copolymerization of olefin with polar monomer using living radical or coordination insertion methods) have also been demonstrated for comparison. Our recent efforts for precise synthesis of polyolefins containing polar functionalities by efficient incorporation of reactive functionality by copolymerization of ethylene with nonconjugateddiene (1,7-octadiene, vinylcyclohexene etc.) or divinyl-biphenyl using nonbridged half-titanocene [ex. CpTiCl2(O-2,6-iPr2C6H3), Cp = C5Me5, tBuC5H4 etc.] catalysts have been introduced.
There is substantial epidemiologic data to suggest that healthy diets, that is, those high in fruits and vegetables, decrease the risk of a variety of cancers.1 For instance, low-fat diets are associated with a decreased risk of breast and colon carcinomas.i For many dietary supplements, the precise biological mechanisms that underlie their chemopreventive activities are unknown. However, our understanding of the mechanisms underlying the anticancer activities for some dietary constituents is increasing. One example of such a constituent is limonene, which is a monoterpene that is found in a variety of citrus fruits and is a major constituent of orange peel oil. Limonene has been extensively studied in animal models as a chemoprotective* and chemotherapeutic agent.3 In particular, limonene will prevent and cause regression of mammary tumors in 7,12dimethylbenz[a]anthra- cene-treated rats.3. Limonenes anticarcinogenic effect has been re-famesyl pyrophosphate (FPP) and is necessary for RASs ...
There are prepared reaction products of a. 4,4-bis-(hydroxymethyl)-cyclohexene compounds of the formula ##EQU1## where R1, R2 and R4 are the same or different and are hydrogen, methyl or phenyl and there is also present either (1) X as the bridging member methylene or ethylene or (2) X is absent and there are present both R3 and R5 wherein R3 and R5 are the same or different and are hydrogen, methyl or phenyl with (b) sulfur. The compounds are useful in cross-linking vulcanizable elastomers.
The focus of this lesson will be on a specific organic compound known as cyclohexene. Our primary topics of discussion will be on its structure,...
VCH-916 is a novel allosteric inhibitor of HCV NS5B polymerase. The RNA-dependent RNA polymerase (NS5B) of HCV is one of the attractive validated targets for development of new drugs to block HCV infection. VCH-916 is currently being evaluated for safety/tolerability, pharmacokinetics and anti-viral efficacy in chronically infected HCV patient ...
Neutral cobalt(II) complexes of the dianionic tetrapodal pentadentate ligand B2Pz4Py, in which borate linkers supply the anionic charges, are reported. Both the six-coordinate THF adduct 1-THF and the five-coordinate THF-free complex 1 are in a high-spin S = 3/2 configuration in the ground state and have been structurally characterized by X-ray crystallography. These two Co(II) starting materials react rapidly with aryl azides of moderate steric bulk. The thermodynamic products of these reactions are low-spin, diamagnetic, Co(III) amido complexes that are either monomeric, when an external hydrogen atom source such as 1,4-cyclohexadiene is present, or dimeric products formed via C-C coupling of the azide aryl group and internal transfer of H• to the nitrogen. These products are fully characterized and are rare examples of octahedral Co amido compounds; structural determinations reveal significant pyramidalization of the amido nitrogens due to π-π repulsion wherein the amido ligand is ...
Ask or answer questions about Limonene! Your source for terpene information. We are a community wanting to help others learn about the benefits of terpenes.
I have posted Spanish, Dutch, German, and French translations below the English. The translations are via Google Translate, so please excuse any errors. https://vimeo.com/280451329 Todays Cannabis Unknown is another edition in our Terpene Series. This time featuring my favorite terpene, Limonene. But before we get started, Ive got to read you our top ten list…
Specially blended with ratios tweaked specifically to mimic the very high limonene citrus, myrcene and caryophyllene flavor profile of the Sour Lemon OG hybrid strain normally found in nature, this blend contains the following naturally derived, organic terpenes: alpha pinene myrcene alpha terpinene d-limonene terpi
Find patient medical information for LIMONENE on WebMD including its uses, effectiveness, side effects and safety, interactions, user ratings and products that have it.
Blue Dream is one of the most popular cannabis strains of all time. This is probably because of how it makes people feel… just good. The Blue Dream profile includes the terpenes Alpha-Pinene, d-Limonene and Myrcene for a physically energized sativa-like effect, with elevated mood and awareness, great for working, playing or being creative. Uplifting & Energizing.. Delivers flavor and aroma of: Citrus & Pine with Mango undertones. --. ...
A cleaning composition with a limited number of natural ingredients contains alkyl polyglucoside, a 2-hydroxylcarboxylic acid, and a fragrance containing lemon oil or d-limonene. The cleaning composition optionally has a small amount of dye, colorant, and preservative. The cleaning composition can be used to clean hard surfaces and cleans as well or better than commercial compositions containing synthetically derived cleaning agents.
The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
textarea, input[type="text"], input[type="url"], input[type="tel"], input[type="email"] { border-radius: 3px; border: 1px solid #ccc; color: #444; font-size: 17px; height: auto; line-height: 1.2em; max-width: 100%; padding: 13px; width: 100%; margin: px; } textarea, input[type="text"], input[type="url"], input[type="tel"], input[type="email"] { border-radius: 3px; border: 1px solid #ccc; color: #444; font-size: 17px; height: auto; line-height: 1.2em; max-width: 100%; padding: 13px; width: 100%; margin-top: 6px; } .sub-form-body .sub-form-field-subscribe input { background: #00AFBF; background: -moz-linear-gradient(top, #00BACB 0%, #00AFBF 100%); background: -webkit-linear-gradient(top, #00BACB 0%,#00AFBF 100%); background: linear-gradient(to bottom, #00BACB 0%,#00AFBF 100%); filter: progid:DXImageTransform.Microsoft.gradient( startColorstr=#00BACB, endColorstr=#00AFBF,GradientType=0 )!important; border-radius: 100px; font-size: 17px; font-weight: normal; line-height: 1.2em; padding: 14px ...
摘要: The present study involves evaluation of antioxidant potential of Crocus sativus and its main constituents, safranal (SFN) and crocin (CRO), in bronchial epithelial cells, followed antiinflammatory potential of the active constituent safranal, in a murine model of asthma. To investigate the antioxidizing potential of Crocus sativus and its main constituents in bronchial epithelial cells, the stress was induced in these cells by a combination of different cytokines that resulted in an increase in nitric oxide production (NO), induced nitric oxide synthase (iNOS) levels, peroxynitrite ion generation, and cytochrome c release. Treatment with saffron and its constituents safranal and crocin resulted in a decrease of NO, iNOS levels, peroxynitrite ion generation, and prevented cytochrome c release. However, safranal significantly reduced oxidative stress in bronchial epithelial cells via iNOS reduction besides preventing apoptosis in these cells. In the murine model of asthma study, ...
China Saffron Extract Crocetin Extract/Yellow Saffron Powder/Natural Safranal Extract Crocin, Find details about China Saffron Extract, Crocetin Extract from Saffron Extract Crocetin Extract/Yellow Saffron Powder/Natural Safranal Extract Crocin - Kingherbs Limited
Microbial biotransformation is a relevant strategy to obtain high added value natural compounds under controlled environmentally friendly conditions. In this research work, the use of agro-residues (orange peel oil) in the biotransformation of D-limonene by a native Penicillium italicumAUMC13045 species isolated from decayed orange was evaluated. The chemical analysis of water-steam distilled orange peel oil was determined by Gass Chromatography (GC) and D-limonene was shown to be the predominant constituent, representing 82.87% of the total content. It was investigated that the highest α-terpineol yield was obtained by Malt Yeast Broth (MYB) medium at the second day after the first addition of orange peel oil. The highest α-terpineol selectivity obtained when bioconversion media inoculated with fungal conidia at the early stage of the exponential growth. The investigated samples gave higher α-terpineol yield when extracted by mixture of (1:1) diethyl ether and pentane.
Orange oil is an essential oil produced by cells within the rind of an orange fruit (Citrus sinensis fruit). In contrast to most essential oils, it is extracted as a by-product of orange juice production by centrifugation, producing a cold-pressed oil. It is composed of mostly (greater than 90%) d-limonene, and is often used in place of pure d-limonene. D-limonene can be extracted from the oil by distillation. The compounds inside an orange oil varies with each different oil extraction. Composition variety happens as a result of regional and seasonal changes as well as the method used for extraction. Several hundred compounds have been identified with gas chromatograph-mass spectrometry. Most of the substances in the oil belong to the terpene group with limonene being the dominant one. Long chain aliphatic hydrocarbon alcohols and aldehydes like 1-octanol and octanal are second important group of substances. The presence of sinensetin explains the orange color. Orange oil is used as a cleaner. ...
This study evaluated the impact of resveratrol (RSV) and pterostilbene (PT) on the aqueous extract of smokeless tobacco (AEST) induced cardiovascular aberrations in estrogen deficient female Sprague-Dawley rats. Exposure to 4-vinylcyclohexene diepoxide (VCD) (80 mg kg−1, i.p.) for 30 days induces estrogen de
D-limonene is Probably the most common terpenes in character. Its really a important constituent in quite a few citrus oils (orange, lemon, mandarin, lime, and grapefruit). D-limonene is mentioned while in the Code of Federal Polices as usually recognized as Secure (GRAS) for the flavoring agent and can be found in frequent foods merchandise for instance fruit juices, tender drinks, baked products, ice product, and pudding. D-limonene is taken into account to have pretty minimal toxicity. It has been analyzed for carcinogenicity in mice and rats. Whilst initial outcomes confirmed d-limonene amplified the incidence of renal tubular tumors in male rats, woman rats and mice in both equally genders confirmed no proof of any tumor. Subsequent reports have identified how these tumors take place and proven that d-limonene would not pose a mutagenic, carcinogenic, or nephrotoxic threat to individuals ...
This article is shared with permission from our friends at Dr. Mercola.. Oranges are one of the most popular fruits in the U.S., but very few consume the peel, which is arguably the healthiest part of the whole fruit. Orange peels are rich in flavonoids, like hesperidin and polymethoxyflavones (PMFs), and other phytochemicals, which contribute many of their health benefits.. Flavonoids - antioxidant compounds found in certain fruits, vegetables, herbs, and spices - are known for their role in helping to prevent chronic diseases like heart disease and cancer.. In addition, orange peel contains higher amounts of certain nutrients than its flesh. For instance, 3.5 ounces of orange peel provides 136 milligrams (mg) of vitamin C, while the flesh contains about 71 mg.1. Orange peel also contains considerable amounts of calcium, copper, magnesium, vitamin A, folate and other B vitamins and dietary fiber.. They have an intense orange and bitter flavor, but the latter is often a clue that a food is ...
An extended model is developed to predict the free-radical thiol-ene reaction dynamics between D-limonene, as a renewable diolefin, and a monothiol compound (iso-tridecyl 3-mercaptopropionate) in bulk liquid conditions. Thermally and photo-initiated reactions of the two monomers showed favored thiol-ene coupling at the exo-isopropenyl alkene structure when reacted at 1 : 1 and 1 : 0.5 mole ratios. Experimental kinetic data obtained from the two stoichiometries were well reproduced numerically via the simulation software COPASI by introducing a multi-route mechanistic scheme with propagation-chain-transfer steps accounting for primary (mono-additions) and secondary (di-addition) modes of coupling. The differences in intrinsic double-bond reactivity enable synthesis of limonene-terminated resins (mono-versus poly-disperse) as multifunctional network precursors. Off-stoichiometry manipulations in the initial mole ratio, assisted by numerical simulations, offer a convenient approach to visualize the ...
In this study, we found that (+)- and (−)-limonene enantiomers were oxidized to respective carveol (6-hydroxylation) and perillyl alcohol (7-hydroxylation) metabolites by CYP2C9 and CYP2C19 in human liver microsomes. Although enzyme efficiencies (Vmax/Kmratio) were much higher in CYP2C19 than those of CYP2C9 in the formation of carveols and perillyl alcohols from limonene enantiomers by recombinant P450 systems, CYP2C9 was found to be more active than CYP2C19 in catalyzing limonene enantiomers by human liver microsomes with the following lines of evidence. First, sulfaphenazole, a specific CYP2C9 inhibitor, significantly suppressed the activities of oxidations of limonene enantiomers catalyzed by human liver microsomes. Second, anti-CYP2C9 IgG, which was obtained from rabbits immunized with purified human liver CYP2C9 (Shimada et al., 1986), completely inhibited limonene oxidations by liver microsomes. Third, antisera raised against CYP2C9 (purified from membranes of E. coli) inhibited very ...
The amount of bitter acids in hops is a very important parameter for beer production. Different types of hops have different quantities of alpha and beta acids, which are responsible for the bitterness of the beer. In principle the hops are divided into aromatic hops (,10% of alpha acids) and bitter hops (,10% alpha acids). A total of 12 samples were analyzed. Four were from different aromatic hops, four were from bitter hops, and the last four samples were the same variety of hops from different regions. All of the samples were applied on HPTLC MS-grade plates and developed with the AMD 2 procedure. After development the plates must be dried for 5 minutes. Then they can be directly scanned without any additional preparation steps. The advantage of TLC is that lots of samples can be applied on one plate, developed in one step and analyzed together, saving time.. ...
The aim of this study was to compare development of atherosclerotic lesions in VCD-treated and OVX±E2 mice. The rationale was based on comparing lifetime hormone profiles and temporal patterns of ovarian failure between individuals who undergo surgical (OVX) versus natural (VCD-treated) menopause. Here, in LDLR−/− mice, protection against lesion development was provided by E2 supplementation in animals given hormone before complete ovarian failure induced by VCD. In fact, E2 supplementation before or during onset of follicle depletion appeared to be more beneficial because innominate lesion area was significantly less in VCD+E2 compared with OVX+E2. This result is consistent with observations in monkeys in which E2 supplementation at the time of OVX is protective against CVD development, whereas it is detrimental if given after cardiovascular lesion progression is under way.17 Our findings suggest the timing of estrogen replacement may be critical to the subsequent influence on ...
The isomerization of limonene over the Ti-SBA-15 catalyst, which was prepared by the hydrothermal method, was studied. The main products of limonene isomerization were terpinolene, α-terpinene, γ-terpinene, and p-cymene-products with numerous applications. The amount of these products depended on reaction time, temperature, and catalyst content. These parameters changed in the following range: reaction time 30-1380 min, temperature 140-160 °C, and catalyst content 5-15 wt %. Finally, the most favorable conditions for the limonene isomerization process were established: a reaction time of 180 min, temperature of 160 °C, and amount of the catalyst 15 wt %. In order to obtain p-cymene (dehydroaromatization product), the most favorable conditions are similar but the reaction time should be 1380 min. The application of such conditions allowed us to obtain the highest amounts of the desired products in the shortest time.
The Antiangiogenic Compound Aeroplysinin-1 Induces Apoptosis in Endothelial Cells by Activating the Mitochondrial Pathway. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
Calorie restriction inhibits ovarian follicle development and follicle loss through activating SIRT1 signaling in mice. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
A new research report contributes to the increasing evidence that repeated occupational exposure to certain chemical solvents raises the risk for Parkinsons disease. Researchers analyzed the occupational histories of twins ...
Professor Phil Baran and coworkers have developed a new reagent, N-Hydroxytetrachlorophthalimide (ALD00564), which provides a cheap, scalable, and safe synthetic alternative to highly used transformations like allylic oxidations, as well as Negishi and Suzuki-Miyaura type cross-coupling reactions.
Natures Orchard Constipation Relief Formula contains a proprietary blend of 100% natural ingredients including the patent-pending CitraFiberTM product. These ingredients have been shown to contribute to overall health in a variety of ways. One such ingredient is d-limonene. D-limonene is one of the most common terpenes in nature. It is found in the dried citrus oils contained in Natures Orchard Constipation Relief Formula.
Skin exposure to organic chemicals and solvents may cause skin irritation and generate proinflammatory mediators that initiate an irritant response. Histopathology can serve as a fixed reference point in a changing microenvironment for explanation of concurrent cellular responses. Changes in the levels of selected proteins in the irritant cascade were quantified after an exposure and compared to v
Commonly discarded, orange peels are packed with beneficial compounds that can do your body good, especially if youre suffering from respiratory distress.
There are 959 calories in 1 original of Pei Wei Asian Diner Orange Peel Steamed Shrimp, with White Rice. Youd need to walk 251 minutes to burn 959 calories. Visit CalorieKing to see calorie count and nutrient data for all portion sizes.
You may also wish to search for items by Vogel. 54 matching references were found. Batich, C.; Heilbronner, E.; Vogel, E., The ionization energies of bridged [14]annulenes and of dicyclohepta[cd,gh]pentalene, Helv. Chim. Acta, 1974, 57, 2288. [all data] Heilbronner, E.; Brogli, F.; Vogel, E., Photoelectron spectroscopic assignment of symmetry to the ground state and first excited state of the 1,4-cyclohexadiene radical cation, J. Electron Spectrosc. Relat. Phenom., 1976, 9, 227. [all data] Gleiter, R.; Dobler, W.; Vogel, E.; Bohm, S.; Lex, J., Consequences of n/o interactions in bishomoanthraquinones and their dimethylene derivatives. A structural and PE spectroscopic study, J. Am. Chem. Soc., 1987, 109, 5156. [all data] Altenbach, H.; Constant, D.; Martin, H.; Mayer, B.; Muller, M.; Vogel, E., Syntheses and photoelectron spectra of 7-azanorbornadiene and related compounds. An analysis with fragment orbitals, Chem. Ber., 1991, 124, 791. [all data] Bremser, W.; Hagen, R.; Heilbronner, E.; Vogel, ...
Specially blended with ratios tweaked specifically to mimic the flavor profile of Maui Wowie normally found in nature, this blend contains the following naturally derived, organic terpenes: alpha pinene myrcene alpha terpinene d-limonene terpinolene linalool terpineol geraniol trace amount alpha- humulene beta- cary
Learn more about terpineol. We enable science by offering product choice, services, process excellence and our people make it happen.
Feel good and improve your day with a formula of terpenes meant to keep you uplifted, yet relaxed and stress free. Main Terpenes: D-Limonene Myrcene Beta-Caryophyllene Alpha-Pinene Beta-Pinene With Ricca, you can expect: All natural, food grade, organic, and 100% free of fillers Products crafted in our Cleanroom in an
Mapping of (-) - Limonene [the "negative" stereoisomer] rearrangement to (-) - Menthol and related end products (Croteau, 1987) demonstrates the menthol pathways dependence on limonene as its substrate. It is reasonable to believe that those varietals possessing the menthol enzyme translated in great enough saturation will keep the substrate, limonene, nearly exhausted ...
... Fruit Punch has a classic fruity, sweet, and tropical aroma with a tangy kick from the high percentage of d-Limonene and citrus terpenes. This profile is very heavily flavored to match a sweet, red fruit punch flavor to accompany limonene-heavy terpene profile. For those looking
Blended composition of natural essential oils (lemon oil and natural extract from citrus peels) + synthetic ingredients. Fragrance components: Geraniol (CAS# 106-24-1), Linalool (CAS# 78-70-6), Citral (CAS# 5392-40-5), D-Limonene (CAS# 5989-27-5 ...
Methyl esters were prepared from the mixture of unrefined palm oil (URPO) and D-Limonene oil (DLO) and evaluated for their properties to be used as fuel in a diesel engine. DLO was blended with URPO in different proportions (such as 10%, 15% and 20% by mass) before transesterification to reduce viscosity of the URPO. 15% of DLO and 85% of URPO by mass was found as the optimum based on the optimum yield. Reaction influential factors, such as amount of alcohol, temperature for reaction, reaction time and amount of catalyst have been investigated for the methyl ester of 15% of DLO and 85% of URPO mixture (PODLO15). In the second phase of work, tests were conducted on a single cylinder, air cooled diesel to analyze the performance, emission and combustion characteristics of the methyl ester of PODLO15. Engine tests results indicated reduced brake thermal efficiency with neat URPO as compared to neat diesel. Methyl ester of PODLO15 showed improvement in brake thermal efficiency ...
The Agency for Healthcare and Quality (AHRQ) offers practical, research-based tools and other resources to help a variety of health care origanizations, provider, and others make care safer in all health care settings. AHRQs evidence-based tools and resources are used by organizations nationwide to improve the quality, safety, effectiveness, and efficiency of health care. Improving health care quality by increasing the capacity of small primary care practices to implement the best clinical evidence is our aim. These tools and resources can be searched by the key drivers and the change strategies of the EvidenceNOW Key Driver Diagram.. ...
The Agency for Healthcare and Quality (AHRQ) offers practical, research-based tools and other resources to help a variety of health care origanizations, provider, and others make care safer in all health care settings. AHRQs evidence-based tools and resources are used by organizations nationwide to improve the quality, safety, effectiveness, and efficiency of health care. Improving health care quality by increasing the capacity of small primary care practices to implement the best clinical evidence is our aim. These tools and resources can be searched by the key drivers and the change strategies of the EvidenceNOW Key Driver Diagram.. ...
The Haro 14mm 48 spoke Replacement Wheel is the perfect replacement for F1 / F2 & Backtrail X1, featuring Haro 48 hole single wall black anodized alloy rim and 14mm sealed mechanism hubs.
Vans and Haro Bikes will be joining forces to bring together an apparel capsule collection and a couple pairs of Vans Era & Sk8 His. In honor of this joint venture, legendary BMX rider Dennis McCoy sits and discusses the evolution of Haro and what the company means to BMX. Take a look at the video and keep an eye out for the collabs to hit stores soon.. ...
... is claimed to have several medicinal benefits, such as treating depression and high cholesterol. This eMedTV page offers an overview of saffron, including how it may treat several health conditions, possible side effects, and safety concerns.
Health benefits of saffron include its ability to improve respiratory and digestive health and eliminate pain. Saffron has calcium, manganese, iron, selenium & magnesium.
These further High Street plots, rising up the hill from Sheep Street and the Tolsey, were part of a medieval extension of the town, and originally had relatively wide frontages. Several are documented from the Middle Ages, though all have been substantially rebuilt. Commercial and industrial buildings include a former inn at No. 152, a former rope factory at No. 142, and Nos.
vch:VCA0860 K01176 alpha-amylase [EC:3.2.1.1] , (RefSeq) malS; alpha-amylase (A) MKLNALTLSLLSALALPALASPASTANLTVATTTNSRDFPLQADEPLVIPLTKGDYTLTI SGIGGDCPPVPEQEIKFNTPIALNCHVPTQLPLSIRFTGDYAFQWQAQNNTLTFVRQTTK AAKTEFHRPIPNVSCEVYQGGEVTLDLASSFADGTELQDAMTGQVVTIEQGKVRLTPSAN SGGLVLLEPKQTAKAEPKQPFTYRNANIYFVMVDRFYNADPSNDGSYGRHKDGQEEIGTF HGGDLKGVIAKLDHIQSLGTDAIWLSPIVEQVHGFVGGGEKGSFPFYAYHGYWTRDFTKI DANFGKDEDLQTLVREAHRRGIKILMDAVINHAGYATLADLQQDAVQVVNAPMLPERWND WKPSADENWHSFHQAIDYQSKNWQQWWGPDWVRAGLPGYPAPGSSDITMNLAGLPDFRTE SPQAVTPPQWLLNNPGTRVVSKPNYTVADYLIEWQSDWVRRFGIDGFRIDTVKHVEGEVW QRLKQRATESLAAWRKDNNQSGEPFWMMGEVWGHGAYRSPYFDDGFDALINFDIQKRMDN GAACLSQMAMVYRDYAQTLAKYPDFNPVSYMSSHDTELFFGRFKSLDMQRNAANALLLTP GAIQVYYGDEVAREAGPYADDFHQGTRSDMPWEWNAERQALLKHWQTLGQFRQRHPAIGT GEHREIAQSNAYVFTRTLGEDKVVVAFVGR ...
The acute and sub-acute toxicity of safranal were studied in rat and mice within 2 and 21 days after exposure, respectively. For subacute toxicity, changes in weight as well as biochemical, hematological and pathological parameters were studied. The intraperitoneal LD50 values of safranal were 1.48 mL/kg in male mice, 1.88 mL/kg in female mice and 1.50 mL/kg in male rats. Oral LD50 values were 21.42 mL/kg in male mice, 11.42 mL/kg in female mice and 5.53 mL/kg in male rats. For subacute toxicity, safranal was administered orally to male rats once daily for 21 days. In hematological tests, a significant decrease in RBC counts, hematocrit, hemoglobin and platelets were observed. Safranal decreased cholesterol, triglyceride and alkalin phosphatase. Lactate dehydrogenase and serum urea nitrogen were increased by safranal. Histological studies indicated that safranal did not have any toxic effect on the heart, liver and spleen. However, pathological changes were seen in the kidney and lung. According to LD50
A detailed study of the mechanism by which a dizinc catalyst copolymerizes cyclohexene oxide and carbon dioxide is presented. The catalyst, previously published by Williams et al. ( Angew. Chem. Int. Ed. 2009, 48, 931), shows high activity under just 1 bar pressure of CO2. This work applies in situ attenuated total reflectance infrared spectroscopy (ATR-FTIR) to study changes to the catalyst structure on reaction with cyclohexene oxide and, subsequently, with carbon dioxide. A computational investigation, using DFT with solvation corrections, is used to calculate the relative free energies for various transition states and intermediates in the cycle for alternating copolymerization catalyzed by this dinuclear complex. Two potentially competing side reactions, sequential epoxide enchainment and sequential carbon dioxide enchainment are also investigated. The two side-reactions are shown to be thermodynamically disfavored, rationalizing the high selectivity exhibited in experimental studies using ...
Biocatalytic production of perillyl alcohol from limonene by using a novel Mycobacterium sp cytochrome P450 alkane hydroxylase expressed in Pseudomonas ...
Purchase Chemistry and Analysis of Hop and Beer Bitter Acids, Volume 27 - 1st Edition. Print Book & E-Book. ISBN 9780444881656, 9781483290867
In an effort to make diverse molecular complexity from simple hydrocarbons, tricarbonyl(cyclohexadienyl)iron(+1) cation was prepared in two steps from 1, 3-cycloxehadiene. Reactivity of the symmetric iron cation with heteroatom nucleophiles and stabilized carbon nucleophiles was studied. Nucleophilic attack of potassium phthalimide at the dienyl terminus of the cation followed by oxidative decomplexation with Ce4+ provided the ligand N-(2,4-cyclohexadiene-1-yl)phthalimide. A series of stereochemically diverse polyhydroxyl aminocyclohexane aminocyclitols derivatives and a number of racemic and optically active hydroxy-and polyhydroxy 1,3-diaminocyclohexane derivatives have been synthesized from N-(2,4-cyclohexadiene-1-yl)phthalimide. The relative stereochemistries of the compounds ware assigned on the basis of the 1H NMR data as well as X-ray single crystal diffraction analysis. In a similar attempt tricabonyl(η5-6-styrylcyclohepta-2,4-diene-1-yl)iron(+1) cation was synthesized in three steps from 1,
Blaps rynchopetera Fairmaire has long been used as a folk medicine by the Yi and Bai ethnic groups in China to treat fever, cough, gastritis, boils, and tumors. In the present study, the cytotoxicity of the defensive secretion (TDS) of B. rynchopetera against AGS Caco-2, HepG2 U251 and Bel-7402 was tested, and the results revealed that TDS had potent cytotoxicity against testing cells with IC50 values of 45.8, 17.4, 53.6, 98.4 and 23.4 μg/mL, respectively. Gas chromatography-mass spectrometry (GC-MS) analysis was employed to clarify the cytotoxic constituents in TDS of B. rynchopetera and five volatile compounds, including 2-ethyl-2,5-cyclohexadiene-1,4-dione (3, 31.00%), 1-tridecene (5, 28.02%), 2-methyl-2,5-cyclohexadiene-1,4-dione (2, 22.86%), hydroquinone (4, 1.33%), and p-benzoquinone (1, 1.01%), were identified. Chemical constituent investigation on TDS further supported the presence of 5 above compounds. A cytotoxic assay indicated that compounds 1, 2, 3 and 4 exhibited significant cytotoxicity
Buy Biotique Orange Peel Exfoliating Soap online from Ayurvedabay.com. Shop for Biotique Botanicals products, ayurvedic products, organic herbs & ayurvedic medicines at best price. FREE Worldwide Shipping on orders over $60! | Easy & Secure Payment.
Get Homax 20 oz. Aerosol Can Water-Based Orange Peel Spray Texture(4092-06) On Sale today at ACE Hardware! Compare Tool Repair Shops prices & check availability for Homax 20 oz. Aerosol Can Water-Based Orange Peel Spray Texture(4092-06). Get it right now at your nearest store in Moultrie.
Joost- I think a cocktail of chromogranins A and B would cover most pulmonary neuroendocrine cells without having to worry about which neuropeptide the cells elaborate. April- I love limonene as a clearing agent except in the tissue processor, we use xylene for procesing and limonene for purging the machine and all staining baths. It is not as volatile as xylene and leaves a slight oiliness in the tissues which usually is not a problem and sometimes helps, especially if the tissue is cut thin. Fatty tissues give the most problems when using limonene for processing. Vinnie and Terry, as for safety, Id rather use an agent that shows antitumor activity and is being fed orally!! to patients in clinical trials (limonene) than some mystery aliphatic that gets persnickety at the slightest hint of H2O. Our eosin never bleeds. I know some folks are allergic to limonene and get violently ill, luckily I have never encountered such a worker in nearly fifteen years of use (maybe 35 or 40 people). Limonenes ...
Satiereal® is a clinically studied, proprietary extract of saffron. You know saffron as a spice. What you may not know is that it has been prized in traditional cultures since ancient Persia as a way to enhance mood and relieve stress. Previously available only in Europe, this standardized saffron extract provides support for healthy body weight by targeting some of the emotional factors that make you eat more when youre trying to eat less. The suggested daily serving of just two 88.25 mg capsules of new Optimized Saffron with Satiereal® delivers the active constituents safranal and crocin. These compounds have been shown to modulate certain serotonergic receptors in the brain to support mood. In clinical studies,7,8 women taking Satiereal® experienced ... 1. 100% reduction in the desire to snack 2. 50% fewer instances of eating between meals 3. Less hunger 4. Moderate weight loss 5. More energy 6. Better mood In fact, they reported feeling better about themselves
Results 60 individual VOMs were identified from mice and 87 in the human, with a 22% correlation between the two. Most notable in the murine sample was the high concentration of simple organic molecules such as hexane and short chain aldehydes. Several compounds were found in the murine sample that had not been seen in human samples and probably reflect urine contamination from incontinent mice. The greatest concentration of VOMs in the mouse were: hexanal, 2.2.4.6.6-pentamethyl-heptane and pentanal. By comparison, in the human, complex cycloalkenes and benzene-based compounds, such as 1-methyl-4-(1-methylethylidene)-cyclohexene, were in abundance. Chief compounds in the human were: D Limonene, 2-methyl phenol and indole. Several molecules were prominent in both mouse and human, such as acetone, short chain organic acids including hexanoic, pentanoic and butanoic acids and D-limonene. The more simple compounds likely reflect a combination of the metabolic effluvia of common intestinal microbiota ...
Read "Direct catalytic oxidation of cyclohexene to 1, 2-cyclohexanediol by aqueous hydrogen peroxide under solvent-free condition, Research on Chemical Intermediates" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
All natural honey and tart Valencia orange peel are a perfect match, spread on warm toast and enjoy the sweet citrus flavor. LaTienda offers the best of Spain shipped direct to your home - fine foods, wine, ceramics and more. Free catalog.
it is 98% air, did you know that? and you can dissolve it with the juice squeezed from an orange peel (see? this is a pdf by the way). and its filled with chemicals that are known to be hazardous to your health and known carcinogens (for instance, the styrene itself leaches, and theres benzene in it too.) Technically, yes, it can be recycled. Its broken down, processed and typically reformed into pellets that are used in future styrofoam production. good, right? well, ysee, its also lightweight and bulky, and also very durable, and that makes it difficult to recycle. plus, a lot of the time its been contaminated with food, e.g. raw meat, and it has to be cleaned first (and due to its high surface area Im guessing thats more than a matter of spraying some water at it like it is for aluminum or plastic ...
Oranges are rich in vitamin C, which helps to promote elastin. In this article, youll learn how to use orange peel for skin whitening. You get your skin color from a pigment known as melanin. External factors like impurities, pollutants, and dead cells pile on your skin resulting in dark spots. Along with this, internal […]. ...
Background: Crocus sativus, known as saffron crocus, is best known for the spice saffron. Saffron use spans more than 3500 years, however, its toxicity on neonates during lactation has not yet evaluated. Objectives: This study was aimed to examine the acute toxicity of saffron on adult mice and its nephrotoxicity and hepatotoxicity on neonates of lactating mothers that used saffron during lactation. Materials and Methods: In this experimental study, following acute toxicity evaluation, 32 pregnant mice were randomly designated into four equal groups. Following delivery, the mothers of groups 1 to 4 were administered orally (by gavage) normal saline (control group), 500, 1000 or 2000 mg/kg/day of saffron for three weeks, respectively. The newborns kidney and liver parameters were assessed at the end of the study for possible nephrotoxicity and hepatotoxicity evaluation. The kidney and liver tissue samples of newborns were histopathologically studied after staining with Hematoxylin & Eosin. Data ...
... Price for Package of 100 bulbs.Crocus sativus, commonly known as saffron crocus, or autumn crocus, is a species
Exir Saffron Offers high quality saffron spice, saffron tea, powdered saffron , and saffron dietary supplements all from natural saffron flower ,Saffron can prevent vision loss or AMD in elderly people.
Terpineol refers to any combination of four isomers. It can possess a floral lilac or pine scent and tastes of fresh mint, lime, or anise.
Read these 15 fresh and sweet orange oil uses that will show you the benefits of this fruit for your body and health. Then, try all of them!
When liver cells die, your body normally replaces them. But if your liver has had to contend with years of alcohol or drug abuse, hepatitis B or C, or long-term exposure to noxious occupational chemicals, your liver cells stop regenerating, and scar tissue and fatty deposits form instead and spread. Thats cirrhosis. As it progresses, […]. READ COMPLETE ARTICLE » ...
FLAVORS: Earthy, Pungent, Pine DESCRIPTION: Alpha-Pinene, Myrcene, D-Limonene, Terpinolene, Linalool, Isoborneol, Geraniol, Alpha-Humulene
Blended composition of natural essential oils (lemon oil and natural extract from citrus peels) + synthetic ingredients. Fragrance components: Geraniol (CAS# 106-24-1), Linalool (CAS# 78-70-6), Citral (CAS# 5392-40-5), D-Limonene (CAS# 5989-27-5 ...
Find and save ideas about Saffron health benefits on Pinterest. | See more ideas about Saffron benefits, Benefits of saffron and Curcumin cancer.
A heavy duty parts washer detergent that contains d-Limonene, a citrus based cleaning agent particularly effective in penetrating and cleaning hard to remove grease, oil, tar, and carbon based deposits. It is biodegradable and is designed specifically for use in Hotsy industrial parts washers. TubMate Torque is an alkaline detergent with multiple components to help maintain enhanced oil and grease cleaning properties even at the end of the bath life. It contains ingredients to combat water hardness problems and includes an advanced defoamer to control foaming in the machine sump ...
Urushiol isnt just a weekend gardeners nuisance, but can cause serious problems for fire fighters in working brush fires in areas such as the California hills, where poison sumac, another urushiol producing plant, thrives. The chemistry gives some clues to helping prevent and treat urushiol reactions. Application of an organic derivative of an absorbent mineral (bentonite) can soak up and trap any oil before it reaches the skin and binds- this is the principal behind the commercial product Ivy Block. Alternatively, something that binds strongly to the urushiol target but is not itself a hapten could act as a preventative. D-Limonene, found in citrus skins, has been floated as a possibility, but I couldnt find any evidence that it works ...
This is a domain of the alpha-2-macroglobulin family.. The alpha-macroglobulin (aM) family of proteins includes protease inhibitors [(PUBMED:2473064)], typified by the human tetrameric a2-macroglobulin (a2M); they belong to the MEROPS proteinase inhibitor family I39, clan IL. These protease inhibitors share several defining properties, which include (i) the ability to inhibit proteases from all catalytic classes, (ii) the presence of a bait region and a thiol ester, (iii) a similar protease inhibitory mechanism and (iv) the inactivation of the inhibitory capacity by reaction of the thiol ester with small primary amines. aM protease inhibitors inhibit by steric hindrance [(PUBMED:2472396)]. The mechanism involves protease cleavage of the bait region, a segment of the aM that is particularly susceptible to proteolytic cleavage, which initiates a conformational change such that the aM collapses about the protease. In the resulting aM-protease complex, the active site of the protease is sterically ...
The replaceable cassette is integrally formed with a small primary container for fast response time when aspirating, and an integrally formed, larger secondary container into which the contents of the primary container are periodically flushed. During aspiration, the secondary container is sealed from the primary container and, therefore, has no adverse effect on aspiration response time. The primary container is located above the secondary container and the two containers are connected by a standpipe through which substances are flushed by the force of gravity in emptying the contents of the primary container into the secondary container. Although the cassette will operate with microsurgical consoles having two separate vacuum sources, only one vacuum source is required.
The invention concerns a process for the isomerization of humulon in a carbon dioxide-hops extract and a process for the isolation of isohumulon from the isomerized carbon dioxide-hops extract. Aluminium or an aluminium compound, preferably aluminium trioxide is added to the carbon dioxide-hops extract in such a concentration that the mole ratio of aluminium: alpha acid (alpha humulon) amounts to from 1:0.1 to 1:6. The mixture is then treated with high alkali hydroxide concentration at a temperature of from 80° to 160° C. Isohumulon is obtained from the extract by adding so much tempered water that the isohumulon share amounts to 1 to 10% and the temperature is reduced to 40° to 45° C., and after further cooling to room temperature, the alkali isohumulons are purified from the other components in conventional manner and optionally are transformed in the conventional way into isohumulons.
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
Crocus sativus Saffron Bulbs Crocus sativus Saffron Flower Seeds Saffron Crocus Bulbs Saffron Bulb or Saffron Crocus! It begins blooming in September and continues through October! The purple flowers have deep purple veining! It's orange-red stigmas are the source of saffron, the worlds most expensive spice! Plant in full sun or partial shade and well-drained soil. In cooler regions the Saffron Crocus can be grown in containers. You can harvest the saffron when the flowers are blooming.
TY - JOUR. T1 - Synthesis of silyloxy dienes by silylene transfer to divinyl ketones. T2 - Application to the asymmetric synthesis of substituted cyclohexanes. AU - Ventocilla, Christian C.. AU - Woerpel, Keith. PY - 2012/4/6. Y1 - 2012/4/6. N2 - Silver-catalyzed silylene transfer to divinyl ketones provided 2-silyloxy-1,3-dienes with control of stereochemistry and regioselectivity. The products participated in Diels-Alder reactions with electron-deficient alkenes and imines to form six-membered-ring products diastereoselectively. Cycloaddition reactions with alkenes bearing chiral auxiliaries provided access to chiral, nonracemic cyclohexenes. The methodology, therefore, represents a synthesis of diastereomerically and enantiomerically pure products in a single flask. The highly substituted cyclohexene products could be functionalized stereoselectively to provide cyclohexanols after oxidation of the carbon-silicon bond.. AB - Silver-catalyzed silylene transfer to divinyl ketones provided ...
High Dose: Patients apply POH cream (0.76%) as in arm II. Patients undergo tissue sampling of the right or left dorsal forearm and of physician-selected representative actinic keratoses (AK) at baseline and after completion of study therapy. Tissue samples are assessed for changes in patterns of biomarker expression (i.e., p53, apoptosis, c-Fos histopathology) and karyometry. After completion of study therapy, patients undergo tissue sampling of the opposite forearm as well as blood sample collection to determine perillyl alcohol (POH) levels in blood and biopsy samples. Urine is also collected and analyzed for safety at the end of treatment. Digital photographs of the forearms and hands are obtained at baseline and after 3 months of study treatment. Optical coherence tomography imaging is also performed on pre- and post-biopsy sites to quantify the effect of POH on sun damage and AK in skin ...
About CITRUS AURANTIUM DULCIS (SWEET ORANGE) OIL: Volatile oil expressed from the fresh peel of the orange fruit.. Function(s): Fragrance Ingredient; ASTRINGENT; MASKING; SKIN CONDITIONING; TONIC. Synonym(s): CITRUS AURANTIUM DULCIS (ORANGE) OIL, ABSOLUE ORANGE FLOWER; ABSOLUE ORANGE FLOWER DECOLOREE; ABSOLUE ORANGE FLOWER FROM WATER; ABSOLUTE ORANGE FLOWERS; ABSOLUTE PETITGRAIN; NEROLI OIL; NEROLI OIL, POMMADE; CITRUS SINENSIS OIL; OIL SWEET; CITRUS AURANTIUM DULCIS OIL; CITRUS SINENSIS (SWEET ORANGE) ESSENTIAL OIL; CITRUS SINENSIS (SWEET ORANGE) OIL; CITRUS SINENSIS ESSENTIAL OIL; CITRUS SINENSIS OIL; OIL OF ORANGE; OILS, ORANGE, SWEET; ORANGE ESSENTIAL OIL; ORANGE OIL; ORANGE OIL TERPENELESS (CITRUS SINENSIS (L.) OSBECK) ...
Chemet offers public health insecticides for Seed Treatment including Captan, Imidacloprid, Carboxin, Metaxyl, Captafol from Bharuch, India.
The objective of this study has been to clarify to what extent ozone (03) and 03 !limonene in interaction with surface materials has an impact on the indoor air quality in typical low-polluting offices at various, realistic air change rates. Changes of environmental conditions were performed seven days before the chemical sampling. Organic compounds were collected on Tenax TA adsorbent tubes and the samples were analysed by gas chromatography with flame ionisation and mass selective detectors. The concentration of Total Volatile Organic Compounds were as expected found to be inversely proportional to air change rates. Aldehydes and organic acids were found at increased levels when the air change rate was decreased from 1.0 h1 to 0.3 h1. Increased ventilation rate to 3.0 h1 did not induce additional changes in the chemical composition of aldehydes and organic acids. The fractions of aldehydes and organic acids relative to nonreactive alkanes indicated that chemical transformation in the indoor
Lemon juice is a great source of vitamin C which will act as a great ingredient for face plus body whitening. A few drops of lemon juice can be addedto water, and by using a cotton ball, you can apply it on your skin, and then leave it for 15 minutes. Rinse only with a cotton towel. You have to keep in mind that a good moisturizer, when applied afterward, will make your skin glow because lemon juice can dry your skin.. Tomato toner can also be a fantastic agent for skin and body whitening. A mashed ripe tomato can be passed through a sieve to strain the seeds, and then some curd can be added to the juice and then applied toface, and you will get a solution to how tobrightening skin. The acidic content in tomato juice will help you lighten your skin and remove dark spots.. Orange peel is another good source of Vitamin C and can be used as a bleaching agent. Dried orange peels can be grinded it to a fine powder, adding some rose water and honey, and applying to skin or face will give out a glowing ...

CyclohexeneCyclohexene

The National Institute of Standards and Technology (NIST) uses its best efforts to deliver a high quality copy of the Database and to verify that the data contained therein have been selected on the basis of sound scientific judgment. However, NIST makes no warranties to that effect, and NIST shall not be liable for any damage that may result from errors or omissions in the Database ...
more infohttps://webbook.nist.gov/cgi/cbook.cgi?Source=1950THO%2FUBB349&Units=CAL&Mask=1000

CyclohexeneCyclohexene

Notice: Except where noted, spectra from this collection were measured on dispersive instruments, often in carefully selected solvents, and hence may differ in detail from measurements on FTIR instruments or in other chemical environments. More information on the manner in which spectra in this collection were collected can be found here. Notice: Concentration information is not available for this spectrum and, therefore, molar absorptivity values cannot be derived. ...
more infohttps://webbook.nist.gov/cgi/cbook.cgi?ID=C110838&Units=SI&Type=IR-SPEC&Index=1

Cyclohexene - WikipediaCyclohexene - Wikipedia

Cyclohexene is not very stable upon long term storage with exposure to light and air because it forms peroxides. Cyclohexene is ... Cyclohexene is also a precursor to adipic acid, maleic acid, dicyclohexyladipate, and cyclohexene oxide. Furthermore, it is ... Safety Data Sheet for cyclohexene Safety MSDS data Reaction of Cyclohexene with Bromine and Potassium Permanganate Cyclohexene ... Cyclohexene is a hydrocarbon with the formula C6H10. This cycloalkene is a colorless liquid with a sharp smell. It is an ...
more infohttps://en.wikipedia.org/wiki/Cyclohexene

Cyclohexene oxide - WikipediaCyclohexene oxide - Wikipedia

It can react in cationic polymerization to poly(cyclohexene oxide). As cyclohexene is monovalent, poly(cyclohexene oxide) is a ... Cyclohexene oxide is produced in epoxidation reaction from cyclohexene. The epoxidation can take place either in a homogeneous ... Cyclohexene has been studied extensively by analytical methods. A good overview is given in literature. A study on the ... A short overview and an investigation of the oxidation of cyclohexene by hydrogen peroxide is given in the literature. In ...
more infohttps://en.wikipedia.org/wiki/Cyclohexene_oxide

Chemical Database: Cyclohexene (EnvironmentalChemistry.com)Chemical Database: Cyclohexene (EnvironmentalChemistry.com)

This page contains information on the chemical Cyclohexene including: 21 synonyms/identifiers; U.S. Code of Federal Regulations ... Cyclohexene*Cyclohexene ring*Cykloheksen*Cykloheksen (POLISH) *Cykloheksen [Polish]*Tetrahydrobenzene. Properties. * ... Cyclohexene. Identifications. *Formula: C6H10. Elements: Carbon, Hydrogen. *CAS Number: 110-83-8*CAS Number: 5989-27-5*CAS ... Cyclohexene (EnvironmentalChemistry.com),/a,- This page contains information on the chemical Cyclohexene including: 21 synonyms ...
more infohttps://environmentalchemistry.com/yogi/chemicals/cn/Cyclohexene.html

Alfa Aesar™ Cyclohexene, 99%Alfa Aesar™ Cyclohexene, 99%

Cyclohexene is used as a solvent. It is employed as a precursor to caprolactam, adipic acid, maleic acid, dicyclohexyladipate ... DOTInformation : Transport Hazard Class: 3; Packing Group: II; Proper Shipping Name: CYCLOHEXENE ...
more infohttps://www.fishersci.ca/shop/products/cyclohexene-99-6/AAA11359AE

Cyclohexene Oxide 98%, ACROS Organics™Cyclohexene Oxide 98%, ACROS Organics™

WARNING: The information provided on this web site was developed in compliance with European Union (EU) regulations and is correct to the best of our knowledge, information and belief at the date of its publication. The information given is designed only as a guide for safe handling and use. It is not to be considered as either a warranty or quality specification.. Danger. EINECSNumber : 206-007-7. RTECSNumber : RN7175000. TSCA : TSCA. ...
more infohttps://www.fishersci.ca/shop/products/cyclohexene-oxide-98-acros-organics/AC111211000

Patent US3968074 - Reaction product of 4,4-bis-(hydroxymethyl)-cyclohexene compounds with sulfur - Google PatentsPatent US3968074 - Reaction product of 4,4-bis-(hydroxymethyl)-cyclohexene compounds with sulfur - Google Patents

... cyclohexene compounds of the formula ##EQU1## where R1, R2 and R4 are the same or different and are hydrogen, methyl or phenyl ... cyclohexene, 1-methyl-3,6-methano-4,4-bis-(hydroxymethyl)-cyclohexene, 1-methyl-4,4-bis-(hydroxymethyl) cyclohexene, 4,4-bis-( ... cyclohexene, 6-methyl-4,4-bis-(hydroxymethyl-cyclohexene, 4,4-bis-(hydroxymethyl)-5-phenyl cyclohexene, 1,2,5-trimethyl-4,4-bis ... cyclohexene, 3,5-diphenyl-4,4-bis-(hydroxymethyl)-cyclohexene, 3-phenyl-4,4-bis-(hydroxymethyl)-cyclohexene, 3-phenyl-5-methyl- ...
more infohttp://www.google.ca/patents/US3968074

Oxidative dehydrogenation of cyclohexene to benzene by oxygen, catalyzed by a palladium cluster | SpringerLinkOxidative dehydrogenation of cyclohexene to benzene by oxygen, catalyzed by a palladium cluster | SpringerLink

A reaction mechanism is proposed for the oxidative dehydrogenation of cyclohexene by oxygen to benzene, catalyzed with a (PPh) ... 2Pd5 cluster, including reversible complexing of cyclohexene with (PPh) ... including reversible complexing of cyclohexene with (PPh)2Pd5, the rupture of the C-H bond of coordinated cyclohexene, and the ... The equilibrium constants of (PPh)2Pd5 with cyclohexene and benzene, as well as the rate constant for the rupture of the C-H ...
more infohttps://link.springer.com/article/10.1007/BF00949647

Cyclohexene Market Sales Analysis and Forecast to 2021 Market Research Report | BusinessCyclohexene Market Sales Analysis and Forecast to 2021 Market Research Report | Business

The Cyclohexene Market research report is a professional and in-depth study on the current state of the Cyclohexene Industry. ... United States Cyclohexene Sales Forecast by Type 2016-2021. *United States Cyclohexene Sales Forecast by Application 2016-2021 ... Consumption Volume and Consumption Value Analysis of Cyclohexene by Regions. *Analysis of Cyclohexene Production, Supply, Sales ... In this Cyclohexene Market analysis, traders and distributors analysis is given along with contact details. For material and ...
more infohttp://beforeitsnews.com/business/2016/10/cyclohexene-market-sales-analysis-and-forecast-to-2021-market-research-report-2999490.html

Molecules | Free Full-Text | A Mild Catalytic Oxidation System: FePcOTf/H2O2 Applied for Cyclohexene DihydroxylationMolecules | Free Full-Text | A Mild Catalytic Oxidation System: FePcOTf/H2O2 Applied for Cyclohexene Dihydroxylation

... were employed for the first time as a mild and efficient Lewis acid catalyst in the selective oxidation of cyclohexene to ... Keywords: iron (III) phthalocyanine; cyclohexene; triflate; cyclohexane-1,2-diols iron (III) phthalocyanine; cyclohexene; ... Zhou, B.; Chen, W. A Mild Catalytic Oxidation System: FePcOTf/H2O2 Applied for Cyclohexene Dihydroxylation. Molecules 2015, 20 ... Zhou B, Chen W. A Mild Catalytic Oxidation System: FePcOTf/H2O2 Applied for Cyclohexene Dihydroxylation. Molecules. 2015; 20(5 ...
more infohttp://www.mdpi.com/1420-3049/20/5/8429

Cyclohexene: Hazards, Synthesis & Structure | Study.comCyclohexene: Hazards, Synthesis & Structure | Study.com

The focus of this lesson will be on a specific organic compound known as cyclohexene. Our primary topics of discussion will be ... Structure of Cyclohexene. Lets start by taking a look at the structure of cyclohexene. Cyclohexene has a pretty simple ... Synthesis of Cyclohexene. Now that we know what the structure of cyclohexene looks like lets talk about how its made ... Cyclohexene is a clear, colorless liquid at room temperature with a sharp odor, so it should always be handled in a fume hood. ...
more infohttps://study.com/academy/lesson/cyclohexene-hazards-synthesis-structure.html

Effect of preparation conditions of benzene bridged Ti incorporated periodic mesoporous organosilicas on selectivity...Effect of preparation conditions of benzene bridged Ti incorporated periodic mesoporous organosilicas on selectivity...

S. Virginia, M.C. López, D.Q. Martha, M.J. Vieira, Synthesis of Ti-SBA-15 with low HCl content as catalysts in cyclohexene ... Titanium PMOs 1,4-Bis(triethoxysilyl)benzene Aging time Cyclohexene epoxidation Electronic supplementary material. The online ... The hydrophobic group of benzene bridged on the pore wall was benefit for the approach of cyclohexene and formation of the ... on the catalytic performance for the cyclohexene epoxidation with tertbutyl hydroperoxide as an oxidant agent were investigated ...
more infohttps://link.springer.com/article/10.1007%2Fs10934-018-0576-5

Chemical Database: 3-Cyclohexene-1-Methanol, Alpha,Alpha,4-Trimethyl-, Acetate (EnvironmentalChemistry.com)Chemical Database: 3-Cyclohexene-1-Methanol, Alpha,Alpha,4-Trimethyl-, Acetate (EnvironmentalChemistry.com)

This page contains information on the chemical 3-Cyclohexene-1-Methanol, Alpha,Alpha,4-Trimethyl-, Acetate including: 12 ... 3-Cyclohexene-1-Methanol, Alpha,Alpha,4-Trimethyl-, Acetate*alpha,alpha,4-Trimethyl-3-cyclohexene-1-methyl acetate*alpha- ... 3-Cyclohexene-1-Methanol, Alpha,Alpha,4-Trimethyl-, Acetate. Identifications. *CAS Number: 80-26-2*FEMA Number: 3047*Synonyms/ ... Chemical Database - 3-Cyclohexene-1-Methanol, Alpha,Alpha,4-Trimethyl-, Acetate. EnvironmentalChemistry.com. 1995 - 2018. ...
more infohttps://environmentalchemistry.com/yogi/chemicals/cn/3-Cyclohexene-1-Methanol%2C%A0Alpha%2CAlpha%2C4-Trimethyl-%2C%A0Acetate.html

RCSB PDB - 2I78: Crystal structure of human dipeptidyl peptidase IV (DPP IV) complexed with ABT-341, a cyclohexene-constrained...RCSB PDB - 2I78: Crystal structure of human dipeptidyl peptidase IV (DPP IV) complexed with ABT-341, a cyclohexene-constrained...

Discovery of Cyclohexene-constrained Phenethylamine ABT-341, a Highly Potent, Selective, Orally Bioavailable, Safe and ... Crystal structure of human dipeptidyl peptidase IV (DPP IV) complexed with ABT-341, a cyclohexene-constrained phenethylamine ...
more infohttps://www.rcsb.org/structure/2i78

Inter-connected and open pore hierarchical TS-1 with controlled framework titanium for catalytic cyclohexene epoxidation -...Inter-connected and open pore hierarchical TS-1 with controlled framework titanium for catalytic cyclohexene epoxidation -...

Inter-connected and open pore hierarchical TS-1 with controlled framework titanium for catalytic cyclohexene epoxidation ... Inter-connected and open pore hierarchical TS-1 with controlled framework titanium for catalytic cyclohexene epoxidation Y. ... Closed porosity slightly improved the cyclohexene conversion, whereas the open-pore sample shows the optimum catalytic activity ... the developed hierarchical TS-1 zeolites were assessed in the catalytic epoxidation of cyclohexene. It was confirmed that the ...
more infohttps://pubs.rsc.org/en/Content/ArticleLanding/2018/CY/C7CY02571H

Influence of Particle Size on Reaction Selectivity in Cyclohexene Hydrogenation and Dehydrogenation over Silica-Supported...Influence of Particle Size on Reaction Selectivity in Cyclohexene Hydrogenation and Dehydrogenation over Silica-Supported...

The conversion of cyclohexene in the presence of excess H{sub 2} (H{sub 2}:C{sub 6}H{sub 10} ratio = 20-60) is characterized by ... For the hydrogenation of cyclohexene, a non-Arrhenius temperature dependence (apparent negative activation energy) was observed ... and a high temperature regime in which the dehydrogenation of cyclohexene dominates (, 573 K). The rate of both reactions ... The role of particle size during the hydrogenation/dehydrogenation of cyclohexene (10 Torr C{sub 6}H{sub 10}, 200-600 Torr H{ ...
more infohttps://digital.library.unt.edu/ark:/67531/metadc928260/

4-Cyclohexene-1,2-dicarboxylic acid, bis(oxiranylmethyl) ester, Reaction: 3-dodecyldihydro-2,5-furandione Chemical Report4-Cyclohexene-1,2-dicarboxylic acid, bis(oxiranylmethyl) ester, Reaction: 3-dodecyldihydro-2,5-furandione Chemical Report

This 4-Cyclohexene-1,2-dicarboxylic acid, bis(oxiranylmethyl) ester, Reaction: 3-dodecyldihydro-2,5-furandione Chemical World ... Name: 4-Cyclohexene-1,2-dicarboxylic acid, bis(oxiranylmethyl) ester, Reaction: 3-dodecyldihydro-2,5-furandione : 4-Cyclohexene ... 4-Cyclohexene-1,2-dicarboxylic acid, bis(oxiranylmethyl) ester, Reaction: 3-dodecyldihydro-2,5-furandione Chemical Report. Date ... 4-Cyclohexene-1,2-dicarboxylic acid, bis(oxiranylmethyl) ester, Reaction: 3-dodecyldihydro-2,5-furandione Chemical Report This ...
more infohttps://marketpublishers.com/report/chemicals_petrochemicals/4-cyclohexene-12-dicarboxylic-acid-bisoxiranylmethyl-ester-reaction-3-dodecyldihydro-25-furandione-chemical-report.html

Ethyl (3R,4R,5S)-5-amino-4-[(1-<sup>11</sup>C)ethanoylamino]-3-(3-pentanyloxy)-1-cyclohexene-1-carboxylate | C1511CH28N2O4 |...Ethyl (3R,4R,5S)-5-amino-4-[(1-<sup>11</sup>C)ethanoylamino]-3-(3-pentanyloxy)-1-cyclohexene-1-carboxylate | C1511CH28N2O4 |...

1-Cyclohexene-1-car. boxylic acid, 5-ami. no-3-(1-ethylpropox. y)-4-[(1-oxoethyl-1. -11. C)amino]-, ethyl es. ter, (3R,4R,5S)- ... Ethyl (3R,4R,5S)-5-amino-4-[(1-11C)ethanoylamino]-3-(3-pentanyloxy)-1-cyclohexene-1-carboxylate *Molecular FormulaC1511CH28N2O4 ...
more infohttp://www.chemspider.com/Chemical-Structure.23313034.html

Oxidative dehydrogenation of cyclohexane and cyclohexene over supporte by Nicholas F. Dummer, Salem Bawaked et al."Oxidative dehydrogenation of cyclohexane and cyclohexene over supporte" by Nicholas F. Dummer, Salem Bawaked et al.

Oxidative dehydrogenation of cyclohexene over AuPd/TiO2 or Pd/TiO2 catalysts was found to be very effective (conversion ,99% at ... 423 K). These results indicate that the first step in the reaction sequence of cyclohexane to cyclohexene is the slowest step. ... palladium and gold-palladium catalysts have been used to oxidatively dehydrogenate cyclohexane and cyclohexenes to their ... Oxidative dehydrogenation of cyclohexene over AuPd/TiO2 or Pd/TiO2 catalysts was found to be very effective (conversion >99% at ...
more infohttps://ro.uow.edu.au/smhpapers/3880/

Global and Chinese 3-Cyclohexene-1-Methanol (CAS 1679-51-2) Industry, 2016 Market Research ReportGlobal and Chinese 3-Cyclohexene-1-Methanol (CAS 1679-51-2) Industry, 2016 Market Research Report

Global and Chinese 3-Cyclohexene-1-Methanol Industry, 2011-2021 Market Research Report is a professional and - Market ... Global and Chinese 3-Cyclohexene-1-Methanol (CAS 1679-51-2) Industry, 2016 Market Research Report The ... 9.1 3-Cyclohexene-1-Methanol Industry News. 9.2 3-Cyclohexene-1-Methanol Industry Development Challenges. 9.3 3-Cyclohexene-1- ... 4.5 2011-2016 Chinese Import and Export of 3-Cyclohexene-1-Methanol. Chapter Five Market Status of 3-Cyclohexene-1-Methanol ...
more infohttps://www.marketresearch.com/Prof-Research-v4036/Global-Chinese-Cyclohexene-Methanol-CAS-9978253/

Hydroxyisohexyl 3-Cyclohexene Carboxaldehyde (Lyral) in Patch Test Preparations Under Varied Storage ConditionsHydroxyisohexyl 3-Cyclohexene Carboxaldehyde (Lyral) in Patch Test Preparations Under Varied Storage Conditions

Hydroxyisohexyl 3-cyclohexene carboxaldehyde concentrations are more stable in petrolatum than many other studied fragrance ... Hydroxyisohexyl 3-Cyclohexene Carboxaldehyde (Lyral) in Patch Test Preparations Under Varied Storage Conditions. ... This study aimed to investigate the volatility of hydroxyisohexyl 3-cyclohexene carboxaldehyde (HICC) in petrolatum when stored ...
more infohttps://insights.ovid.com/derm/201309000/01206501-201309000-00008
  • This study aimed to investigate the volatility of hydroxyisohexyl 3-cyclohexene carboxaldehyde (HICC) in petrolatum when stored in test chambers and to explore the correlation between vapor pressure and allergen loss in petrolatum during preparation and storage. (ovid.com)
  • Hydroxyisohexyl 3-cyclohexene carboxaldehyde concentrations are more stable in petrolatum than many other studied fragrance allergens, but HICC is still at risk for decreasing concentration when exposed to ambient air or heat for prolonged periods. (ovid.com)
  • Fleet, GWJ & Shing, TKM 1983, ' An entry to chiral cyclohexenes from carbohydrates: A short, efficient, and enantiospecific synthesis of (-)-shikimic acid from D-mannose ', Journal of the Chemical Society, Chemical Communications , no. 15, pp. 849-850. (elsevier.com)
  • Xi, Zuwei 2009-08-15 00:00:00 Cyclohexene can be oxidized directly to 1, 2-cyclohexanediol with aqueous hydrogen peroxide under solvent-free condition using a heteropolyphosphatotungstate catalyst. (deepdyve.com)
  • Dehydration of cyclohexanol to cyclohexene can be accomplished by pyrolysis of the cyclic secondary alcohol with an acid catalyst at a moderate temperature or by distillation over alumina or silica gel. (scribd.com)
  • The product of this dehydration process is actually cyclohexene itself! (study.com)
  • However, after dehydration is complete and the bulk of the product has distilled, the column remains saturated with water-cyclohexene that merely refluxes and does not distill. (scribd.com)
  • The effects of preparation conditions of Ti-PMOs, mole ratio of TEOS/BTEB and ageing time, on the catalytic performance for the cyclohexene epoxidation with tertbutyl hydroperoxide as an oxidant agent were investigated. (springer.com)
  • Prelab Exercise: Prepare a detailed flow sheet for the preparation of cyclohexene, indicating at each step which layer contains the desired product. (scribd.com)
  • n-, iso- and cyclo-alk en es and -alk yn es (unsaturated hydrocarbons). (wikipedia.org)
  • A novel environmentally-friendly catalytic system for the carbonylation of cyclohexene with molecular oxygen under conditions of mild temperature, and under an atmospheric oxygen pressure is presented. (springer.com)
  • The focus of this lesson will be on a specific organic compound known as cyclohexene. (study.com)
  • It's the week before Susan's organic laboratory class and her instructor just sent out an email stating that the class is going to be conducting an experiment on cyclohexene when they meet the following week. (study.com)
  • Cyclohexene is not very stable upon long term storage with exposure to light and air because it forms peroxides. (wikipedia.org)
  • In terms of personal exposure to cyclohexene, Susan should try to minimize her exposure to the compound because inhaling the vapors can cause a person to cough and feel drowsy. (study.com)
  • The ROP of ε -CL with a dihydroxy functional initiator, 3-cyclohexene-1,1-dimethanol, produced a well-defined two-arm PCL with a cyclohexene end-functional group, (PCL) 2 -CH. The subsequent bromination of (PCL) 2 -CH followed by azidation gave a diazido end-functionalized PCL, (PCL) 2 -(N 3 ) 2 . (springer.com)
  • For the hydrogenation of cyclohexene, a non-Arrhenius temperature dependence (apparent negative activation energy) was observed. (unt.edu)