A cyclic nucleotide formed from CYTIDINE TRIPHOSPHATE by the action of cytidylate cyclase. It is a potential cyclic nucleotide intracellular mediator of signal transductions.
A phosphodiesterase that specifically cleaves the 3'-phosphate linkage of 2',3'-cyclic nucleotides. It is found at high level in the cytoplasm of cells that form the MYELIN SHEATH.
Cytidine (dihydrogen phosphate). A cytosine nucleotide containing one phosphate group esterified to the sugar moiety in the 2', 3' or 5' position.
A group of enzymes that catalyzes the phosphorylation of serine or threonine residues of proteins and is dependent on cyclic nucleotides.
A group of cyclic GMP-dependent enzymes that catalyze the phosphorylation of SERINE or THREONINE residues of proteins.
Guanosine cyclic 3',5'-(hydrogen phosphate). A guanine nucleotide containing one phosphate group which is esterified to the sugar moiety in both the 3'- and 5'-positions. It is a cellular regulatory agent and has been described as a second messenger. Its levels increase in response to a variety of hormones, including acetylcholine, insulin, and oxytocin and it has been found to activate specific protein kinases. (From Merck Index, 11th ed)
A family of enzymes that catalyze the conversion of ATP and a protein to ADP and a phosphoprotein.
An adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH.
A group of compounds with the heterocyclic ring structure of benzo(c)pyridine. The ring structure is characteristic of the group of opium alkaloids such as papaverine. (From Stedman, 25th ed)
A group of enzymes that are dependent on CYCLIC AMP and catalyze the phosphorylation of SERINE or THREONINE residues on proteins. Included under this category are two cyclic-AMP-dependent protein kinase subtypes, each of which is defined by its subunit composition.
The state of the PENIS when the erectile tissue becomes filled or swollen (tumid) with BLOOD and causes the penis to become rigid and elevated. It is a complex process involving CENTRAL NERVOUS SYSTEM; PERIPHERAL NERVOUS SYSTEMS; HORMONES; SMOOTH MUSCLES; and vascular functions.
The inability in the male to have a PENILE ERECTION due to psychological or organ dysfunction.
The external reproductive organ of males. It is composed of a mass of erectile tissue enclosed in three cylindrical fibrous compartments. Two of the three compartments, the corpus cavernosa, are placed side-by-side along the upper part of the organ. The third compartment below, the corpus spongiosum, houses the urethra.
An erectile structure homologous with the penis, situated beneath the anterior labial commissure, partially hidden between the anterior ends of the labia minora.
Inability to achieve and maintain an erection (ERECTILE DYSFUNCTION) due to defects in the arterial blood flow to the PENIS, defect in venous occlusive function allowing blood drainage (leakage) from the erectile tissue (corpus cavernosum penis), or both.
Nucleoside-2',3'-cyclic phosphate nucleotidohydrolase. Enzymes that catalyze the hydrolysis of the 2'- or 3'- phosphate bonds of 2',3'-cyclic nucleotides. Also hydrolyzes nucleoside monophosphates. Includes EC 3.1.4.16 and EC 3.1.4.37. EC 3.1.4.-.
A species of fruit fly much used in genetics because of the large size of its chromosomes.
A class of enzymes that catalyze the conversion of a nucleotide and water to a nucleoside and orthophosphate. EC 3.1.3.-.
Different forms of a protein that may be produced from different GENES, or from the same gene by ALTERNATIVE SPLICING.
A genus of small, two-winged flies containing approximately 900 described species. These organisms are the most extensively studied of all genera from the standpoint of genetics and cytology.
Proteins that originate from insect species belonging to the genus DROSOPHILA. The proteins from the most intensely studied species of Drosophila, DROSOPHILA MELANOGASTER, are the subject of much interest in the area of MORPHOGENESIS and development.
Enzymes that catalyze the hydrolysis of CYCLIC AMP to form adenosine 5'-phosphate. The enzymes are widely distributed in animal tissue and control the level of intracellular cyclic AMP. Many specific enzymes classified under this heading demonstrate additional spcificity for 3',5'-cyclic IMP and CYCLIC GMP.
Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.
The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.
Immunologic techniques based on the use of: (1) enzyme-antibody conjugates; (2) enzyme-antigen conjugates; (3) antienzyme antibody followed by its homologous enzyme; or (4) enzyme-antienzyme complexes. These are used histologically for visualizing or labeling tissue specimens.
Studies determining the effectiveness or value of processes, personnel, and equipment, or the material on conducting such studies. For drugs and devices, CLINICAL TRIALS AS TOPIC; DRUG EVALUATION; and DRUG EVALUATION, PRECLINICAL are available.
A technique using antibodies for identifying or quantifying a substance. Usually the substance being studied serves as antigen both in antibody production and in measurement of antibody by the test substance.
A CALCIUM and CALMODULIN-dependent cyclic nucleotide phosphodiesterase subfamily. The three members of this family are referred to as type 1A, type 1B, and type 1C and are each product of a distinct gene. In addition, multiple enzyme variants of each subtype can be produced due to multiple alternative mRNA splicing. Although the type 1 enzymes are classified as 3',5'-cyclic-AMP phosphodiesterases (EC 3.1.4.17), some members of this class have additional specificity for CYCLIC GMP.
Cell surface proteins that bind PARATHYROID HORMONE with high affinity and trigger intracellular changes which influence the behavior of cells. Parathyroid hormone receptors on BONE; KIDNEY; and gastrointestinal cells mediate the hormone's role in calcium and phosphate homeostasis.
A parathyroid hormone receptor subtype that recognizes both PARATHYROID HORMONE and PARATHYROID HORMONE-RELATED PROTEIN. It is a G-protein-coupled receptor that is expressed at high levels in BONE and in KIDNEY.
A polypeptide hormone (84 amino acid residues) secreted by the PARATHYROID GLANDS which performs the essential role of maintaining intracellular CALCIUM levels in the body. Parathyroid hormone increases intracellular calcium by promoting the release of CALCIUM from BONE, increases the intestinal absorption of calcium, increases the renal tubular reabsorption of calcium, and increases the renal excretion of phosphates.
A mitochondrial disorder featuring the triad of chronic progressive EXTERNAL OPHTHALMOPLEGIA, cardiomyopathy (CARDIOMYOPATHIES) with conduction block (HEART BLOCK), and RETINITIS PIGMENTOSA. Disease onset is in the first or second decade. Elevated CSF protein, sensorineural deafness, seizures, and pyramidal signs may also be present. Ragged-red fibers are found on muscle biopsy. (Adams et al., Principles of Neurology, 6th ed, p984)
Two pairs of small oval-shaped glands located in the front and the base of the NECK and adjacent to the two lobes of THYROID GLAND. They secrete PARATHYROID HORMONE that regulates the balance of CALCIUM; PHOSPHORUS; and MAGNESIUM in the body.
Neurons in the OLFACTORY EPITHELIUM with proteins (RECEPTORS, ODORANT) that bind, and thus detect, odorants. These neurons send their DENDRITES to the surface of the epithelium with the odorant receptors residing in the apical non-motile cilia. Their unmyelinated AXONS synapse in the OLFACTORY BULB of the BRAIN.
A subgroup of cyclic nucleotide-regulated ION CHANNELS within the superfamily of pore-loop cation channels. They are expressed in OLFACTORY NERVE cilia and in PHOTORECEPTOR CELLS and some PLANTS.
The volatile portions of substances perceptible by the sense of smell. (Grant & Hackh's Chemical Dictionary, 5th ed)
Positively charged atoms, radicals or groups of atoms with a valence of plus 2, which travel to the cathode or negative pole during electrolysis.
That portion of the nasal mucosa containing the sensory nerve endings for SMELL, located at the dome of each NASAL CAVITY. The yellow-brownish olfactory epithelium consists of OLFACTORY RECEPTOR NEURONS; brush cells; STEM CELLS; and the associated olfactory glands.
Gated, ion-selective glycoproteins that traverse membranes. The stimulus for ION CHANNEL GATING can be due to a variety of stimuli such as LIGANDS, a TRANSMEMBRANE POTENTIAL DIFFERENCE, mechanical deformation or through INTRACELLULAR SIGNALING PEPTIDES AND PROTEINS.

Suppression of hypoxia-associated vascular endothelial growth factor gene expression by nitric oxide via cGMP. (1/43)

PURPOSE: To investigate the suppressive effect of nitric oxide (NO) on vascular endothelial growth factor (VEGF) gene expression and to elucidate its mechanism of action. METHODS: Immortalized human retinal epithelial (RPE) cells, H-ras-transfected murine capillary endothelial cells, and nuclear factor-kappaB (NF-kappaB) RelA knockout 3T3 fibroblasts had VEGF gene expression stimulated by hypoxia, TPA (phorbol ester 12-O-tetradecanoylphorbol-13 acetate), and ras-transfection. The dose response and time course of inhibition of VEGF gene expression by NO were characterized by northern blot analysis, ribonuclease protection assay, and enzyme-linked immunosorbent assay. The effects of NF-kappaB and cGMP in the NO-induced suppression of VEGF gene expression were quantitated. cGMP production was inhibited by LY 83583 (6-anilino-5,8-quinolinedione), a specific inhibitor of guanylate cyclase production, and cGMP accumulation was quantitated by immunoassay. RelA knockout 3T3 fibroblasts were used to assess the contribution of NF-kappaB to the downregulation of VEGF by NO. RESULTS: The NO donor sodium nitroprusside (SNP) decreased hypoxia-induced VEGF gene expression in a dose- and time-dependent manner. One hundred fifty micromolar SNP completely suppressed hypoxia-induced VEGF mRNA levels for at least 24 hours. Constitutive VEGF expression was not altered by SNP. The SNP-mediated decreases in VEGF expression were associated with increases in intracellular cGMP and were blocked by LY 83583. Sodium nitroprusside was able to decrease hypoxia-induced VEGF mRNA increases in fibroblasts deficient in the RelA subunit of NF-kappaB. Nitric oxide was also effective at suppressing increased VEGF expression secondan, to mutant ras and TPA. CONCLUSIONS: These data indicate that NO decreases hypoxia-induced VEGF via a cGMP-dependent mechanism and suggest that NO may serve as an endogenous inhibitor of both hypoxia- and non- hypoxia-enhanced VEGF expression in vivo.  (+info)

Generating new ligand-binding RNAs by affinity maturation and disintegration of allosteric ribozymes. (2/43)

Allosteric ribozymes are engineered RNAs that operate as molecular switches whose rates of catalytic activity are modulated by the binding of specific effector molecules. New RNA molecular switches can be created by using "allosteric selection," a molecular engineering process that combines modular rational design and in vitro evolution strategies. In this report, we describe the characterization of 3',5'-cyclic nucleotide monophosphate (cNMP)-dependent hammerhead ribozymes that were created using allosteric selection (Koizumi et al., Nat Struct Biol, 1999, 6:1062-1071). Artificial phylogeny data generated by random mutagenesis and reselection of existing cGMP-, cCMP-, and cAMP-dependent ribozymes indicate that each is comprised of distinct effector-binding and catalytic domains. In addition, patterns of nucleotide covariation and direct mutational analysis both support distinct secondary-structure organizations for the effector-binding domains. Guided by these structural models, we were able to disintegrate each allosteric ribozyme into separate ligand-binding and catalytic modules. Examinations of the independent effector-binding domains reveal that each retains its corresponding cNMP-binding function. These results validate the use of allosteric selection and modular engineering as a means of simultaneously generating new nucleic acid structures that selectively bind ligands. Furthermore, we demonstrate that the binding affinity of an allosteric ribozyme can be improved through random mutagenesis and allosteric selection under conditions that favor tighter binding. This "affinity maturation" effect is expected to be a valuable attribute of allosteric selection as future endeavors seek to apply engineered allosteric ribozymes as biosensor components and as controllable genetic switches.  (+info)

Phenanthrolines--a new class of CFTR chloride channel openers. (3/43)

1. A number of phenanthrolines and benzoquinolines were examined for their ability to activate epithelial chloride secretion by measuring short circuit current (SCC) using the mouse colon epithelium. 1,10 phenanthroline stimulated electrogenic chloride secretion with an EC(50) of 612+/-10 microM and a Hill slope of 4.9+/-0.3. A similar pharmacology was demonstrated by both 1,7 and 4,7 phenanthrolines, 7,8 benzoquinoline and phenanthridine. 2. Evidence that the increase in SCC caused by 1,10 phenanthroline was due to chloride secretion is based upon (a) inhibition of the current by furosemide, (b) failure of cystic fibrosis (CF) colons to respond and (c) an associated net flux of (36)Cl(-). 3. 1,10 Phenanthroline affected neither the generation of cyclic AMP or the concentration of intracellular Ca(2+) in colonic epithelial cells. 4. 1,10 phenanthroline affected the chloride conductance of the apical membrane, as shown by an increase in chloride current in 'apical membrane only' preparations in the presence of an apical to basolateral chloride gradient. The increase in chloride current was inhibited by 5-nitro-2-(3-phenylpropylamino) benzoic acid (NPPB) and was not present in CF colons. 5. Additionally, 1,10 phenanthroline activated basolateral K(+) channels, both Ca(2+)- and cyclic AMP-sensitive channels, as shown by inhibitor studies with charybdotoxin (ChTX) and XE991, and after the apical membrane was permeabilized with nystatin. 6. The phenanthrolines and benzoquinolines described here, with dual actions affecting CFTR and basolateral K(+) channels, may constitute useful lead compounds for adjunct therapy in CF.  (+info)

Contribution of Gln9 and Phe80 to substrate binding in ribonuclease MC1 from bitter gourd seeds. (4/43)

Ribonuclease MC1 (RNase MC1) isolated from bitter gourd (Momordica charantia) seeds specifically cleaves phosphodiester bonds on the 5'-side of uridine. The crystal structures of RNase MC1 in complex with 2'-UMP or 3'-UMP reveal that Gln9, Asn71, Leu73, and Phe80 are involved in uridine binding by hydrogen bonding and hydrophobic interactions [Suzuki et al. (2000) Biochem. Biophys. Res. Commun. 275, 572-576]. To evaluate the contribution of Gln9 and Phe80 to uridine binding, Gln9 was replaced with Ala, Phe, Glu, or His, and Phe80 with Ala by site-directed mutagenesis. The kinetic properties of the resulting mutant enzymes were characterized using cytidylyl-3',5'-uridine (CpU) as a substrate. The mutant Q9A exhibited a 3.7-fold increased K(m) and 27.6-fold decreased k(cat), while three other mutations, Q9F, Q9E, and Q9H, predominantly affected the k(cat) value. Replacing Phe80 with Ala drastically reduced the catalytic efficiency (k(cat)/K(m)) with a minimum K(m) value equal to 8 mM. It was further found that the hydrolytic activities of the mutants toward cytidine-2',3'-cyclic monophosphate (cCMP) were reduced. These results demonstrate that Gln9 and Phe80 play essential roles not only in uridine binding but also in hydrolytic activity. Moreover, we produced double Ala substituted mutants at Gln9, Asn71, Leu73, and Phe80, and compared their kinetic properties with those of the corresponding single mutants. The results suggest that these four residues may contribute to uridine binding in a mutually independent manner.  (+info)

The HD domain of the Escherichia coli tRNA nucleotidyltransferase has 2',3'-cyclic phosphodiesterase, 2'-nucleotidase, and phosphatase activities. (5/43)

In all mature tRNAs, the 3'-terminal CCA sequence is synthesized or repaired by a template-independent nucleotidyltransferase (ATP(CTP):tRNA nucleotidyltransferase; EC 2.7.7.25). The Escherichia coli enzyme comprises two domains: an N-terminal domain containing the nucleotidyltransferase activity and an uncharacterized C-terminal HD domain. The HD motif defines a superfamily of metal-dependent phosphohydrolases that includes a variety of uncharacterized proteins and domains associated with nucleotidyltransferases and helicases from bacteria, archaea, and eukaryotes. The C-terminal HD domain in E. coli tRNA nucleotidyltransferase demonstrated Ni(2+)-dependent phosphatase activity toward pyrophosphate, canonical 5'-nucleoside tri- and diphosphates, NADP, and 2'-AMP. Assays with phosphodiesterase substrates revealed surprising metal-independent phosphodiesterase activity toward 2',3'-cAMP, -cGMP, and -cCMP. Without metal or in the presence of Mg(2+), the tRNA nucleotidyltransferase hydrolyzed 2',3'-cyclic substrates with the formation of 2'-nucleotides, whereas in the presence of Ni(2+), the protein also produced some 3'-nucleotides. Mutations at the conserved His-255 and Asp-256 residues comprising the C-terminal HD domain of this protein inactivated both phosphodiesterase and phosphatase activities, indicating that these activities are associated with the HD domain. Low concentrations of the E. coli tRNA (10 nm) had a strong inhibiting effect on both phosphatase and phosphodiesterase activities. The competitive character of inhibition by tRNA suggests that it might be a natural substrate for these activities. This inhibition was completely abolished by the addition of Mg(2+), Mn(2+), or Ca(2+), but not Ni(2+). The data suggest that the phosphohydrolase activities of the HD domain of the E. coli tRNA nucleotidyltransferase are involved in the repair of the 3'-CCA end of tRNA.  (+info)

Cofactor fingerprinting with STD NMR to characterize proteins of unknown function: identification of a rare cCMP cofactor preference. (6/43)

Proteomics efforts have created a need for better strategies to functionally categorize newly discovered proteins. To this end, we have employed saturation transfer difference NMR with pools of closely related cofactors, to determine cofactor preferences. This approach works well for dehydrogenases and has also been applied to cyclic nucleotide-binding proteins. In the latter application, a protein (radial spoke protein-2, RSP2) that plays a central role in forming the radial spoke of Chlamydomonas reinhardtii flagella was shown to bind cCMP. cCMP-binding proteins are rare, although previous reports of their presence in sperm and flagella suggest that cCMP may have a more general role in flagellar function. 31P NMR was used to monitor the preferential hydrolysis of ATP versus GTP, suggesting that RSP2 is a kinase.  (+info)

Hypertonicity regulates the aquaporin-2 promoter independently of arginine vasopressin. (7/43)

BACKGROUND: Aquaporin-2 (AQP-2) is an arginine vasopressin (AVP)-regulated water channel in kidney collecting duct cells. The present study was undertaken to determine whether a change in tonicity could directly regulate the AQP-2 gene in an in vitro experiment. METHODS: Various fragments of the 5'-flanking region of the murine AQP-2 gene up to -9.5 kb were cloned into a luciferase (Luc) reporter plasmid, and they were transiently transfected into Madin-Darby canine kidney cells. RESULTS: Hypertonicity significantly increased the Luc activity of the constructs containing >6.1 kb of the 5'-flanking region of the AQP-2 gene (-6.1AQP2). However, promoter regions <4.3 kb in length containing the tonicity-responsive enhancer (TonE) at bp -570 to -560 were not stimulated by hypertonicity. The TonE-deleted construct which contains -9.5 to -1.1 kb of the 5' side of the AQP-2 gene, 8.4AQP2, was also stimulated by hypertonicity. Mitogen-activated protein (MAP) kinase inhibitors SB203580 and U0126 did not affect the Luc activity of -6.1AQP2 induced by hypertonicity. In addition, the vector expressing dominant-negative TonE-binding protein (TonEBP) did not affect the hypertonicity-induced Luc activity of -6.1AQP2. The Luc activity of -6.1AQP2 was stimulated by the overexpression of TonEBP. Hypertonicity further increased the Luc activity of -6.1AQP2 under the overexpression of TonEBP. CONCLUSION: These findings indicate that hypertonicity regulates AQP-2 promoter activity via an AVP-independent mechanism, and that the tonicity-responsive element resides between the -6.1 and -4.3 kb 5'-flanking region of the AQP-2 gene, in which the structure and mechanism of response to hypertonicity could be distinct from those of TonE.  (+info)

A comparison of the diagnostic accuracy and prognostic value of the first and second anti-cyclic citrullinated peptides (CCP1 and CCP2) autoantibody tests for rheumatoid arthritis. (8/43)

OBJECTIVES: To compare the diagnostic performance and prognostic value of the anti-cyclic citrullinated peptide (CCP1) and anti-CCP2 autoantibody tests in a clinical setting. METHODS: Anti-CCP1 and anti-CCP2 antibody tests were performed on the same serum samples obtained from 467 patients with early arthritis from the Leiden Arthritis Cohort. The sensitivity, specificity, positive predictive value, and negative predictive value for discriminating between rheumatoid arthritis (RA) and non-RA at 1 year's follow up were calculated for both tests. Results were graphically presented using receiver operating characteristic curves. Progression of radiological joint damage was assessed over 4 years in patients with RA and used to assess the prognostics values of the CCP tests. RESULTS: At a similar specificity the CCP2 test had a higher sensitivity than the CCP1 test. Both tests identified a subgroup of patients with RA with an increased rate of joint damage progression. The anti-CCP2 test identified more patients with an increased rate of joint damage progression than the anti-CCP1 test, and in multiple regression analysis CCP2 was the better predictor of joint damage. CONCLUSIONS: The CCP2 test had better diagnostic and prognostic ability than the CCP1 test.  (+info)

Stephen Murray was a globally renowned private equity investor and leading philanthropist. Mr. Murray passed on March 12, 2015, at the age of 52. He was the head of CCMP […]. Read More → ...
Looking to get certified? If youd like to become a Certified Change Management Professional (CCMP), ACMP Atlanta can help you on your certification journey. Periodically, we will host study groups for ACMP Atlanta members who have or plan to obtain 21 hours of change management training ...
Stem cell markers are genes and their protein products used by scientists to isolate and identify stem cells. Stem cells can also be identified by functional assays. Below is a list of genes/protein products that can be used to identify various types of stem cells, or functional assays that do the same. The initial version of the list below was obtained by mining the PubMed database as described in AA4 AA4.1 P-gp (CD243) ABCB5 ABCG2 (CDw338) ALDH alkaline phosphatase alpha6-integrin Anti-WNT2B monoclonal antibody antithrombin III (AT) asialo GM1 Bcl-2 Beta-galactosidase (β-gal) of ROSA26 mice beta1-integrin bromodeoxyuridine c-kit (CD117) c-Met C1qR(p) END (CD105) PROM1 (CD133) ALCAM (CD166) ITGB1 (CD29) TNFRSF8 (CD30) PECAM-1 (CD31) Siglec-3 (CD33) CD34 CD44 NCAM (CD56) CD73 CD9 CD90 CDCP1 Circulating anticoagulants protein C (PC) CK19 CLV3 cyclic CMP ECMA-7 EDR1 EEC FGF-4 Flk-2 Flk1(+) Flt3/Flk2 FMS (CD115) FORSE-1 G alpha16 GDF3 GFPM Giant granules of beige C57B1/6 (bg) mice Gli2 Gli3 glial ...
Costanzo G, Giorgi A, Scipioni A, Timperio AM, Mancone C, Tripodi M, Kapralov M, Krasavin E, Kruse H, Šponer J, Šponer JE, Ranc Václav , Otyepka M, Pino S, Di Mauro E: Nonenzymatic Oligomerization of 3,5 Cyclic CMP Induced by Proton- and UV-Irradiation Hints at a Non-Fastidious Origin of RNA. ChemiBioChem, 18(5), 1535-1543, 2017. (DOI ...
Costanzo G, Giorgi A, Scipioni A, Timperio AM, Mancone C, Tripodi M, Kapralov M, Krasavin E, Kruse H, Šponer J, Šponer JE, Ranc Václav , Otyepka M, Pino S, Di Mauro E: Nonenzymatic Oligomerization of 3,5 Cyclic CMP Induced by Proton- and UV-Irradiation Hints at a Non-Fastidious Origin of RNA. ChemiBioChem, 18(5), 1535-1543, 2017. (DOI ...
These reference sequences exist independently of genome builds. Explain. These reference sequences are curated independently of the genome annotation cycle, so their versions may not match the RefSeq versions in the current genome build. Identify version mismatches by comparing the version of the RefSeq in this section to the one reported in Genomic regions, transcripts, and products above. ...
the output of iwlist scan wlx00c0ca58180d Scan completed : Cell 01 - Address: 5C:F4:AB:09:D3:B3 Channel:1 Frequency:2.412 GHz (Channel 1) Quality=31/70 Signal level=-79 dBm Encryption key:on ESSID:Internet_B0 Bit Rates:1 Mb/s; 2 Mb/s; 5.5 Mb/s; 11 Mb/s; 18 Mb/s 24 Mb/s; 36 Mb/s; 54 Mb/s Bit Rates:6 Mb/s; 9 Mb/s; 12 Mb/s; 48 Mb/s Mode:Master Extra:tsf=000001d780c847a5 Extra: Last beacon: 4132ms ago IE: Unknown: 000B496E7465726E65745F4230 IE: Unknown: 010882848B962430486C IE: Unknown: 030101 IE: Unknown: 2A0104 IE: Unknown: 2F0104 IE: IEEE 802.11i/WPA2 Version 1 Group Cipher : CCMP Pairwise Ciphers (1) : CCMP Authentication Suites (1) : PSK IE: Unknown: 32040C121860 IE: Unknown: 0B050200140000 IE: Unknown: 2D1AAC181FFFFF000000000000000000000000000000000000000000 IE: Unknown: 3D1601000400000000000000000000000000000000000000 IE: Unknown: 7F03000008 IE: Unknown: ...
the output of iwlist scan wlx00c0ca58180d Scan completed : Cell 01 - Address: 5C:F4:AB:09:D3:B3 Channel:1 Frequency:2.412 GHz (Channel 1) Quality=31/70 Signal level=-79 dBm Encryption key:on ESSID:Internet_B0 Bit Rates:1 Mb/s; 2 Mb/s; 5.5 Mb/s; 11 Mb/s; 18 Mb/s 24 Mb/s; 36 Mb/s; 54 Mb/s Bit Rates:6 Mb/s; 9 Mb/s; 12 Mb/s; 48 Mb/s Mode:Master Extra:tsf=000001d780c847a5 Extra: Last beacon: 4132ms ago IE: Unknown: 000B496E7465726E65745F4230 IE: Unknown: 010882848B962430486C IE: Unknown: 030101 IE: Unknown: 2A0104 IE: Unknown: 2F0104 IE: IEEE 802.11i/WPA2 Version 1 Group Cipher : CCMP Pairwise Ciphers (1) : CCMP Authentication Suites (1) : PSK IE: Unknown: 32040C121860 IE: Unknown: 0B050200140000 IE: Unknown: 2D1AAC181FFFFF000000000000000000000000000000000000000000 IE: Unknown: 3D1601000400000000000000000000000000000000000000 IE: Unknown: 7F03000008 IE: Unknown: ...
Next-day shipping cDNA ORF clones derived from MICPUCDRAFT_53506 hypothetical protein available at GenScript, starting from $99.00.
Next-day shipping cDNA ORF clones derived from MICPUCDRAFT_63979 hypothetical protein available at GenScript, starting from $99.00.
Of course, technical analysis is just one part of the puzzle - it may help you to make trading decisions, but its foolish to only trade based on technical analysis. In addition to technical analysis, you should also conduct fundamental analysis, looking through the balance sheet of Cabot Microelectronics Corporation. Heres how it stands right now:. ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
ID L1JYA3_GUITH Unreviewed; 2741 AA. AC L1JYA3; DT 06-MAR-2013, integrated into UniProtKB/TrEMBL. DT 06-MAR-2013, sequence version 1. DT 22-NOV-2017, entry version 30. DE SubName: Full=Uncharacterized protein {ECO:0000313,EMBL:EKX53561.1, ECO:0000313,EnsemblProtists:EKX53561}; GN ORFNames=GUITHDRAFT_160866 {ECO:0000313,EMBL:EKX53561.1}; OS Guillardia theta CCMP2712. OC Eukaryota; Cryptophyta; Pyrenomonadales; Geminigeraceae; Guillardia. OX NCBI_TaxID=905079 {ECO:0000313,EMBL:EKX53561.1, ECO:0000313,Proteomes:UP000011087}; RN [1] {ECO:0000313,EMBL:EKX53561.1, ECO:0000313,EnsemblProtists:EKX53561, ECO:0000313,Proteomes:UP000011087} RP NUCLEOTIDE SEQUENCE. RC STRAIN=CCMP2712 {ECO:0000313,EMBL:EKX53561.1, RC ECO:0000313,Proteomes:UP000011087}; RX PubMed=23201678; DOI=10.1038/nature11681; RG DOE Joint Genome Institute; RA Curtis B.A., Tanifuji G., Burki F., Gruber A., Irimia M., Maruyama S., RA Arias M.C., Ball S.G., Gile G.H., Hirakawa Y., Hopkins J.F., Kuo A., RA Rensing S.A., Schmutz J., Symeonidi ...
On Fri, Apr 16, 2010 at 10:34:14AM -0300, Douglas Diniz wrote: , Hi, I have a embedded system with a Freescale mpc8323e processor. Im , using Hostap to do the encryption in the Wifi interface (Ubiquiti card , with Madwifi driver). Im not sure what exactly you are describing here.. If you are referring to hostapd with Hostap, please note that hostapd does not encrypt or decrypt data frames; your driver or WLAN hardware does it (in case of Madwifi, you are likely already using hardware acceleration for data frame encryption and decryption with CCMP/TKIP/WEP). , This processor has a Encryption Acceleration hardware, and I want to use this. , Someone know what I have to do? Do I need to do something in the hostap code? What exactly do you want to do with this hardware? It would not make much sense to try to accelerate CCMP/TKIP/WEP since they are already taken care of in hardware and doing this on an external (to the WLAN card) component would just slow things down. I would assume you could try ...
The comprehensive metabolic panel (CMP) is a group of 14 tests that measures several substances in your blood. The CMP is often used as part of a general health exam to screen for and diagnose a number of conditions that can affect your kidneys, lungs, and liver, for example.
An overview of the comprehensive metabolic panel (CMP), including why the test is ordered and how it works. Also, info on Type 2 diabetes and more.
ID PROMP_1_PE100 STANDARD; PRT; 555 AA. AC PROMP_1_PE100; Q7V3H5; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE SubName: Full=L-aspartate oxidase; EC=1.4.3 16; (PROMP_1.PE100). GN Name=nadB; OrderedLocusNames=PMM0100; OS PROCHLOROCOCCUS MARINUS SUBSP. PASTORIS STR. CCMP1986. OC Bacteria; Cyanobacteria; Prochlorales; Prochlorococcaceae; OC Prochlorococcus. OX NCBI_TaxID=59919; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS PROMP_1.PE100. CC Prochlorococcus marinus subsp. pastoris str. CCMP1986, complete genome. CC genome. CC -!- ANNOTATIONS ORIGIN:Q7V3H5_PROMP CC -!- GENE_FAMILY: HOG000160476 [ FAMILY / ALN / TREE ] DR UniProtKB/Swiss-Prot; Q7V3H5; -. DR EMBL; BX548174; CAE18559.1; -; Genomic_DNA. DR RefSeq; NP_892221.1; NC_005072.1. DR HSSP; P83223; 1D4D. DR ProteinModelPortal; Q7V3H5; -. DR STRING; Q7V3H5; -. DR GeneID; 1725749; -. DR GenomeReviews; BX548174_GR; PMM0100. DR ...
One fox sits atop the formally christened office. Nancy-Ann worked for J.P. Morgan Partners LLP, which later became CCMP Capital Advisers, a private equity underwriter (PEU) specializing in health care. Ms. DeParle sits on the board of four for-profit health care boards. Her 2007 board compensation was nearly $550,000. Her stock holdings were recently worth over $3.1 million ...
/PRNewswire/ -- Research and Markets (http://www.researchandmarkets.com/research/nt4nh3/cmp_technology) has announced the addition of the CMP Technology:...
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely. ...
Cryptophytes are an enigmatic group of unicellular eukaryotes with plastids derived by secondary (i.e., eukaryote-eukaryote) endosymbiosis. Cryptophytes are unusual in that they possess four genomes-a host cell-derived nuclear and mitochondrial genome and an endosymbiont-derived plastid and nucleomorph genome. The evolutionary origins of the host and endosymbiont components of cryptophyte algae are at present poorly understood. Thus far, a single complete mitochondrial genome sequence has been determined for the cryptophyte Rhodomonas salina. Here, the second complete mitochondrial genome of the cryptophyte alga Hemiselmis andersenii CCMP644 is presented. The H. andersenii mtDNA is 60,553 bp in size and encodes 30 structural RNAs and 36 protein-coding genes, all located on the same strand. A prominent feature of the genome is the presence of a ~20 Kbp long intergenic region comprised of numerous tandem and dispersed repeat units of between 22-336 bp. Adjacent to these repeats are 27 copies of
ABSTRACT: Members of the marine phytoplankton genus Phaeocystis (Prymnesiophyceae) produce large amounts of the intracellular osmolyte DMSP and they are known to also produce lyase enzymes that cleave DMSP into the biogeochemically important trace gas DMS. The functional characteristics of DMSP lyase activity in Phaeocystis spp. are not well known. We characterized DMSP lyase activity in extracts from 2 ecologically important species from this genus, the mesophile P. globosa (strain CCMP629) and the psychrophile P. antarctica (strain CCMP1374). Results from whole cell extracts showed that both algal species were potent producers of DMSP lyase, with Michaelis-Menten constant (Km) and maximum reaction velocity (Vmax) values of 1.77 mM and 17.3 nmol DMS min-1 mg protein-1, respectively, for P. globosa, and 2.31 mM and 28.2 nmol DMS min-1 mg protein-1, respectively, for P. antarctica. The optimal DMSP lyase activity was recorded at pH 4 and 30?C for P. globosa, and at pH 5 and 20?C for P. ...
SAM domain and HD domain-containing protein 1 is a protein that in humans is encoded by the SAMHD1 gene. SAMHD1 is a cellular enzyme, responsible for blocking replication of HIV in dendritic cells, macrophages and monocytes. It is an enzyme that exhibits phosphohydrolase activity, converting deoxynucleoside triphosphates (dNTPs) to inorganic phosphate (iPPP) and a 2-deoxynucleoside (i.e. deoxynucleosides without a phosphate group). In doing so, SAMHD1 depletes the pool of dNTPs available to a reverse transcriptase for viral cDNA synthesis and thus prevents viral replication. SAMHD1 has also shown nuclease activity. Although a ribonuclease activity was described to be required for HIV-1 restriction, recent data confirmed that SAMHD1-mediated HIV-1 restriction in cells does not involve ribonuclease activity. The SAMHD1 protein is also known as: AGS5: Aicardi- Goutières syndrome type 5 DCIP: Dendritic cell-derived IFNG-induced protein2 Mg11: Interferon-gamma-inducible protein HDDC1: HD domain ...
Cytarabine, a deoxycytidine nucleoside analog, forms the backbone of most chemotherapy regimens for acute myeloid leukemia (AML) and has been used for over 40 years. Intracellular accumulation of its active metabolite, a deoxynucleoside triphosphate known as ara-CTP, causes leukemic cell death by interfering with DNA synthesis. The lack of response to cytarabine is among the major causes of treatment failure, yet the precise determinants of differential patient response remain undefined. A mechanistic understanding of factors responsible for interindividual differences in cytarabine sensitivity could improve AML patient outcomes, particularly if a clinically tractable approach could be found to enhance cytarabine sensitivity.. Herold, Rudd, and colleagues postulated that cytarabine sensitivity could be affected by endogenous cellular factors capable of hydrolyzing deoxynucleoside triphosphates. SAMHD1 (deoxynucleoside triphosphate triphosphohydrolase SAM domain and HD domain 1) was previously ...
TY - JOUR. T1 - 7 tRNA Nucleotidyltransferase. AU - Deutscher, Murray P. PY - 1982/12/1. Y1 - 1982/12/1. UR - http://www.scopus.com/inward/record.url?scp=77956942628&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=77956942628&partnerID=8YFLogxK. U2 - 10.1016/S1874-6047(08)60279-6. DO - 10.1016/S1874-6047(08)60279-6. M3 - Article. AN - SCOPUS:77956942628. VL - 15. SP - 183. EP - 215. JO - Enzymes. JF - Enzymes. SN - 0423-2607. IS - C. ER - ...
Index: compiler/x86/aoptx86.pas =================================================================== --- compiler/x86/aoptx86.pas (revision 44021) +++ compiler/x86/aoptx86.pas (working copy) @@ -3303,43 +3303,185 @@ function TX86AsmOptimizer.OptPass1Cmp(var p: tai): boolean; var v: TCGInt; - hp1, hp2, hp3, hp4: tai; + hp1, hp2: tai; begin Result:=false; - { cmp register,$8000 neg register - je target --, jo target - .... only if register is deallocated before jump.} - case Taicpu(p).opsize of - S_B: v:=$80; - S_W: v:=$8000; - S_L: v:=qword($80000000); - { actually, this will never happen: cmp with 64 bit constants is not possible } - S_Q : v:=Int64($8000000000000000); - else - internalerror(2013112905); - end; - if MatchOpType(taicpu(p),Top_const,top_reg) and - (taicpu(p).oper[0]^.val=v) and - GetNextInstruction(p, hp1) and - MatchInstruction(hp1,A_Jcc,[]) and - (Taicpu(hp1).condition in [C_E,C_NE]) then + if taicpu(p).oper[0]^.typ = top_const then begin - TransferUsedRegs(TmpUsedRegs); - ...
Consumers should immediately stop using the recalled dock ladders and contact CMP Group to return the ladders for a full refund or a free replacement ladder.
ID HEMAN_1_PE108 STANDARD; PRT; 345 AA. AC HEMAN_1_PE108; A9BKW7; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE SubName: Full=Rcl1; (HEMAN_1.PE108). GN ORFNames=HAN_2g302; OS HEMISELMIS ANDERSENII. OG Nucleomorph. OC Eukaryota; Cryptophyta; Cryptomonadales; Hemiselmidaceae; Hemiselmis. OX NCBI_TaxID=464988; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS HEMAN_1.PE108. CC Hemiselmis andersenii (strain CCMP644) chromosome 2, nucleomorph, CC complete sequence. CC -!- ANNOTATIONS ORIGIN:A9BKW7_HEMAN CC -!- GENE_FAMILY: HBG000000000 [ FAMILY / ALN / TREE ] DR UniProtKB/Swiss-Prot; A9BKW7; -. DR EMBL; CP000882; ABW98122.1; -; Genomic_DNA. DR RefSeq; XP_001712447.1; XM_001712395.1. DR GeneID; 5739692; -. DR ProtClustDB; CLSN2924336; -. DR GO; GO:0033009; C:nucleomorph; IEA:UniProtKB-KW. DR GO; GO:0003824; F:catalytic activity; IEA:InterPro. DR InterPro; IPR023797; ...
The pancreas is a mixed gland secretion (external or internal or digestive and insulin) that is in the highest part of the deep abdominal cavity behind the stomach. The pancreas is located in a transverse position with a head, body and tail. Its internal structure is clustered and each of the grains corresponds to a secretory gland acinus.
681 meanings of CMP acronym and CMP abbreviation. Get the definition of CMP by All Acronyms dictionary. Top Definition: Configuration Management Plan
The comprehensive metabolic panel (CMP), plasma lab test helps to diagnose a broad range of health conditions. Order it online to avoid costly doctors visits!
As reported in the Portland Press Herald and on MPBN News, CMP and most intervenors in the rate design case have reached a tentative settlement which
sub ascii {$a cmp $b} sub alpha {lc($a) cmp lc($b)} @a = qw(a A b B D d c C); $subname = ascii; @sorted = sort $subname @a; print @sorted; $subname = alpha; @sorted = sort $subname @a; print @sorted ...
Saxitoxin is a potent neurotoxin that occurs in aquatic environments worldwide. Ingestion of vector species can lead to paralytic shellfish poisoning, a severe human illness that may lead to paralysis and death. In freshwaters, the toxin is produced by prokaryotic cyanobacteria; in marine waters, it is associated with eukaryotic dinoflagellates. However, several studies suggest that saxitoxin is not produced by dinoflagellates themselves, but by co-cultured bacteria. Here, we show that genes required for saxitoxin synthesis are encoded in the nuclear genomes of dinoflagellates. We sequenced |1.2×106 mRNA transcripts from the two saxitoxin-producing dinoflagellate strains Alexandrium fundyense CCMP1719 and A. minutum CCMP113 using high-throughput sequencing technology. In addition, we used in silico transcriptome analyses, RACE, qPCR and conventional PCR coupled with Sanger sequencing. These approaches successfully identified genes required for saxitoxin-synthesis in the two transcriptomes. We focused
ID C1DZM5_MICCC Unreviewed; 982 AA. AC C1DZM5; DT 26-MAY-2009, integrated into UniProtKB/TrEMBL. DT 26-MAY-2009, sequence version 1. DT 22-NOV-2017, entry version 37. DE SubName: Full=Phosphoenolpyruvate carboxylase {ECO:0000313,EMBL:ACO60676.1}; GN Name=PEPC {ECO:0000313,EMBL:ACO60676.1}; GN ORFNames=MICPUN_104763 {ECO:0000313,EMBL:ACO60676.1}; OS Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) (Picoplanktonic OS green alga). OC Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; OC Mamiellales; Mamiellaceae; Micromonas. OX NCBI_TaxID=296587 {ECO:0000313,EMBL:ACO60676.1, ECO:0000313,Proteomes:UP000002009}; RN [1] {ECO:0000313,EMBL:ACO60676.1, ECO:0000313,Proteomes:UP000002009} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=RCC299 / NOUM17 {ECO:0000313,Proteomes:UP000002009}; RX PubMed=19359590; DOI=10.1126/science.1167222; RA Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., RA Allen A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon ...
T316 3.0 Clamp 90° Elbow 2CMP ID/OD Polish Sanitary-. divTable{display: table;width: 100%;}. divTableRow {display: table-row;}. divTableHeading {back
Urban Exploration Resource: Featuring Urban Exploration stories and a huge database of locations and pictures from a variety of abandoned buildings and other unique places.
Thank you for your interest in spreading the word on American Association for Respiratory Care.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
TY - JOUR. T1 - Blood-Derived RNA- and microRNA-Hydrolyzing IgG Antibodies in Schizophrenia Patients. AU - Ermakov, E. A.. AU - Ivanova, S. A.. AU - Buneva, V. N.. AU - Nevinsky, G. A.. PY - 2018/5/1. Y1 - 2018/5/1. N2 - Abzymes with various catalytic activities are the earliest statistically significant markers of existing and developing autoimmune diseases (AIDs). Currently, schizophrenia (SCZD) is not considered to be a typical AID. It was demonstrated recently that antibodies from SCZD patients efficiently hydrolyze DNA and myelin basic protein. Here, we showed for the first time that autoantibodies from 35 SCZD patients efficiently hydrolyze RNA (cCMP , poly(C) , poly(A) , yeast RNA) and analyzed site-specific hydrolysis of microRNAs involved in the regulation of several genes in SCZD (miR-137, miR-9-5p, miR-219-2-3p, and miR-219a-5p). All four microRNAs were cleaved by IgG preparations (n = 21) from SCZD patients in a site-specific manner. The RNase activity of the abzymes correlated with ...
I have recieved my CMP and LFT blood results. I am noticing my AST is 88 and my ALT is 160 while all other LFTs are - Answered by a verified Doctor
CMP Pharma is a specialty pharmaceutical company that develops and manufactures a portfolio of high value topical and liquid products that address critical needs for niche markets within the pharmaceutical and life science industries ...
17.1 Introduction.. 17.2 Defects After Oxide CMP.. 17.3 Defects After Polysilicon CMP.. 17.4 Defects After Tungsten CMP.. 17.5 Defects After Copper CMP.. 17.6 Defect Observation and Characterization Techniques.. 17.7 Ensemble Defect Detection and Inspection Techniques.. 17.8 Consideration for the Future.. 18 CMP Slurry Metrology, Distribution, and Filtration.. 18.1 Introduction.. 18.2 CMP Slurry Metrology and Characterization.. 18.3 CMP Slurry Blending and Distribution.. 18.4 CMP Slurry Filtration.. 18.5 Pump Handling Effects on CMP Slurry Filtration-Case Studies.. 19 The Facilities Side of CMP.. 19.1 Introduction.. 19.2 Characterization of the CMP Waste Stream.. 19.3 Materials of Compatibility.. 19.4 Collection System Methodologies.. 19.5 Treatment System Components.. 19.6 Integration of Components-Putting It All Together.. 19.7 Conclusions.. 20 CMP-The Next Fifteen Years.. 20.1 The Past 15 Years.. 20.2 Challenges to Silicon IC Manufacturing.. 20.3 New CMP Processes ...
A comprehensive metabolic panel (CMP) blood test helps evaluate kidney and liver function, sugar (glucose) and protein levels in the blood, and electrolyte and fluid balance.
The Effects of H2O2 Bleaching and DTPA Spraying on the Brightness Stability of Hornbeam CMP Pulp following Accelerated Irradiation Aging
IRLNEP work plan projects developed during the previous year focused on water quality and invasive species monitoring with the St. Johns River Water Management District (SJRWMD) and University of Central Florida respectively. Citizen education and engagement projects were implemented as a high-priority application of EPA Section 320 funds. For the first time, IRLNEP funded a project to pilot test nutrient reduction strategies. Grant writing/capacity building support of local community projects that implement the IRL CCMP provided a high return on investment value to local community partners. Local and state agencies began to react and respond to the 2011 superbloom by convening local community and scientific workshops. The SJRWMD convened and funded a consortium of more than 20 scientists to explore available data and identify cause-effect relationships that potentially could explain what triggered and sustained the superbloom. Scientists from IRLNEP, Bethune-Cookman University, Florida Fish and ...
Diatom Cultures. The diatom Thalassiosira pseudonana was selected as the study organism as it has a well-characterized physiology, genome, and proteome [11, 25-27]. T. pseudonana clone 3H (CCMP1335, mean diameter: 4 µm) was obtained from the Provasoli-Guillard Center for Culture of Marine Phytoplankton (West Boothbay Harbor, ME, USA). Cells were grown axenically using semi-continuous batch culturing with a modified version of f/2 made in 0.2-µm filtered and microwave-sterilized Sargasso seawater [28]. Fe was added separately to achieve the desired concentrations. Biological duplicate cultures grown under replete conditions received 400 nM Fe. The inoculum for the biological duplicate Fe-limited treatment came from an exponentially growing replete culture that was diluted (1:10) in media without added Fe. Cultures were grown in 2-L acid-cleaned polycarbonate flasks. All cultures were maintained at 13°C, at a continuous light intensity of 150 μmol quanta m- 2 s-1, and provided with cool-white ...
A CMP blood test, or comprehensive metabolic panel, checks a patients blood glucose level, kidney and liver functions, and level of electrolytes, according to WebMD. This test may be included in a...
... cyclic CMP + diphosphate Hence, this enzyme has one substrate, CTP, and two products, 3',5'-cyclic CMP and diphosphate. This ... cyclic-CMP-forming). Other names in common use include 3',5'-cyclic-CMP synthase, cytidylyl cyclase, cytidyl cyclase, and CTP ... JH (1985). "3',5'-Cyclic UMP, -cyclic IMP, -cyclic TMP and related enzymes in mammalian-tissues". Biochem. Soc. Trans. 13: 1134 ... cyclic CMP) formation by homogenates of mouse liver". Biochem. Biophys. Res. Commun. 80 (1): 119-25. doi:10.1016/0006-291X(78) ...
This cyclic "waterwheel" gives the falls their name. "Glen Aulin High Sierra Camp to Waterwheel Falls". Los Angeles Times. ...
Rodríguez, Carlos Iván; Setaluri, Vijayasaradhi (2014). "Cyclic AMP (cAMP) signaling in melanocytes and melanoma". Arch. ... which produces cyclic adenosine monophosphate (cAMP), which activates protein kinase A (PKA), which activates by protein ... The MC1R and cAMP signaling pathway starts with the activation of MC1R, which causes activation of adenylyl cyclase (AC), ... Lee, Ai-Young; Noh, Minsoo (2013). "The regulation of epidermal melanogenesis via cAMP and/or PKC signaling pathways: insights ...
Cyclic adenosine monophosphate (cAMP) is pervasive in signal transduction. Adenosyl (Ad) is the radical formed by removal of ... The A1 receptors couple to Gi/o and decreases cAMP levels, while the A2 adenosine receptors couple to Gs, which stimulates ... This is mediated via the A1 receptor, inhibiting adenylyl cyclase, reducing cAMP and so causing cell hyperpolarization by ...
Cyclic adenosine monophosphate (cAMP) is produced during glucose starvation; this molecule acts as an allosteric effector that ... The catabolite activator protein (CAP), otherwise known as cAMP receptor protein (CRP), activates transcription at the lac ...
This enzyme produces the second messenger cyclic adenosine monophosphate (cAMP). In the lung, cAMP decreases calcium ...
The NLRC4 inflammasome is regulated by cyclic adenosine monophosphate (cAMP). Apoptosis-associated speck like protein ...
Calcium ions or cyclic AMP (cAMP) act as secondary messengers. This is an example of negative control. The calcium ions ... The latter enzyme causes the formation of cyclic AMP from ATP; two molecules of cyclic AMP bind to the regulatory subunit of ...
Some primary hemostasis inhibitors are cAMP, prostacyclin, PGE1, and kistrin. cAMP, cyclic adenosine monophosphate, ... TPα stimulates cAMP levels whereas TPβ inhibits the level of intracellular cAMP. Serotonin, 5-HT, is an amine synthesized in ... inhibition of cyclic AMP breakdown by cyclic GMP". Molecular Pharmacology. 37 (5): 671-681. Siess, Wolfgang; Eduardo, Lapetina ... PGI2, prostacyclin, binds to IP receptors that catalyze cAMP formation. This process is mediated via GTP-binding protein Gs and ...
Examples of second messengers include cyclic AMP (cAMP) and calcium ions. Membrane receptors function by binding the signal ... Examples of second messengers include cyclic AMP (cAMP) and calcium ions. Membrane receptors function by binding the signal ... Examples of second messengers include cyclic AMP (cAMP) and calcium ions. Responseslide_49 Cell signaling ultimately leads to ...
PDE4 hydrolyzes cyclic adenosine monophosphate (cAMP) to inactive adenosine monophosphate (AMP). Inhibition of PDE4 blocks ... hydrolysis of cAMP thereby increasing levels of cAMP within cells. cAMP suppresses the activity of immune and inflammatory ... EP application 0497564 Souness JE, Houghton C, Sardar N, Withnall MT (June 1997). "Evidence that cyclic AMP phosphodiesterase ...
Two cAMP (cyclic AMP) molecules bind dimeric CAP with negative cooperativity. Cyclic AMP functions as an allosteric effector by ... a cascade of events results in the increase of cytosolic cAMP levels. This increase in cAMP levels is sensed by CAP, which goes ... cAMP-CAP is required for transcription activation of the lac operon. This requirement reflects the greater simplicity with ... Catabolite activator protein (CAP; also known as cAMP receptor protein, CRP) is a trans-acting transcriptional activator that ...
PDE4 hydrolyzes cyclic adenosine monophosphate (cAMP) to inactive adenosine monophosphate (AMP). Inhibition of PDE4 blocks ... on cyclic adenosine monophosphate (cAMP). It is a member of the larger family of PDE inhibitors. The PDE4 family of enzymes are ... They are predominantly responsible for hydrolyzing cAMP within both immune cells and cells in the central nervous system. The ... Lelkes Z, Alföldi P, Erdos A, Benedek G (1998). "Rolipram, an antidepressant that increases the availability of cAMP, ...
Netrin repulsion can also be mediated by changes in cyclic nucleotide levels; netrin-1 induces a repulsive response when cAMP ... Ming, GL; Song, HJ; Berninger, B; Holt, CE; Tessier-Lavigne, M; Poo, MM (Dec 1997). "cAMP-dependent growth cone guidance by ...
The 3',5'-cyclic AMP (cAMP) is required for parathyroid hormone activation. It is frequently seen in alcoholics, persons with ... Magnesium is a cofactor for adenylate cyclase, which catalyzes the conversion of ATP to 3',5'-cyclic AMP. ...
"Climate change is natural cyclic process not man-made says Dr Ritesh Arya". January 26, 2020. "Global warming is a cyclic ... He was able to explore and develop luke warm water for Indian army @ Siachen Base camp with the aim to decrease dependency on ... Jolly, Asit (May 11, 2012). "Siachen: Hydrogeologist taps into a hot water source near Army base camp". India Today. "Climate ... Global warming is a cyclic process: Guinness record holder-Deccan Herald Soon, power from ancient rocks-Times of India [7]. ...
Nucleic acid DNA metabolism Cofactor Guanosine Cyclic AMP (cAMP) ATP Wishart, David S.; Djombou Feunang, Yannick; Marcu, Ana; ...
The weapons had very high cyclic rates up to 1,500 rpm. This was the weapon Brigadier General Thompson demonstrated at Camp ... Early versions of the Thompson, the Model 1919, had a fairly high cyclic rate of fire, as high as 1,200 rounds per minute (rpm ... The original Model 1928s were Model 1921s with weight added to the actuator, which slowed down the cyclic rate of fire, a ... Thompson requested Payne develop a method of reducing the cyclic rate of fire. Payne replaced the actuator with a heavier one ...
Adenylate cyclase catalyzes the conversion of ATP into cyclic AMP (cAMP) and pyrophosphate. The complexation of adenylate ... a 46-year-old scientist at the US Army Biological Warfare Laboratories at Camp (later Fort) Detrick, Maryland, who died in 1951 ...
One hormone that is used by many fungi is Cyclic adenosine monophosphate (cAMP).[citation needed] Chemotaxis Dusenbery, David B ...
Inhibition of adenylyl cyclase decreases the conversion of cyclic AMP (cAMP) from ATP. Lower levels of cAMP decrease the ... leading to an increase in cAMP and lipase activity. This mechanism was postulated on the basis that the predominant signaling ...
cAMP-specific 3',5'-cyclic phosphodiesterase 4C is an enzyme that in humans is encoded by the PDE4C gene. PDE4C is ... Overview of all the structural information available in the PDB for UniProt: Q08493 (cAMP-specific 3',5'-cyclic ... Engels P, Sullivan M, Müller T, Lübbert H (1995). "Molecular cloning and functional expression in yeast of a human cAMP- ... Sullivan M, Olsen AS, Houslay MD (2000). "Genomic organisation of the human cyclic AMP-specific phosphodiesterase PDE4C gene ...
AMP can also exist as a cyclic structure known as cyclic AMP (or cAMP). Within certain cells the enzyme adenylate cyclase makes ... cAMP plays an important role in intracellular signaling. DNA Oligonucleotide Phosphodiesterase Glutamate flavoring Kikunae ... cAMP from ATP, and typically this reaction is regulated by hormones such as adrenaline or glucagon. ...
He is also interested in the signaling pathway controlled by cyclic adenosine monophosphate (cAMP). His group generated the ... contributed to establishing the concept of cAMP microdomains and described the existence of an autonomous cAMP homeostatic ...
Increased activity of adenylyl cyclase leads to increased formation of cyclic adenosine monophosphate (cAMP). β3-AR can also ... When they are coupled they lead to decrease in intracellular cAMP. The mechanism of β3-AR and Gi protein has been proposed as a ...
This activates adenylyl cyclase, which catalyses the conversion of ATP to cyclic AMP (cAMP). cAMP activates protein kinase A, ...
A2A receptors are G-protein coupled receptor (GPCR) that increases cyclic adenosine monophosphate (cAMP). These receptors are ... Then 5 years later, the effects of adenosine and adenine nucleotides on the cAMP in the guinea pig brain was described by ... It was proposed that the cause of behavioral depression was due to inhibition of cyclic nucleotide phosphodiesterases when ...
Cyclic AMP acts by activating cAMP-sensitive pathways such as protein kinase A and EPAC1. Its derivatives include Colforsin, ... Forskolin is commonly used as a tool in biochemistry to raise levels of cyclic AMP (cAMP) in the study and research of cell ... Forskolin activates the enzyme adenylyl cyclase and increases intracellular levels of cAMP. cAMP is an important second ... Adenylyl cyclase Cyclic AMP "Forskolin" (PDF). Sigma Aldrich. "Forskolin". Drugs.com. 2018. Retrieved 23 March 2018. Alasbahi, ...
Cyclic adenosine monophosphate (cAMP) molecules bind directly to f-channels and increase their open probability. cAMP ... Sympathetic stimulation raises the level of cAMP-molecules which bind to f-channels and shift the If activation range to more ... DiFrancesco D, Tortora P (May 1991). "Direct activation of cardiac pacemaker channels by intracellular cyclic AMP". Nature. 351 ... The molecular determinants of the pacemaker current belong to the HCN channel (hyperpolarization-activated cyclic nucleotide- ...
cAMP, cyclic adenosine monophosphate, is a derivative of ATP and essential for many biological functions. It enhances 26S ... cGMP does not affect lysosomal proteolysis, unlike cAMP, and will be more useful in the long run. The lab treated tauopathy ... This experiment tested whether cGMP can work the same way and as efficiently, if not more efficiently, than cAMP. The ... Tau-driven 26S proteasome impairment and cognitive dysfunction can be prevented early in disease by activating cAMP-PKA ...
Her research involves the investigation of the mechanism of signal transduction via cyclic nucleotides, phosphodiesterases and ... Samanta et al (2017) Mycobacterial phenolic glycolipid synthesis is regulated by cAMP-dependent lysine acylation of FadD22 ...
... and the direction in which the apex progresses responds to cyclic AMP levels, including cAMP cyclization by a pollen signalling ...
Long-term treatment with moclobemide leads to an increase in cyclic adenosine monophosphate (cAMP) binding to cAMP-dependent ... 1998). "cAMP-dependent phosphorylation system after short and long-term administration of moclobemide". J Psychiatr Res. 32 (2 ...
Дофаминовый рецептор D1 - рецептор дофамина, сопряжённый с G-белками, стимулирующий аденилатциклазу и активирующий cAMP- ... G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger. • positive regulation of release ...
cyclic nucleotide-gated ion channels. cGMP (vision), cAMP and cGTP (olfaction). Na+, K+ [11]. ...
In vitro, apremilast reduces PDE4 activity leading to an increase in cyclic-adenosine monophosphate (cAMP) concentrations in ... a cAMP phosphodiesterase-4 inhibitor, demonstrates anti-inflammatory activity in vitro and in a model of psoriasis". British ...
環狀(英語:Cyclic nucleotide). *cAMP. *cGMP. *c-di-GMP(英語:Cyclic di-GMP) ...
Nende proteiinkinaaside aktiivsust reguleerivad mitmesugused keemilised signaalid, sealhulgas cAMP, cGMP, diatsüülglütserool ja ... "Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase". Science 253 (5018): 407 ...
Fertel R, Weiss B (1976). „Properties and drug responsiveness of cyclic nucleotide phosphodiesterases of rat lung" (abstract). ... pripadaju velikoj familiji cikličnih nukleotidnih PDE enzima koji katališu cAMP i cGMP hidrolizu.[1][2] ... Weiss B (1975). „Differential activation and inhibition of the multiple forms of cyclic nucleotide phosphodiesterase". Adv ... Weiss B, Hait WN (1977). „Selective cyclic nucleotide phosphodiesterase inhibitors as potential therapeutic agents". Annu. Rev ...
By 1972 they had evidence that the second messenger molecule cyclic AMP (cAMP) was produced in Aplysia ganglia under conditions ... One of the nuclear targets for PKA is the transcriptional control protein CREB (cAMP response element binding protein).[5] In ... It was soon found that the neurotransmitter serotonin, acting to produce the second messenger cAMP, is involved in the ... By 1980, collaboration with Paul Greengard resulted in demonstration that cAMP-dependent protein kinase, also known as protein ...
Annual cyclic changes occur in the tropics, but not as predictably as those in the temperate zone, albeit unrelated to ... Summit Camp, Greenland (EF). *Scott Base, Antarctica (EF). *Vostok Station, Antarctica (EF), location of the lowest air ...
AANAT is activated through a protein kinase A system in which cyclic AMP (cAMP) is involved. The activation of AANAT leads to ... Though there are some differences specific to certain species of vertebrates, the effect of cAMP on AANAT and AANAT on ... Norepinephrine causes the production of melatonin in the pinealocytes by stimulating the production of cAMP. Because the ...
cAMP:. *Heterotrimeric G protein *Gs/Gi. *Adenylate cyclase. *cAMP. *3',5'-cyclic-AMP phosphodiesterase ...
Wilchek, M., Salomon, Y., Lowe, M., and Selinger, Z. (1971). "Conversion of protein kinase to a cyclic AMP independent form by ... was killed in Flossenbürg concentration camp. He survived, and immigrated to Israel in 1949 with his mother and sister. He ... affinity chromatography on N0-caproyl 3′,5′-cyclic adenosine monophosphate-Sepharose". Biochem. Biophys. Res. Commun. 45 (5): ...
Wilson is an activist for the cause of cyclic vomiting syndrome and serves as the spokesperson for the Cyclic Vomiting Syndrome ... Anna Camp. Nelsan Ellis. Michelle Forbes. Mariana Klaveno. Ryan Kwanten. Todd Lowe. Michael McMillian. Stephen Moyer. Anna ... For the ninth season of Grey's Anatomy Wilson met with the producers and pitched the idea of featuring cyclic vomiting syndrome ...
Cyclic nucleotide. *cAMP. *cGMP. *c-di-GMP. *c-di-AMP. *cADPR. Nucleoside diphosphate. ...
"Steroidogenic activities in MA-10 Leydig cells are differentially altered by cAMP and Müllerian inhibiting substance". The ... "Anti-Müllerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle ...
... which results in a decrease of intracellular concentration of cyclic adenosine monophosphate (cAMP). Most agonists for ...
Norepinephrine elevates the intracellular cAMP concentration via beta-adrenergic receptors and activates the cAMP-dependent ... Some of the metabolites formed via the reaction of melatonin with a free radical include cyclic 3-hydroxymelatonin, N1-acetyl- ... Melatonin metabolites generated from redox reactions include cyclic 3-hydroxymelatonin, N1-acetyl-N2-formyl-5-methoxykynuramine ...
Robert Schumann continued the development of cyclic structure. In his Piano Quintet in E flat, Op. 44,[31] Schumann wrote a ... The number of chamber music camps and retreats, where amateurs can meet for a weekend or a month to play together, has ... This War of the Romantics shook the artistic world of the period, with vituperative exchanges between the two camps, concert ... César Franck's piano quintet in F minor, composed in 1879, further established the cyclic form first explored by Schumann and ...
"Desert varnish: evidence for cyclic deposition of manganese" (PDF). Nature. 276 (5687): 489-491. Bibcode:1978Natur.276..489P ... Dust storm about to engulf a military camp in Iraq, 2005. Sand and dust storms are natural events that occur in arid regions ...
Also, it may be activated by a cAMP-dependent protein kinase (PKA). This pathway is significantly less effective than the first ... which is necessary for lipid mobilization in response to cyclic AMP, which itself is provided by the activation of Gs protein- ... coupled receptors that promote cAMP production. Examples include beta adrenergic stimulation, stimulation of the glucagon ...
cellular response to cAMP. • توصيل الإشارة. • mammary gland involution. • شيخوخة. • تعديل ما بعد الترجمة. • positive regulation ... cellular response to organic cyclic compound. • negative regulation of smooth muscle cell migration. • negative regulation of ...
... (EC 3.1.4.53, cAMP-specifična fosfodiesteraza, cAMP-specifična PDE, PDE1, PDE2A, PDE2B, PDE4 ... Lugnier, C., Keravis, T., Le Bec, A., Pauvert, O., Proteau, S. and Rousseau, E. (1999). "Characterization of cyclic nucleotide ... Alonso, G.D., Schoijet, A.C., Torres, H.N. and Flawiá, M.M. (2006). "TcPDE4, a novel membrane-associated cAMP-specific ... Bader, S., Kortholt, A., Snippe, H. and Van Haastert, P.J. (2006). "DdPDE4, a novel cAMP-specific phosphodiesterase at the ...
cAMP:. *Heterotrimeric G protein *Gs/Gi. *Adenylate cyclase. *cAMP. *3',5'-cyclic-AMP phosphodiesterase ...
Supresja za pośrednictwem cAMP[edytuj , edytuj kod]. Cykliczny AMP jest wytwarzany w dużych ilościach przez limfocyty Treg i ... Cyclic adenosine monophosphate is a key component of regulatory T cell-mediated suppression. „J Exp Med". 204 (6), s. 1303-1310 ... cAMP hamuje nie tylko limfocyty, ale także komórki dendrytyczne i w tym drugim przypadku współdziała z IL-10[103]. We wnętrzu ... Cyclic adenosine monophosphate and IL-10 coordinately contribute to nTreg cell-mediated suppression of dendritic cell ...
Sulfur deposited in the mid-latitude and polar regions is often damaged by radiation, breaking up the normally stable cyclic 8- ... Trojan camp. Impact events. *Comet Shoemaker-Levy 9. *2009 Jupiter impact event ...
response to cAMP. • response to cocaine. • response to progesterone. • positive regulation of blood pressure. • heart ... response to organic cyclic compound. • negative regulation of gastric acid secretion. • positive regulation of prostaglandin ... non-cyclic) dithiol nonapeptide called oxytoceine.[120] It has been theorized that oxytoceine may act as a free radical ...
Roskoski R, Roskoski LM (Jan 1987). "Activation of tyrosine hydroxylase in PC12 cells by the cyclic GMP and cyclic AMP second ... Effects of dopamine and cAMP-dependent phosphorylation on enzyme activity". The Journal of Biological Chemistry. 267 (18): ... response to organic cyclic compound. • eating behavior. • cellular response to growth factor stimulus. • heart morphogenesis. • ... Hormones (e.g. glucocorticoids), drugs (e.g. cocaine), or second messengers such as cAMP increase tyrosine hydroxylase ...
... cAMP) ವ್ಯವಸ್ಥೆಯನ್ನು ಅಪ್‌ರೆಗ್ಯುಲೇಷನ್ ಮಾಡಲಾಗುತ್ತದೆ ಎಂದು ರೊಡೆಂಟ್ ಅಧ್ಯಯನಗಳು ತೋರಿಸಿಕೊಟ್ಟಿವೆ. cAMPಅನ್ನು ಅಡೆನೊಸಿನ್ 5-ಟ್ರೈಫಾಸ್ಫೇಟ್ (ATP ... "Interaction between the antidepressant-like behavioral effects of beta adrenergic agonists and the cyclic AMP PDE inhibitor ... "The negative immunoregulatory effects of fluoxetine in relation to the cAMP-dependent PKA pathway". International ...
Since cyclic AMP is involved in the release as well as several of the actions of insulin, the possible role of cyclic AMP in ... and may also antagonize the action of cyclic AMP in muscle. Cyclic AMP is thus seen to mediate the actions of several catabolic ... The Role of Cyclic AMP in the Control of Carbohydrate Metabolism Message Subject (Your Name) has forwarded a page to you from ... Another role of cyclic AMP is to enhance or promote the release of insulin from pancreatic beta cells. Insulin then travels to ...
The cAMP-dependent protein kinase and cGMP-dependent protein kinase are major intrace … ... Intracellular cAMP and cGMP levels are increased in response to a variety of hormonal and chemical stimuli; these nucleotides ... Cyclic nucleotide-dependent protein kinases: intracellular receptors for cAMP and cGMP action Crit Rev Clin Lab Sci. 1999 Aug; ... Intracellular cAMP and cGMP levels are increased in response to a variety of hormonal and chemical stimuli; these nucleotides ...
... Hedlund, Petter Lund University Hospital. ... Furthermore, we analyzed whether a cross-talk exists between the cGMP and cyclic AMP (cAMP) signaling cascades in smooth muscle ... Elevation of cAMP by forskolin, however, induces similar relaxation in normal and cGKI-null corpus cavernosum. In addition, ... The molecular target or targets of cGMP in erectile tissue and the role of cAMP for normal penile erection are not known. ...
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in ...
cAMP-specific 3,5-cyclic phosphodiesterase 4D. Details. Name. cAMP-specific 3,5-cyclic phosphodiesterase 4D. Synonyms. *3.1 ... cAMP catabolic process / cAMP-mediated signaling / cellular protein complex assembly / cellular response to cAMP / cellular ... 3,5-cyclic-AMP phosphodiesterase activity / 3,5-cyclic-nucleotide phosphodiesterase activity / ATPase binding / beta-2 ... lcl,BSEQ0002560,cAMP-specific 3,5-cyclic phosphodiesterase 4D MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP ...
cAMP-specific 3,5-cyclic phosphodiesterase 4B. Details. Name. cAMP-specific 3,5-cyclic phosphodiesterase 4B. Synonyms. *3.1 ... 3,5-cyclic-AMP phosphodiesterase activity / cAMP binding / ion channel binding / metal ion binding ... lcl,BSEQ0000972,cAMP-specific 3,5-cyclic phosphodiesterase 4B MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS ... lcl,BSEQ0016107,cAMP-specific 3,5-cyclic phosphodiesterase 4B (PDE4B) ...
Olfactory Dysfunction of Rhinosinusitis - Cyclic Adenosine Monophosphate (cAMP)/Calcium Signaling Study (cAMP). The safety and ... odor detection and signal transduction, cyclic adenosine monophosphate and odor detection, the role of cAMP in olfactory ... The study aims are: 1. to determine the levels of cAMP in olfactory tissue from people with chronic rhinosinusitis and other ... 2. to correlate preoperative olfactory function with cAMP levels from biopsied olfactory tissue. 3. to determine odorant and ...
May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain. ... Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. ... cyclic phosphodiesterase 8A (PDE8A), High affinity cAMP-specific 3,5-cyclic phosphodiesterase 7A (PDE7A), cAMP and cAMP- ... cyclic phosphodiesterase 8B (PDE8B), cAMP-specific 3,5-cyclic phosphodiesterase 4A (PDE4A), cAMP-specific 3,5-cyclic ...
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (By similarity). Vital ... cyclic phosphodiesterase 8 (Pde8), cAMP-specific 3,5-cyclic phosphodiesterase, isoforms N/G (dnc), cAMP-specific 3,5-cyclic ... cAMP-specific 3,5-cyclic phosphodiesterase, isoform I (dnc), cAMP-specific 3,5-cyclic phosphodiesterase (dnc), High ... cAMP-specific 3,5-cyclic phosphodiesterase, isoform IAdd BLAST. 1209. Proteomic databases. PaxDb, a database of protein ...
Pharmacological inhibition of type 4 cyclic adenosine monophosphate (cAMP)-specific phosphodiesterase (PDE4) produces ... Consistent with this, rolipram potentiated isoproterenol-induced cyclic AMP formation only in the PDE4D+/+ mice. These results ... suggest that PDE4D is an essential mediator of the antidepressant-like effects of rolipram, and that PDE4D-regulated cyclic ...
cyclic CMP ligand page. Quantitative data and detailed annnotation of the targets of licensed and experimental drugs. ... Until recently it was not definitively known if cyclic CMP occurs in vivo. However, a report and study published in January ... suggest that cyclic CMP may be a bona fide second messenger in mammalian cells [1-2].. ...
MOLECULAR DOCKING OF COMPETITIVE PHOSPHODIESTERASE TITLE 2 SUBSTRATE CYCLIC ADENOSINE 3,5-MONOPHOSPHATE (CAMP) ... MOLECULAR DOCKING OF COMPETITIVE PHOSPHODIESTERASE TITLE 2 SUBSTRATE CYCLIC ADENOSINE 3,5-MONOPHOSPHATE (CAMP). *Deposition ...
Relative potency against cyclic-Adenosine monophosphate (c-AMP) relative to alpha-MSH. ...
... cyclic phosphodiesterase 4A (domestic guinea pig). Find diseases associated with this biological target and compounds tested ...
... cyclic AMP), 0.1 ml. Cyclic adenosine monophosphate (cAMP) plays a key role as an intracellular second messenger for ... Product Description for cAMP (cyclic AMP). Sheep anti cAMP (cyclic AMP).. Presentation: Serum. Product is tested for Enzyme ... Recommended Secondary Antibodies for cAMP (cyclic AMP) (6 products). Catalog No.. Host. Clone/Iso.. Pres.. React.. Applications ... Cyclic adenosine monophosphate (cAMP) plays a key role as an intracellular second messenger for transduction events that follow ...
Androgenic modulation of cyclic adenosine monophosphate (cAMP)-dependent meiotic arrest. Biol Reprod. 1983 May; 28(4):774-87. ...
What is cyclic AMP, 3,5-cAMP? Meaning of cyclic AMP, 3,5-cAMP medical term. What does cyclic AMP, 3,5-cAMP mean? ... cAMP in the Medical Dictionary? cyclic AMP, 3,5-cAMP explanation free. ... Cyclic AMP, 3,5-cAMP , definition of cyclic AMP, 3,5-cAMP by Medical dictionary https://medical-dictionary. ... redirected from cyclic AMP, 3,5-cAMP). Also found in: Dictionary, Thesaurus, Encyclopedia. AMP. adenosine monophosphate. ...
THE CYCLIC NUCLEOTIDES, CAMP AND CGMP ARE IMPORTANT REGULATORY MOLECULES THAT ARE NOW RECOGNIZED AS MEDIATORS IN A VAST NUMBER ... THE CYCLIC NUCLEOTIDES, CAMP AND CGMP ARE IMPORTANT REGULATORY MOLECULES THAT ARE NOW RECOGNIZED AS MEDIATORS IN A VAST NUMBER ... HYBRIDOMAS WILL BE PREPARED VIA FUSION OF MOUSE MYELOMA CELLS WITH SPLEENS OF MICE IMMUNIZED WITH SUCCINYL-CAMP (OR CGMP) ... ANTI CAMP/CGMP ANTIBODIES AND FLUORESCENT ENZYME IMMUNOASSAY SYSTEMS FOR THE RAPID AND SENSITIVE MEASUREMENT OF THE CYCLIC ...
Cyclic adenosine 3,5-monophosphate (cAMP)-dependent and cAMP-independent regulation of parathyroid hormone receptors on UMR ... and cAMP-independent pathways. PTH activates both pathways, whereas the effect of NlePTH(3-34) appears to be exclusively cAMP- ... on both intracellular cAMP accumulation and gene expression driven by a transiently transfected synthetic cAMP-responsive ... In UMR 106-01 cells, PTH receptors are strikingly down-regulated by pretreatment with 8-Br-cAMP or 3-isobutyl-1-methylxanthine ...
What is cAMP-specific 3,5-cyclic phosphodiesterase 4C? Meaning of cAMP-specific 3,5-cyclic phosphodiesterase 4C medical ... cyclic phosphodiesterase 4C in the Medical Dictionary? cAMP-specific 3,5-cyclic phosphodiesterase 4C explanation free. ... What does cAMP-specific 3,5-cyclic phosphodiesterase 4C mean? ... cAMP-responsive element-binding protein 3-like protein 1. *cAMP ... CAMP-specific 3,5-cyclic phosphodiesterase 4C , definition of cAMP-specific 3,5-cyclic phosphodiesterase 4C by Medical ...
... also known as cAMP). Validated for ELISA (1 image). ... Cyclic AMP antibody LS-C51496 is an unconjugated rabbit ... Most Popular cAMP / Cyclic AMP Antibodies. Anti-cAMP / Cyclic AMP Antibody LS-C48526 ... 3, 5-cyclic AMP-8-KLH.. Specificity:. The specificity of the antiserum is defined as the ratio of antigen concentration to ... The cross-reactivity data obtained in competitive ELISA system is as follows: Compound % Cross-reactivity cAMP. ...
The latter enzymes may also degrade cAMP, so it may also be informative to measure intracellular cAMP levels. ... Cyclic Nucleotide (cAMP and cGMP) Assays and Capture ELISA for Quantitative Analysis of Plasmodium falciparum Blood-stage ... Hackett, F., Collins, C. R., Strath, M. and Blackman, M. J. (2014). Cyclic Nucleotide (cAMP and cGMP) Assays and Capture ELISA ... Hackett, F., Collins, C. R., Strath, M. and Blackman, M. J. (2014). Cyclic Nucleotide (cAMP and cGMP) Assays and Capture ELISA ...
Binding of cAMP to the cyclic nucleotide-binding domain (CNBD) facilitates channel opening by relieving a tonic inhibition ... The HCN domain couples voltage gating and cAMP response in Hyperpolarization-activated Cyclic Nucleotide-gated channels. ... Hyperpolarization-activated cyclic nucleotide-gated (HCN) channels control spontaneous electrical activity in heart and brain. ... Despite high resolution structures of the HCN1 channel in the cAMP bound and unbound states, the structural mechanism coupling ...
Free Sp-cAMPS is only very slowly metaboli ... Sp-cAMPS,/a, (Cat. No. A 003) immobilized on agarose by an ... Sp-8-AEA-cAMPS-Agarose 8- (2- Aminoethylamino)adenosine- 3, 5- cyclic monophosphorothioate, Sp- isomer, immobilized on ... "Cyclic Nucleotides as Affinity Tools: Phosphorothioate cAMP Analogues Adress Specific PKA Subproteomes" ... Sweden, 0, 0 - 0 (1992), "cAMP Analogues Designed for Affinity Chromatography". *7. Dills W. L., Beavo J. A., Bechtel P. J. ...
Cyclic nucleotide-gated channels of rat olfactory receptor cells: divalent cations control the sensitivity to cAMP.. J W Lynch ... Cyclic nucleotide-gated channels of rat olfactory receptor cells: divalent cations control the sensitivity to cAMP. ... However, addition of 0.2 or 0.5 mM Ca2+ shifted the KM of cAMP reversibly to the higher cAMP concentrations of 33 or 90 microM ... controls the sensitivity of the cAMP-gated channels to cAMP. The influx of Ca2+ through these channels during the odorant ...
The intracellular cAMP level regulates cellular responses by altering the interaction between the catatytic C and regulatory R ... cAMP-dependent PKA is an ubiquitous serine/theonine protein kinase present in a variety of tissues (e.g. brain, skeletal muscle ... Cyclic AMP Dependent Protein Kinase A Regulatory Subunit 1a, Recombinant (cAMP PKA R1) ... Customer review for "Cyclic AMP Dependent Protein Kinase A Regulatory Subunit 1a, Recombinant (cAMP PKA R1)" ...
Suitable for affinity chromatography of various cAMP-respon ... p style=text-align: justify;,The second messenger cyclic AMP ... 8-AHA-2-O-Me-cAMP-Agarose 8- (6- Aminohexylamino)- 2- O- methyladenosine- 3, 5- cyclic monophosphate; immobilized on ... "Cyclic Nucleotides as Affinity Tools: Phosphorothioate cAMP Analogues Adress Specific PKA Subproteomes" ... The second messenger cyclic AMP with a methylated ribose 2-hydroxy group immobilized on agarose by an aminohexylamino spacer ...
Mouse cyclic Adenosine Monophosphate ELISA Kit-CAG46759.1 (MBS722602) product datasheet at MyBioSource, ELISA Kits ... Camp elisa kit :: Mouse cyclic Adenosine Monophosphate ELISA Kit. Catalog #. MBS722602 .mycenter { display: block; margin-left ... Related Product Information for Camp elisa kit. Intended Uses: This cAMP ELISA kit is a 1.5 hour solid-phase ELISA designed for ... UniProt Comments for Camp CAMP: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Belongs to the ...
Mouse cyclic Adenosine Monophosphate ELISA Kit-CAG46759.1 (MBS722602) product datasheet at MyBioSource, ELISA Kits ... Camp elisa kit. Intended Uses: This cAMP ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination ... 3316 publications with Camp and Nervous System Diseases. Cardiovascular Diseases Antibodies. >2805 publications with Camp and ... 2208 publications with Camp and Disease Models, Animal. Inflammation Antibodies. >1851 publications with Camp and Inflammation ...
Tissue cyclic nucleotides (cAMP and cGMP), cyclic nucleotide phosphodiesterase (cAMP- and cGMP-PDE) activities, adenylyl ... are released which induce cyclic changes in cyclic nucleotides, cAMP and cGMP. Both these cyclic nucleotides transiently ... Role of cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP) and p38 mitogen activated protein kinase ( ... Role of cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP) and p38 mitogen activated protein kinase ( ...
  • odor detection and signal transduction, cyclic adenosine monophosphate and odor detection, the role of cAMP in olfactory dysfunction, and pheromone detection. (clinicaltrials.gov)
  • These results suggest that PDE4D is an essential mediator of the antidepressant-like effects of rolipram, and that PDE4D-regulated cyclic adenosine monophosphate signaling may play a role in the pathophysiology and pharmacotherapy of depression. (biopsychiatry.com)
  • Cyclic adenosine monophosphate (cAMP) plays a key role as an intracellular second messenger for transduction events that follow a number of extracellular signals. (acris-antibodies.com)
  • Androgenic modulation of cyclic adenosine monophosphate (cAMP)-dependent meiotic arrest. (harvard.edu)
  • 3′,5′-AMP ( cyclic AMP ) cyclic adenosine monophosphate . (thefreedictionary.com)
  • 3bprime,5bprime-AMP , cyclic AMP cyclic adenosine monophosphate . (thefreedictionary.com)
  • MBS722602 is a ready-to-use microwell, strip plate Competitive ELISA (enzyme-linked immunosorbent assay) Kit for analyzing the presence of the cyclic Adenosine Monophosphate (Camp) ELISA Kit target analytes in biological samples. (mybiosource.com)
  • Ketamine (1 µM) was able to increase cyclic adenosine monophosphate (cAMP) signaling in NPCs within 15 min and cell proliferation, while ketamine-induced IGF2 expression was reduced after PKA inhibition with cAMPS-Rp. (mdpi.com)
  • In a cAMP-dependent pathway, the activated G s alpha subunit binds to and activates an enzyme called adenylyl cyclase , which, in turn, catalyzes the conversion of ATP into cyclic adenosine monophosphate (cAMP). (wikipedia.org)
  • Cyclic adenosine monophosphate (cAMP) is one of the most important signaling molecules in virtually all cell types and organisms. (sciencemag.org)
  • Pharmacologic effects of PDE-III/PDE-V inhibition include vasodilation, smooth muscle relaxation, and platelet aggregation inhibition, due to decreased degradation of cyclic adenosine monophosphate (cAMP) and cyclic guanosine monophosphate (cGMP). (thefreedictionary.com)
  • These negative effects may result from the effect of antidepressants on cyclic adenosine monophosphate (cAMP), they said. (thefreedictionary.com)
  • Summers went on to say, "In scientific terms, we have known for some time that PGE-1 increases cyclic adenosine monophosphate (cAMP) by regulating the calcium in cells. (thefreedictionary.com)
  • G protein (heterotrimeric guanine nucleotide-binding protein)-coupled receptor (GPCR)-mediated increases in the second messenger cyclic adenosine monophosphate (cAMP) activate the mitogen-activated protein kinase (MAPK) extracellular signal-regulated kinase (ERK), and in neuroendocrine cells, this pathway leads to cAMP-dependent neuritogenesis mediated through Rap1 and B-Raf. (sciencemag.org)
  • Cyclic adenosine monophosphate (cAMP) plays a central role as a second (intracellular) messenger for the transduction of signals regulating cellular metabolism, secretion, and plasticity by hormones and other first messengers that act through plasma membrane receptors ( 1 ). (sciencemag.org)
  • In Schwann cells (SCs), cyclic adenosine monophosphate (cAMP) not only induces differentiation into a myelinating SC-related phenotype, but also synergistically enhances the mitogenic action of growth factors such as neuregulin. (lecollege.org)
  • Introduction The ubiquitous second messenger cyclic adenosine monophosphate (cAMP) is usually a key regulator of metabolic activity, survival, proliferation and differentiation in a wide variety of cell types. (lecollege.org)
  • Increased degrees of 3C5-cyclic adenosine monophosphate (cAMP) stimulate cell proliferation and liquid secretion in polycystic kidney disease (PKD). (movd2016.org)
  • Latest studies established that 3C5-cyclic adenosine monophosphate (cAMP) stimulates mural epithelial cell proliferation and secretion of liquid into cysts of sufferers with ADPKD7C11. (movd2016.org)
  • Increased thyroid gland activity was observed after 15 min exposure of rats to 20 mT, 50 Hz electromagnetic field (EMF), as judged from the increased cyclic adenosine monophosphate (cAMP) in the gland, and increased T3 and T4 (reviewed by Zagorskaya, 1989 ). (biologists.org)
  • G α s activates adenylyl cyclases, which drive cyclic adenosine monophosphate (cAMP)-dependent targets: protein kinase A (PKA), the exchange protein activated by cAMP (EPAC), and hyperpolarization-activated cyclic nucleotide-gated (HCN) channels. (aspetjournals.org)
  • Cyclic adenosine monophosphate (cAMP) is certainly an essential intracellular second messenger molecule that converts extracellular molecules to intracellular sign transduction pathways generating cell- and stimulus-specific effects. (recyclers-info.com)
  • the hydrolysis of the phosphodiester bond, especially those of the next messenger cascade substances cyclic adenosine monophosphate (cAMP) and cyclic guanosine monophosphate (cGMP). (recyclers-info.com)
  • This scientist is responsible for the discovery of cyclic adenosine monophosphate (cAMP) as the first known intracellular second messenger of hormone action. (physiologyweb.com)
  • Urinary cyclic 3',5'-adenosine monophosphate (cAMP): an index of the action of parathyroid hormone on the kidney. (elsevier.com)
  • Fingerprint Dive into the research topics of 'Urinary cyclic 3',5'-adenosine monophosphate (cAMP): an index of the action of parathyroid hormone on the kidney. (elsevier.com)
  • Next, we also investigated the alterations of cyclic adenosine monophosphate (cAMP), protein kinase A (PKA) catalytic subunit (PKAca), cAMP response element-binding (CREB), and glutamate transporter 1 (GLT1) levels produced by GEBR-7b in the rats model of depression. (dovepress.com)
  • Cyclic adenosine monophosphate (cAMP), stimulates the breakdown of stored carbohydrate into sugar. (pituitary.org)
  • Cyclic adenosine 3',5'-monophosphate (cAMP)-dependent and cAMP-independent regulation of parathyroid hormone receptors on UMR 106-01 osteoblastic osteosarcoma cells. (sigmaaldrich.com)
  • A relationship between cyclic adenosine 3′, 5′-monophosphate (cAMP) levels and brain tumor biology has been evident for nearly as long as cAMP and its synthetase, adenylate cyclase (ADCY) have been known. (frontiersin.org)
  • DI-fusion Cyclic adenosine 3',5'-monophosphate (cAMP)-dependent protein. (ac.be)
  • Cyclic adenosine 3',5'-monophosphate (cAMP)-dependent protein kinases, but not exchange proteins directly activated by cAMP (Epac), mediate thyrotropin/cAMP-dependent regulation of thyroid cells. (ac.be)
  • The distribution and dissociation of cyclic adenosine 3':5'-monophosphate-dependent protein kinases in adipose, cardiac, and other tissues. (springer.com)
  • Cellular localization and age-dependent changes in mRNA for cyclic adensoine 3',5'-monophosphate-dependent protein kinases in rat testis. (springer.com)
  • Hartl FT, Roskoski R, Jr. Cyclic adenosine 3':5'-monophosphate-dependent protein kinase. (springer.com)
  • How is Adenosine 3'5' Cyclic Monophosphate abbreviated? (thefreedictionary.com)
  • Cyclic guanosine monophosphate (cGMP) is a unique second messenger molecule formed in different cell types and tissues. (springer.com)
  • PDE4 is selective to cAMP over cyclic guanosine monophosphate. (clinicaltrials.gov)
  • CaCRE stands for Calcium and cAMP (Adenosine 3`5` Cyclic Monophosphate) Response-Element. (acronymsandslang.com)
  • What is the abbreviation for Calcium and cAMP (Adenosine 3'5' Cyclic Monophosphate) Response-Element? (acronymsandslang.com)
  • Adenosine 3',5'-cyclic monophosphate stimulates chloride (Cl-) secretion across airway epithelia. (jci.org)
  • Cyclic adenine monophosphate (cAMP) is a secondary messenger used in intercellular signal transduction. (wikibooks.org)
  • The cAMP-dependent protein kinase and cGMP-dependent protein kinase are major intracellular receptors for these nucleotides, and the actions of these enzymes account for much of the cellular responses to increased levels of cAMP or cGMP. (nih.gov)
  • Tissue cyclic nucleotides (cAMP and cGMP), cyclic nucleotide phosphodiesterase (cAMP- and cGMP-PDE) activities, adenylyl cyclase and protein kinase A activities and p-adrenergic receptor characteristics were determined. (sun.ac.za)
  • Based on the results obtained, it is proposed that during a multi-cycle ischaemie PC protocol triggers (presumably endogenous catecholamines and NO) are released which induce cyclic changes in cyclic nucleotides, cAMP and cGMP. (sun.ac.za)
  • Both these cyclic nucleotides transiently activate the downstream stress kinase, p38 MAPK, which may trigger further downstream adaptive processes. (sun.ac.za)
  • To detect localized levels of cyclic nucleotides in these compartments we used targeted cAMP and cGMP sensors. (unipd.it)
  • Such sensors exploit the phenomenon of Fluorescence Resonance Energy Transfer (FRET) for the detection of cyclic nucleotides changes in intact living cells. (unipd.it)
  • As early as 1965 it was proposed that in addition to the well-established second messengers, cyclic AMP and cyclic GMP, the cyclic pyrimidine nucleotides, cyclic CMP (cCMP) and cyclic UMP (cUMP) could play a role as second messenger molecules. (biomedcentral.com)
  • In order to critically re-evaluate the cCMP- and cUMP field, we developed highly sensitive quantitative HPLC-MS/MS mass spectrometry methods to detect multiple cyclic nucleotides (cNMPs). (biomedcentral.com)
  • Endothelium-derived relaxing factors, such as nitric oxide or prostacyclin, relax blood vessels and inhibit the proliferation and migration of VSMCs by increasing the synthesis of the cyclic nucleotides cAMP or cGMP ( 7 - 10 ). (diabetesjournals.org)
  • Because high concentrations of cyclic nucleotide analogs are usually used for intact tissue incubations, trace cyclic nucleotide contaminants in commercial cyclic nucleotides may not be separated during purification and would thus interfere with the assay for the nucleotide of interest. (elsevier.com)
  • The gel can be used for affinity chromatography of various cyclic nucleotide-responsive proteins such as protein kinases, phosphodiesterases and others. (biolog.de)
  • As potential targets for cCMP and cUMP, we examined cAMP- and cGMP-activated protein kinases. (biomedcentral.com)
  • Cyclic nucleotide-dependent protein kinases. (springer.com)
  • Identification of two subclasses of type II cAMP-dependent protein kinases. (springer.com)
  • Binding of cAMP to the cyclic nucleotide-binding domain (CNBD) facilitates channel opening by relieving a tonic inhibition exerted by the CNBD. (elifesciences.org)
  • In response to hormone- induced high cAMP levels, PKA phosphorylates glycogen synthetase (inhibition of the enzyme activity) and phosphorylase kinase to block glycogen synthesis. (biomol.com)
  • Inhibition of actin polymerisation with cytochalasin-D, latrunculin-B or the ROCK inhibitor, Y-27632, mimicked effects of cAMP on EPAC1 mRNA and protein levels. (diagenode.com)
  • Elevated cAMP also inhibited activity of an EPAC1 promoter-reporter gene, which contained a consensus binding element for TEAD, which is a target for inhibition by cAMP. (diagenode.com)
  • Elevated levels of adenylate cyclase (ADCY) activity and cAMP levels were associated with normalization of cell morphology, restoration of contact inhibition and reduced growth rates in neoplastic cells. (frontiersin.org)
  • The cAMP pathway is studied through loss of function (inhibition) and gain of function (increase) of cAMP. (wikipedia.org)
  • Despite the similar inhibition of cAMP synthesis, the effect of light is directly on the photoreceptors and independent of dopamine modulation, because it was unaffected by application of the D4 receptor antagonist l -745,870. (jneurosci.org)
  • 5. Exocytosis triggered by single depolarizations in standard whole-cell recordings was strongly potentiated by cAMP, but in this case the effect was unaffected by PKA inhibition. (nih.gov)
  • Inhibiting a downstream effector of cAMP [protein kinase A (PKA)] prevents myelin-MAG promotion from young neurons, and elevating cAMP blocks myelin-MAG inhibition of neurite outgrowth in older neurons. (jneurosci.org)
  • Thus, the switch from promotion to inhibition by myelin-MAG, which marks the developmental loss of regenerative capacity, is mediated by a developmentally regulated decrease in endogenous neuronal cAMP levels. (jneurosci.org)
  • VSMCs, simultaneous activation of adenylyl cyclase and inhibition of PDE3 activity in cp / cp VSMCs synergistically increased cAMP. (diabetesjournals.org)
  • In both phases, inhibition of cAMP-dependent protein kinase A (PKA) activity prevented ethanol-induced CRE-mediated luciferase expression. (aspetjournals.org)
  • The pro-survival role of cAMP was associated with selective unresponsiveness of L929 cells to the inhibition of p38 activation by cAMP even though cAMP significantly inhibited the activation of JNK under the same conditions. (bio-aromatica.com)
  • Further exploration revealed that this induction of DLC the major mediator of p38 inhibition by cAMP was impaired in L929 cells. (bio-aromatica.com)
  • Enforced inhibition of p38 activation by using p38 specific inhibitor or ectopic expression of DLC reversed the protection of L929 cells by cAMP from TNF-α-induced cell death. (bio-aromatica.com)
  • In fibroblasts the inhibition of JNK by cAMP confers resistance to UV-induced cytotoxicity [15]. (bio-aromatica.com)
  • The inhibition of either JNK or p38 by cAMP depends on CREB-mediated transcription and entails upstream MAP2K [14 15 However the major effectors Nipradilol of cAMP-mediated inhibition of JNK or p38 activation are different. (bio-aromatica.com)
  • The induction of DLC Nipradilol is required for cAMP-mediated inhibition of p38 activation [14] whereas the induction of the long form of cellular FLICE-inhibitory protein (c-FLIPL) and MAPK phosphatase-1 (MKP-1) is required for cAMP-mediated inhibition of JNK activation [15]. (bio-aromatica.com)
  • These observations suggest that the inhibition of JNK or p38 by cAMP could be uncoupled in certain cell context. (bio-aromatica.com)
  • For quite some time, PDE enzymes possess remained a pastime inside the pharmaceutical sector, as inhibition of PDE can raise the degrees of cAMP or cGMP hence improving or prolonging their organic physiological results [5]. (recyclers-info.com)
  • The activation of a protein kinase by cAMP results in the phosphorylation of substrate proteins. (acris-antibodies.com)
  • Recently, we reported the isolation of a UMR 106-01 subclone, UMR 4-7, that is stably transfected with a Zn(++)-inducible mutant of the regulatory subunit of protein kinase A. Incubation of UMR 4-7 cells with Zn++ renders the cells unresponsive to cAMP agonists. (sigmaaldrich.com)
  • In conclusion, homologous down-regulation of PTH receptors is mediated by activation of both cAMP-dependent (via protein kinase A) and cAMP-independent pathways. (sigmaaldrich.com)
  • The protein kinase A activator Sp-cAMPS (Cat. (biolog.de)
  • In addition, its reduced binding affinity towards protein kinase A compared to cAMP results in milder desorption conditions during affinity chromatography. (biolog.de)
  • cAMP-dependent PKA is an ubiquitous serine/theonine protein kinase present in a variety of. (biomol.com)
  • We focused on the locales in which the two isoforms of the cAMP effector Protein Kinase A (PKA), PKAI and PKAII, reside. (unipd.it)
  • The cNMP agarose affinity chromatography technique identified cAMP-dependent protein kinase as one target protein for cCMP and cUMP, these cNMPs being low-affinity activators of this kinase. (biomedcentral.com)
  • Activation of cyclic AMP-dependent kinase is required but may not be sufficient to mimic cyclic AMP-dependent DNA synthesis and thyroglobulin expression in dog thyroid cells. (ac.be)
  • In humans, cAMP works by activating protein kinase A (PKA, cAMP-dependent protein kinase ), one of the first few kinases discovered. (wikipedia.org)
  • The Catalytic sub-units make their way in to the nucleus to influence transcription.Further effects mainly depend on cAMP-dependent protein kinase , which vary based on the type of cell. (wikipedia.org)
  • Analysis of the cAMP-dependent protein kinase system using molecular genetic approaches. (springer.com)
  • Amino acid sequence of the regulatory subunit of bovine type I adenosine cyclic 3',5'-phosphate dependent protein kinase. (springer.com)
  • Genetic characterization of a brain-specific form of the type I regulatory subunit of cAMP-dependent protein kinase. (springer.com)
  • Takio K, Smith SB, Krebs EG, Walsh KA, Titani K. Amino acid sequence of the regulatory subunit of bovine type II adenosine cyclic 3',5'-phosphate dependent protein kinase. (springer.com)
  • The molecular cloning of a type H regulatory subunit of the cAMP-dependent protein kinase from rat skeletal muscle and mouse brain. (springer.com)
  • Molecular cloning, cDNA structure, and regulation of the regulatory subunit of type II cAMP-dependent protein kinase from rat ovarian granulosa cells. (springer.com)
  • The neural type II regulatory subunit of cAMP-dependent protein kinase is present and regulated by hormones in the rat ovary. (springer.com)
  • Identification and differential expression of two forms of regulatory subunits (RH) of cAMP-dependent protein kinase II in Friend erythroleukemic cells. (springer.com)
  • cAMP-dependent protein kinase A (PKA) was identified as the major downstream effector of intracellular cAMP, acting as a cAMP sensor and in turn transducing cAMP-initiated signaling to further downstream cellular targets ( 2 , 3 ). (sciencemag.org)
  • Thus, the regulatory (R) subunit of PKA releases an active serine and threonine kinase upon binding to cAMP, and cAMP-bound Epacs promote the exchange of guanosine triphosphate (GTP) for guanosine diphosphate (GDP) on the small guanosine triphosphatases (GTPases) Rap1 and Rap2 ( 5 , 6 ). (sciencemag.org)
  • Protein kinase A-dependent and -independent stimulation of exocytosis by cAMP in mouse pancreatic B-cells. (nih.gov)
  • While Gα olf expression was not detectable in β-cells, experiments using inhibitors and siRNA revealed that the pathway dependent on phospholipase C-inositol triphosphate, rather than cAMP-protein kinase A, mediates GSIS potentiation via OLFR15. (nature.com)
  • Unicellular eukaryotic pathogen Leishmania donovani, an intra-macrophage protozoan parasite, on exposure to phagolysosome conditions (PC) of mammalian macrophages, show increased cAMP level and cAMP-dependent protein kinase A (PKA) resulting in resistance to macrophage oxidative burst. (intechopen.com)
  • a pre-requisite for parasite survival and infectivity, showed to elevate cAMP level and cAMP-mediated protein kinase A (PKA) activation. (intechopen.com)
  • In eukaryotes, several researches indicate that most of the cAMP mediated effects are due to the activation of the cAMP-regulated protein kinase A, and the subsequent phosphorylation of other substrates of PKA which act as transcription factors, or metabolic enzymes such as lipases, phosphorylase kinase or glycogen synthase. (intechopen.com)
  • Accumulated evidence has indicated that cAMP controls complex cellular processes via changes in target gene transcription primarily Fingolimod through the activation of two downstream effectors, the cAMP-dependent protein kinase (PKA) and the newly discovered exchange protein activated by cAMP (EPAC) [15]. (lecollege.org)
  • Increases in concentration of the second messenger cAMP may lead to the activation of cyclic nucleotide-gated ion channels exchange proteins activated by cAMP (EPAC) such as RAPGEF3 popeye domain containing proteins (Popdc) an enzyme called protein kinase A (PKA). (wikipedia.org)
  • Further effects mainly depend on cAMP-dependent protein kinase, which vary based on the type of cell. (wikipedia.org)
  • Signaling via cAMP in fungi: interconnections with mitogen-activated protein kinase pathways", Arch Microbiology, vol. 170, pp. 395-404, 1998. (patentgenius.com)
  • and cp / cp VSMCs, as well as activation of these enzymes following activation of the cAMP-protein kinase A signaling cascade, were not different. (diabetesjournals.org)
  • Forskolin, β-adrenergic agonists, or glucagon increase cAMP and activate PDE3 through a cAMP-dependent protein kinase A (PKA)-mediated phosphorylation. (diabetesjournals.org)
  • Furthermore, we found that forskolin-promoted increases in cAMP or N 6 -phenyladenosine-cAMP, a protein kinase A-selective analog, reverse the myofibroblast phenotype, as assessed by the expression of collagen I α 1, α -smooth muscle actin, plasminogen activator inhibitor-1, and cellular contractile abilities, all hallmarks of a fibrogenic state. (aspetjournals.org)
  • Cloning and characterization of BCY1, a locus encoding a regulatory subunit of the cyclic AMP-dependent protein kinase in Saccharomyces cerevisiae. (yeastgenome.org)
  • To determine cAMP, cGMP, or cyclic nucleotide analog levels, this chapter develops a method to first separate the analog(s) from cAMP or cGMP by a simple chromatographic procedure followed by functionally directed assay of the respective cyclic nucleotide by either cAMP- or cGMP-dependent protein kinase activation. (elsevier.com)
  • Alternatively, sensitive and specific cAMP- and cGMP-dependent protein kinase activation assays are described in the chapter. (elsevier.com)
  • The downstream effectors of cAMP-protein kinase A (PKA) and cAMP response element-binding protein (CREB)-have been shown to play a role in the tumorigenesis of endocrine tissues [1 2 Furthermore it has been long disclosed that cAMP elevation is usually associated with impaired cell death of various tumor cells [3-10]. (bio-aromatica.com)
  • Our recent work has revealed that at least in fibroblasts the crosstalk between the cAMP signaling pathway and either JNK (c-Jun N-terminal protein kinase) or p38 pathway plays a key role in the regulation of cell death by cAMP [14 15 JNK and p38 are users of the mitogen-activated protein kinase (MAPK) superfamily [16-18]. (bio-aromatica.com)
  • cAMP and cGMP bind towards the regulatory products of proteins kinase A(PKA) enabling phosphorylation hence transducing sign cascades in the cell [1]C[3]. (recyclers-info.com)
  • cAMP is responsible for a multitude of actions like ion channel regulation and kinase activation [17-19]. (fsmr.org)
  • cAMP works by activating protein kinase A (PKA). (wikibooks.org)
  • cAMP binds to specific locations on the regulatory units of the protein kinase, and causes dissociation between the regulatory and catalytic subunits, thus activating the catalytic units and enabling them to phosphorylate substrate proteins. (wikibooks.org)
  • Then the cAMP activates protein kinase A by binding to the regulatory units in protein kinase A, thereby allowing the disassociation between the catalytic and regulatory subunits in protein kinase A. The newly activated protein kinase A allows for the phosphorylation of serine and threonine from ATP which generates cellular response. (wikibooks.org)
  • Typically, the binding of the ligands to its receptor resulting in the activation of G-proteins, in return, activates the effector adenylyl cyclase evoking the production of cAMP. (acris-antibodies.com)
  • Suitable for affinity chromatography of various cAMP-responsive proteins, especially those which tolerate modification of the ribose 2'-hydroxy group, such as the exchange protein activated by cyclic AMP (Epac) and certain phosphodiesterases. (biolog.de)
  • Hormonal regulation of cyclic AMP binding to specific receptor proteins in rat ovarian follicles. (springer.com)
  • Jun proteins modulate the ovary-specific promoter of aromatase gene in ovarian granulosa cells via a cAMP-responsive element. (biomedsearch.com)
  • Electrophoretic gel mobility assay showed that endogenous Jun proteins bound to a functionally important cAMP-responsive element (CRE) in the PII promoter-proximal region. (biomedsearch.com)
  • Opioid receptor stimulation can activate inhibitory Gi-proteins which in turn block adenylyl cyclase activity reducing cAMP [17]. (fsmr.org)
  • This combination triggers of a change in the G-proteins - proteins which stretch out across the membrane-, this change in turn leads to the activation or release of a "secondary messenger" (usually cyclic AMP or Ca2+), inside the cell, which then goes on to make changes inside the cell -usually the activation of enzymes involved in the breakdown of sugars and fats to produce more energy and growth. (fluoridealert.org)
  • Binding of four cAMP molecules causes the release of free and active catalytic subunits, which may phosphorylate serine and threonine residues on target proteins. (wikibooks.org)
  • In vitro, cGMP modulates the activity of the cAMP-degrading phospodiesterases (PDEs) PDE2 and PDE3. (unipd.it)
  • We investigated whether in rat neonatal cardiomyocytes cGMP can alter intracellular cAMP signals via modulation of PDEs activity and whether this modulation is different in distinct subcellular compartments. (unipd.it)
  • Moreover, several recombinant cAMP- and cGMP-degrading PDEs were identified to exhibit cUMP-degrading activity, whereas to this end, we have not been able to identify a cCMP-hydrolyzing PDE. (biomedcentral.com)
  • Cyclic nucleotide PDEs consist of 10 gene families, each having one or more isoforms. (aacrjournals.org)
  • A large family of enzymes named cyclic nucleotide phosphodiesterases (PDEs) inactivate cAMP and cGMP through their hydrolysis ( 11 - 14 ). (diabetesjournals.org)
  • We found that myofibroblasts produce less cAMP in response to GPCR agonists or forskolin and have decreased expression of several adenylyl cyclase (AC) isoforms and increased expression of multiple cyclic nucleotide phosphodiesterases (PDEs). (aspetjournals.org)
  • Free Sp-cAMPS is only very slowly metabolized by mammalian phosphodiesterases and thus represents an extraordinary stable ligand. (biolog.de)
  • PDE-stable cyclic AMP analogue suitable for immobilization as affinity ligand (e.g. for purification of phosphodiesterases) or for coupling of various labelling structures including fluorophores. (mybiosource.com)
  • abstract = "Quantitation of cAMP in plasma and urine allows derivation of indices or renal responsiveness to PTH, indices of steady-state circulating PTH bioactivity, and indices of rapid changes in circulating PTH bioactivity. (elsevier.com)
  • The intracellular cAMP level regulates cellular responses by altering the interaction between the catatytic C and regulatory R subunits of PKA. (biomol.com)
  • In addition, cAMP regulates the passage of metal ions, like Ca2+, through ion channels. (wikibooks.org)
  • Because the involvement of cAMP can amplify the response of the ligand binding, the second messenger cAMP has been largely employed to monitor the activation of the GPCR to facilitate the therapeutic drug discovery. (acris-antibodies.com)
  • Despite high resolution structures of the HCN1 channel in the cAMP bound and unbound states, the structural mechanism coupling ligand binding to channel gating is unknown. (elifesciences.org)
  • This ligand is offered with a longer spacer ( Sp-8-AHA-cAMPS-Agarose , Cat. (biolog.de)
  • The second messenger cyclic AMP with a methylated ribose 2'-hydroxy group immobilized on agarose by an aminohexylamino spacer attached to position 8 of the ligand. (biolog.de)
  • Ligand-induced activation of Exchange Protein Activated by cAMP-1 (EPAC1) is implicated in numerous physiological and pathological processes, including cardiac fibrosis where changes in EPAC1 expression have been detected. (diagenode.com)
  • The cAMP-Screen® and cAMP-Screen Direct® assays are used with established cell lines for functional measurements of endogenous receptors (Figure 1), with cell lines expressing exogenous ligand receptors, and with primary cell cultures to investigate their response to treatment with the appropriate ligands. (thermofisher.com)
  • The inactive tetrameric PKA holoenzyme R2C2 is activated when cAMP binds to R2, which dissociates the tetramer to R2 cAMP 4 and two active catalytic subunits. (biomol.com)
  • In order to have a comprehensive understanding of cAMP signaling and their contribution to infectivity, studies were carried out on all the enzymes associated with cAMP metabolism such as adenylate cyclase, phosphodiesterase, pyrophosphatase and the regulatory and catalytic subunits of PKA. (intechopen.com)
  • Upon binding of cAMP to the regulatory subunits, the catalytic subunits of PKA phosphorylate and modulate the activity of a variety of cytosolic and nuclear substrates, including the transcription factor CREB. (lecollege.org)
  • Whether or not cyclic AMP plays a regulatory role in basement membrane synthesis is presently unknown. (diabetesjournals.org)
  • The cAMP pathway can be targeted at multiple levels in the regulation of its synthesis and degradation. (frontiersin.org)
  • Soon after its discovery, it became clear that cAMP was a ubiquitous second messenger and that normal physiology was dependent upon precise regulation of its synthesis and degradation. (frontiersin.org)
  • Differences in cAMP synthesis arise through differences in expression, subcellular localization and activation of nine different membrane bound ADCYs and one soluble ADCY ( Cooper and Tabbasum, 2014 ). (frontiersin.org)
  • Quinpirole, a dopamine D2/D3/D4 receptor agonist, decreased cAMP synthesis in retinas of wild-type (WT) mice but not in retinas of D4KO mice. (jneurosci.org)
  • In WT retinas, the photoreceptors of which were functionally isolated by incubation in the presence of exogenous glutamate, light also suppressed cAMP synthesis. (jneurosci.org)
  • Despite its importance in the regulation of growth and differentiation processes of a variety of organisms, the mechanism of synthesis and degradation of cAMP (cyclic AMP) has not yet been described in Giardia lamblia . (biochemj.org)
  • The synthesis of cAMP from ATP is done by adenylyl cyclases located in the plasma membrane. (wikibooks.org)
  • This secondary messenger amplifies the signal many times over through the synthesis of many molecules of cAMP by adenylyl cyclase. (wikibooks.org)
  • All this antibody may also be used in ELISA and to affinity purify cAMP. (acris-antibodies.com)
  • The ELISA analytical biochemical technique of the MBS722602 kit is based on Camp antibody-Camp antigen interactions (immunosorbency) and an HRP colorimetric detection system to detect Camp antigen targets in samples. (mybiosource.com)
  • The microtiter plate has been pre-coated with a monoclonal antibody specific for cAMP. (mybiosource.com)
  • Standards or samples are then added to the microtiter plate wells and cAMP if present, will bind to the antibody pre-coated wells. (mybiosource.com)
  • In order to quantitatively determine the amount of cAMP present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for cAMP are added to each well to "sandwich" the cAMP immobilized on the plate. (mybiosource.com)
  • Only those wells that contain cAMP and enzyme-conjugated antibody will exhibit a change in color. (mybiosource.com)
  • A low level of cAMP yields minimal competition with the cAMP-AP conjugate for binding to anti-cAMP antibody, resulting in a high chemiluminescence signal (Figure 3). (thermofisher.com)
  • A ) In the cAMP-Screen® system, cell lysates are then transferred to a solid white assay plate precoated with secondary antibody. (thermofisher.com)
  • Standards or test samples are added to the wells, along with an alkaline phosphatase (AP) conjugated-cAMP antigen and a polyclonal rabbit antibody specific to cAMP. (abcam.com)
  • Cyclic AMP (cAMP) is a key second messenger in intracellular signal transduction across a variety of biological pathways in many different organisms. (thermofisher.com)
  • In addition, the assays can be used for high-throughput screening assays for compounds which stimulate or inhibit cAMP production via interference with receptor function or signal transduction pathways. (thermofisher.com)
  • Characterization of the signal transduction pathways demonstrated the involvement of EP4 receptor and cAMP signaling. (jimmunol.org)
  • cAMP is used for intracellular signal transduction and affects a number of cellular processes. (wikibooks.org)
  • Our data are consistent with a pathway involving the cAMP-mediated activation of Rapgef2, which then stimulates Rap1, leading to increases in B-Raf, MEK, and ERK activity. (sciencemag.org)
  • 1. The mechanisms by which cAMP stimulates Ca(2+)-dependent insulin secretion were investigated by combining measurements of whole-cell Ca2+ currents, the cytoplasmic free Ca2+ concentration ([Ca2+]i) and membrane capacitance in single mouse B-cells maintained in tissue culture. (nih.gov)
  • 7. We conclude that cAMP stimulates insulin secretion both by increasing the release probability of secretory granules already in the readily releasable pool and by accelerating the refilling of this pool. (nih.gov)
  • cAMP stimulates bicarbonate secretion across normal, but not cystic fibrosis airway epithelia. (jci.org)
  • To determine whether cAMP also stimulates HCO3- secretion, we studied cultured canine and human airway epithelial cells bathed in a HCO3-/CO2-buffered, Cl(-)-free solution. (jci.org)
  • For example, cAMP stimulates the production of ATP for muscle contraction. (wikibooks.org)
  • In UMR 106-01 cells, PTH receptors are strikingly down-regulated by pretreatment with 8-Br-cAMP or 3-isobutyl-1-methylxanthine for 2 days. (sigmaaldrich.com)
  • The cAMP-Screen® and cAMP-Screen Direct® assay systems have been used with a wide range of cell lines containing endogenous receptors, including epithelial, neuronal, endocrine, pancreatic, and tumor-derived cell lines, as well as stably- and transiently-transfected CHO and HEK cells exogenously expressing many different GPCRs, neurotransmitter, adenosine, and hormone receptors. (thermofisher.com)
  • Photoreceptor cells express dopamine D4 receptors that regulate cAMP metabolism. (jneurosci.org)
  • These findings indicate that dopamine D4 receptors normally play a major role in regulating photoreceptor cAMP metabolism and adaptive retinal responses to changing environmental illumination. (jneurosci.org)
  • G protein (heterotrimeric guanine nucleotide-binding protein)-coupled receptors (GPCRs) are the best candidates for stimulating an increase in cAMP concentration in cells of the nervous system that could, in turn, control ERK activation. (sciencemag.org)
  • We have shown in the NG108-15 neuroblastoma × glioma hybrid cell line that ethanol increases cellular cAMP levels via activation of adenosine A 2 receptors, leading to phosphorylation of the cAMP response element-binding protein (CREB). (aspetjournals.org)
  • These results support a working hypothesis in which the occupancy of surface cAMP receptors leads to changes in two opposing cellular processes, excitation and adaptation, that control the activity of D. discoideum adenylate cyclase. (elsevier.com)
  • cAMP-gated channels were studied in inside-out membrane patches excised from the apical cellular pole of isolated olfactory receptor cells of the rat. (rupress.org)
  • The Applied Biosystems® cAMP-Screen® and cAMP-Screen Direct® chemiluminescent immunoassay systems were designed for rapid and convenient quantitation of cellular cAMP in functional assays of receptor activation, with both adherent and nonadherent cell types. (thermofisher.com)
  • Growth-arrest of cells resulted in preferential decrease of cellular cCMP- and cUMP concentrations as compared to cAMP- and cGMP concentrations, indicating that cCMP- and cUMP production is dependent on factors present in serum. (biomedcentral.com)
  • Investigations of the cellular actions of PKA led to the working hypothesis that all of the biological effects of cAMP within cells might be PKA-dependent ( 4 ). (sciencemag.org)
  • Our data are consistent with an increased role for PDE3 in regulating cAMP-dependent signaling in cp / cp VSMCs and identify PDE3 as a cellular activity potentially responsible for the phenotype of cp / cp VSMCs. (diabetesjournals.org)
  • Increased cellular cAMP levels can prevent the transformation of CFs into profibrogenic myofibroblasts, a critical step that precedes increased ECM deposition and tissue fibrosis. (aspetjournals.org)
  • We conclude that therapeutic strategies designed to enhance cellular cAMP concentrations in CFs may provide a means to reverse excessive scar formation following injury and to treat cardiac fibrosis. (aspetjournals.org)
  • A number of hormones are known to activate cAMP through the action of the enzyme Adenylate cyclase which converts ATP to cAMP. (abcam.com)
  • With loss-of-function experiments in the rat neuronal cell line Neuroscreen-1 (NS-1) and gain-of-function experiments in human embryonic kidney 293T cells, we demonstrated that Rapgef2 connected GPCR-dependent activation of adenylate cyclase and increased cAMP concentration with the activation of ERK in neurons and endocrine cells. (sciencemag.org)
  • In Dictyostelium discoideum, extracellular cAMP activates adenylate cyclase, which leads to an increase in intracellular cAMP and the rate of cAMP secretion. (elsevier.com)
  • Cyclic AMP plays an important role in the regulation of metabolism generally. (diabetesjournals.org)
  • May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain. (uniprot.org)
  • cAMP has been shown to be involved in the cardiovascular and nervous systems, immune mechanisms, cell growth and differentiation, and general metabolism. (abcam.com)
  • To assess the effects of dopamine on photoreceptor physiology, we examined the morphology, electrophysiology, and regulation of cAMP metabolism in mice with targeted disruption of the dopamine D4 receptor gene. (jneurosci.org)
  • cAMP Treatment Improves Adipose Metabolism to Mimic Calorie Restriction. (nature.com)
  • Altogether, these data identify cGKI as the downstream target of cGMP in erectile tissue and provide evidence that cAMP signaling cannot compensate for the absence of the cGMP/cGKI signaling cascade in vivo . (diva-portal.org)
  • Furthermore, we analyzed whether a cross-talk exists between the cGMP and cyclic AMP (cAMP) signaling cascades in smooth muscle (5, 14), i.e., whether cAMP can cause relaxation via cGKI. (diva-portal.org)
  • In conclusion, ketamine promotes the proliferation of NPCs presumably by involving cAMP-IGF2 signaling. (mdpi.com)
  • In the field of molecular biology , the cAMP-dependent pathway , also known as the adenylyl cyclase pathway , is a G protein-coupled receptor -triggered signaling cascade used in cell communication . (wikipedia.org)
  • Specificity of signaling between a GPCR and its ultimate molecular target through a cAMP-dependent pathway may be achieved through formation of a multiprotein complex that includes the GPCR, adenylyl cyclase, and the effector protein. (wikipedia.org)
  • Furthermore, cAMPr was used together with a fluorescent Ca 2+ sensor to simultaneously detect cAMP and Ca 2+ in the Drosophila brain through two-photon imaging, suggesting its potential use to study cAMP signaling in diverse tissues and organisms. (sciencemag.org)
  • However, it has long been assumed that GPCR-initiated increases in cAMP concentration and ERK activation are separate and well-insulated signaling pathways ( 13 , 14 ). (sciencemag.org)
  • This chapter deals in detail the contribution of these components of cAMP signaling in cAMP homeostasis of the parasite as well as their role on successful host-parasite interaction leading to intracellular parasite survival and establishment of infection. (intechopen.com)
  • In conclusion, our data supports the idea that the outcome of cAMP signaling in SCs depends on the particular set of effectors activated. (lecollege.org)
  • It has also became apparent that PKA and EPAC are able to simultaneously control multiple processes within the same cell and that the outcome of cAMP signaling may depend on the particular set of downstream effectors activated. (lecollege.org)
  • As KIAA0564 a result we have utilized enzymatic, traditional western blot, PCR, and biochemical assays to review the appearance of different PDE isoforms and downstream effectors of cAMP signaling in wild-type and Ritonavir polycystic rat and mouse kidneys. (movd2016.org)
  • Our data suggest that ethanol induces cAMP-dependent gene expression regulated by CREB and PKA and that this signaling pathway may mediate some of the addictive behaviors underlying alcoholism. (aspetjournals.org)
  • The signaling response to a constant cAMP stimulus is terminated after several minutes by an adaptation mechanism. (elsevier.com)
  • Dinauer, MC, Steck, TL & Devreotes, PN 1980, ' Cyclic 3'-5'-AMP Relay in Dictyostelium discoideum V. adaptation of the cAMP signaling response During cAMP stimulation ', Journal of Cell Biology , vol. 86, no. 2, pp. 554-561. (elsevier.com)
  • Background The cyclic AMP (cAMP) signaling pathway has been reported to either promote or suppress cell death in a cell context-dependent manner. (bio-aromatica.com)
  • However, repeated GEBR-7b administration significantly reversed CUS-induced depression-like behavior and changes of cAMP/PKA/CREB/GLT1 signaling. (dovepress.com)
  • We showed that activation of adrenergic signaling increases AC-cAMP/PKA signaling, which mediates the increase in the SANC AP firing rate (i.e., positive chronotropic modulation). (frontiersin.org)
  • Eliminating AC-cAMP-PKA signaling abolished the core effect of autonomic receptor stimulation on the AP firing rate. (frontiersin.org)
  • 3'5' Cyclic AMP phosphodiesterase activity in the testes & fat body & the effect of prostaglandins & cAMP in the green frog Rana hexadactyla Lesson. (bvsalud.org)
  • The effect of cGMP on cAMP levels results in a different activation of PKA isoforms and affects the phosphorylation of downstream PKA targets. (unipd.it)
  • Drugs of abuse modulate the phosphorylation of ARPP-21, a cyclic AMP-regulated phosphoprotein enriched in the basal ganglia. (nih.gov)
  • However, phosphorylation of CREB is not sufficient to activate cAMP response element (CRE)-mediated gene expression. (aspetjournals.org)
  • In English Incubation of 3T3-L1 preadipocytes with isobutylmethylxanthine (IBMX), dexamethasone, and insulin, alone or in combination, demonstrated that IBMX, which increased cAMP-response element-binding protein (CREB) phosphorylation, was the predominant regulator of Pde3b expression. (lu.se)
  • Axl phosphorylation was also induced by a cAMP analogue demonstrating interplay between the cAMP and RTK pathways. (jimmunol.org)
  • Hippocampal cAMP levels were examined by enzyme-linked immunosorbent assay, whereas PKAca, phosphorylation of CREB (pCREB), CREB, and GLT1 in the hippocampus of rats were subjected to Western blot analysis. (dovepress.com)
  • Thus, Ca 2+ and cAMP/PKA-dependent phosphorylation limits the rate and magnitude of chronotropic changes in the spontaneous AP firing rate. (frontiersin.org)
  • Receptor regulation by NlePTH(3-34) is not blocked in the cAMP-resistant cells, however. (sigmaaldrich.com)
  • In contrast to its additive effect on receptor regulation, NlePTH(3-34) efficiently competes for binding to the PTH receptor in UMR 106-01 cells and antagonizes the stimulatory effects of NlePTH(1-34) on both intracellular cAMP accumulation and gene expression driven by a transiently transfected synthetic cAMP-responsive enhancer. (sigmaaldrich.com)
  • Cyclic nucleotide-gated channels of rat olfactory receptor cells: divalent cations control the sensitivity to cAMP. (rupress.org)
  • Elevation of cAMP using forskolin, cAMP-analogues or adenosine A2B-receptor activation significantly reduced EPAC1 mRNA and protein levels and inhibited formation of F-actin stress fibres. (diagenode.com)
  • In the nervous system, ERK mediates cAMP-dependent intracellular effects, including synaptic plasticity underlying memory formation and neurodegeneration-dependent receptor supersensitivity ( 10 - 12 ). (sciencemag.org)
  • On the other hand and somehow paradoxically, cAMP is usually a strong mitogenic factor for SCs [4] and synergistically enhances cell proliferation in response to polypeptide growth factors that activate receptor tyrosine kinases (RTKs), such as PDGF and neuregulin [5-7]. (lecollege.org)
  • Here we tested two hypotheses: 1) myofibroblasts have a decreased ability to accumulate cAMP in response to G protein-coupled receptor (GPCR) agonists, and 2) increasing cAMP will not only prevent, but also reverse, the myofibroblast phenotype. (aspetjournals.org)
  • Yet, the sensors available up to now are hampered by the low affinity of the cAMP binding moieties employed. (provendis.info)
  • US 8889425 B2 bind cAMP with an affinity in the low mikromolar range, which may be insufficient for measuring basal cAMP levels. (provendis.info)
  • Sandwiched between a blue and a yellow fluorescent protein, this motif exhibits a nanomolar affinity and allows for real-time mesurement of intracellular cAMP concentration. (provendis.info)
  • We found that the Rap guanine nucleotide exchange factor Rapgef2 was enriched from primary bovine neuroendocrine cells by cAMP-agarose affinity chromatography and that it was specifically eluted by cAMP. (sciencemag.org)
  • Through an analysis of the genome of G. lamblia , we found sequences of three putative enzymes - one phosphodiesterase (gPDE) and two nucleotidyl cyclases (gNC1 and gNC2) - that should be responsible for the regulation of cAMP in G. lamblia . (biochemj.org)
  • Current treatments of erectile dysfunction elevate either cGMP levels by blocking cGMP degrading phosphodiesterase 5 or cyclic AMP (cAMP) levels by intrapenile injection of prostaglandin E1. (diva-portal.org)
  • Taken together, these data demonstrate that cAMP downregulates EPAC1 gene expression via disrupting the actin cytoskeleton, which inhibits YAP/TAZ-TEAD activity in concert with HDAC-mediated histone deacetylation at the EPAC1 proximal promoter. (diagenode.com)
  • This gene encodes a cAMP-regulated phosphoprotein. (nih.gov)
  • By transfecting preadipocytes, differentiating preadipocytes, and HEK293A cells with luciferase reporter vectors containing different fragments of the 5'- flanking region of the Pde3b gene, we identified a distal promoter that contained canonical cis-acting cAMP-response elements (CRE) and a proximal, GC-rich promoter region, which contained atypical CRE. (lu.se)
  • We characterized the role of potential cAMP-responsive elements (CRE) in basal and in induced angiotensin converting enzyme (ACE) gene promoter activity in order to shed light on the regulation of somatic ACE expression. (scielo.br)
  • Among the principal effects of cyclic AMP in these tissues are glycogenolysis in muscle and lipolysis in adipose tissue. (diabetesjournals.org)
  • Insulin then travels to the liver and adipose tissue to suppress the accumulation of cyclic AMP, and may also antagonize the action of cyclic AMP in muscle. (diabetesjournals.org)
  • Therefore, we investigated regulation of EPAC1 expression by cAMP in cardiac fibroblasts. (diagenode.com)
  • impairment of SC differentiation and myelin formation but not Krox-20 expression, which indicates an independent mechanism of Krox-20 regulation in response to cAMP. (lecollege.org)
  • Thus, Fingolimod we sought to investigate the differential contribution of PKA and EPAC to the cAMP-dependent regulation of SC proliferation and differentiation. (lecollege.org)
  • It is required for the formation of adult pacemaker cells during embryonic heart development and for the cAMP-dependent up-regulation of embryonic heart rate. (ebi.ac.uk)
  • The G s alpha subunit, in turn, activates adenylyl cyclase, which quickly converts ATP into cAMP. (wikipedia.org)
  • This leads to an increase in adenylyl cyclase activity, thereby increasing cAMP levels, which can lead to an increase in insulin and therefore hypoglycemia The Gs alpha subunit slowly catalyzes the hydrolysis of GTP to GDP, which in turn deactivates the Gs protein, shutting off the cAMP pathway. (wikipedia.org)
  • Cyclic AMP is a key molecule in 2nd messenger cell signalling. (provendis.info)
  • Lately a new course of substances, the 2-(acylamino)-3-thiophenecarboxylates, provides been shown to operate as non-selective phosphodiesterase activators and inhibit the development of MDCK cysts.23 Small information is on the design of expression of the various PDE isoforms and of the downstream effectors considered to mediate the cystogenic aftereffect of cAMP in polycystic kidneys. (movd2016.org)
  • The cross-reactivity data obtained in competitive ELISA system is as follows: Compound % Cross-reactivity cAMP. (lsbio.com)
  • Small volumes of Camp elisa kit vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. (mybiosource.com)
  • The ELISA Kit is designed to detect native, not recombinant, Camp. (mybiosource.com)
  • Intended Uses: This cAMP ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse cAMP. (mybiosource.com)
  • CAMP ELISA kit applies the quantitative sandwich enzyme immunoassay technique. (mybiosource.com)
  • Abcam's Cyclic AMP in vitr o competitive ELISA (Enzyme-Linked Immunosorbent Assay) is a colorimetric competitive enzyme immunoassay kit for the quantitative determination of extracellular cAMP. (abcam.com)
  • The "regular" cAMP kit, Cyclic AMP ELISA Kit (ab133039) comes with an assay buffer for diluting standards and samples, and is intended for use with extracellular cAMP - samples like serum or cell culture media, for example. (abcam.com)
  • Whereas the mitogenic action of cAMP relies exclusively on PKA activity, the differentiating action of cAMP requires a PKA-independent (non-canonical) cAMP-specific pathway that is partially transduced by EPAC. (lecollege.org)
  • On the contrary, EPAC directly transduces cAMP signals through its ability to act as a guanine nucleotide exchange factor for the small GTP-binding protein Rap1. (lecollege.org)
  • Besides PKA and EPAC, other intracellular targets that bind cAMP through conserved cAMP-binding domains, including some cyclic nucleotide-gated channels, have been recognized. (lecollege.org)
  • In the rostral ventrolateral medulla (RVLM), Sp-cAMPs and 8-Br-cAMP, which activate PKA, as well as 8-pCPT, which activates EPAC, increased sSNA, AP, and HR. Sp-cAMPs also facilitated the reflexes tested. (aspetjournals.org)
  • Molecules that activate cAMP pathway include: cholera toxin - increases cAMP levels forskolin - a diterpene natural product that activates adenylyl cyclase caffeine and theophylline inhibit cAMP phosphodiesterase, which degrades cAMP - thus enabling higher levels of cAMP than would otherwise be had. (wikipedia.org)
  • This assay has high sensitivity and excellent specificity for detection of cAMP. (mybiosource.com)
  • Hardman JG, Sutherland EW: A cyclic 3',5'-nucleotide phosphodiesterase from heart with specificity for uridine 3',5'-phosphate. (biomedcentral.com)
  • VSMC cAMP hydrolysis is catalyzed by members of the phosphodiesterase 3 (PDE3) and PDE4 families ( 12 ), whereas VSMC cGMP is inactivated by PDE1 or PDE5 enzymes ( 15 ). (diabetesjournals.org)
  • Among every one of the PDE isoforms, PDE4 may be the main cAMP-degrading enzyme within inflammatory and immune system cells. (recyclers-info.com)
  • The cAMP-Screen® assay has also been used for cAMP quantitation from tissues. (thermofisher.com)
  • The cAMP-Screen® and cAMP-Screen Direct® competitive immunoassay systems are formatted for maximum flexibility to permit either manual assay or automated high-throughput screening with 96- or 384-well microplates. (thermofisher.com)
  • With the cAMP-Screen Direct® system, cells are grown and lysed directly in the assay plate. (thermofisher.com)
  • HEK 293 cells were plated at the indicated densities and grown in cAMP-Screen Direct® 96-well assay plates, followed by duplicate cAMP-Screen Direct® assays in the presence of cAMP standards. (thermofisher.com)
  • At another level, the role of cyclic AMP is more obvious: insulin deficiency leaves unopposed the actions of hormones which stimulate the production of cyclic AMP, thereby contributing to the glucose plethora and ketosis so often seen in the later stages of the disease. (diabetesjournals.org)
  • These data suggest that cAMP and Ca2+ stimulate HCO3- secretion across airway epithelium, and suggest that HCO3- leaves the cell across the apical membrane via conductive pathways. (jci.org)
  • In the C terminus the channels carry a cyclic nucleotide-binding domain (CNBD) [ PMID: 12161074 ]. (ebi.ac.uk)
  • Binding of cAMP to the CNBD speeds up channel opening and shifts the voltage-dependence of activation to more positive voltages [ PMID: 18953682 ]. (ebi.ac.uk)
  • Elevation of cAMP by forskolin, however, induces similar relaxation in normal and cGKI-null corpus cavernosum. (diva-portal.org)
  • Effect of forskolin and an antagonist on cAMP levels. (thermofisher.com)
  • Duplicate cAMP-Screen® assays were performed after using the indicated concentration of forskolin to induce cAMP production in SK-N-MC cells in the absence or presence of a forskolin antagonist (human NPY). (thermofisher.com)
  • 4. Elevation of intracellular cAMP (by exposure to forskolin) evoked a 6-fold PKA-dependent enhancement of the maximal exocytotic response (determined as the maximum increase in cell capacitance that could be elicited by a train of depolarizations) in perforated-patch whole-cell recordings. (nih.gov)
  • However, addition of 0.2 or 0.5 mM Ca2+ shifted the KM of cAMP reversibly to the higher cAMP concentrations of 33 or 90 microM, respectively, at -50 mV. (rupress.org)
  • Great effort has been taken to develop sensors that allow for noninvasive assessment of cAMP concentrations in living cells. (provendis.info)
  • Genetically encoded biosensors hold great promise to allow spatial and temporal measurements of cAMP concentrations in living cells. (provendis.info)
  • These results indicate that: 1) altered expression of AC and PDE isoforms yield a decrease in cAMP concentrations of cardiac myofibroblasts (relative to CFs) that likely contributes to their profibrotic state, and 2) approaches to increase cAMP concentrations not only prevent fibroblast-to-myofibroblast transformation but also can reverse the profibrotic myofibroblastic phenotype. (aspetjournals.org)
  • The PKA enzyme is also known as cAMP-dependent enzyme because it gets activated only if cAMP is present. (wikipedia.org)
  • developed a genetically encoded fluorescent sensor of cAMP (cAMPr), which was expressed in mammalian neurons and in the Drosophila brain and responded to stimulation of adenylyl cyclase, the enzyme that generates cAMP. (sciencemag.org)
  • All known cAMP sensors, with the exception of the channels, exert their effects indirectly through the activation of enzyme activities within the cell. (sciencemag.org)
  • In enzymology, a cytidylate cyclase (EC 4.6.1.6) is an enzyme that catalyzes the chemical reaction CTP ⇌ {\displaystyle \rightleftharpoons } 3',5'-cyclic CMP + diphosphate Hence, this enzyme has one substrate, CTP, and two products, 3',5'-cyclic CMP and diphosphate. (wikipedia.org)
  • When a signal is first transducted inside the cell, an enzyme called adenylyl cyclase is activated which converts ATP to cAMP. (wikibooks.org)
  • However, the cAMP molecules do not last long as another enzyme, phosphodiesterase, converts cAMP to AMP which means another signal is necessary in order for another response to occur. (wikibooks.org)
  • The concentration gradients of the kit standards or positive controls render a theoretical kit detection range of 10-250pmoL/mL in biological research samples containing Camp, with an estimated sensitivity of 1.0pmoL/mL. (mybiosource.com)
  • The concentration gradients of the kit standards or positive controls render a theoretical kit detection range in biological research samples containing Camp. (mybiosource.com)
  • Standard curves display an inverse correlation between signal intensity and free cAMP concentration and allow quantitation of the amount of cAMP. (thermofisher.com)
  • 3. A prison camp or concentration camp. (thefreedictionary.com)
  • During pretreatment with 10 -6 M cAMP, the rates of attenuation could be ranked according to the concentration of the test stimulus. (elsevier.com)
  • The latter enzymes may also degrade cAMP, so it may also be informative to measure intracellular cAMP levels. (bio-protocol.org)
  • Therefore, cGMP can potentially influence intracellular cAMP levels. (unipd.it)
  • The generation of nitric oxide (NO) in penile erectile tissue and the subsequent elevation of cyclic GMP (cGMP) levels are important for normal penile erection. (diva-portal.org)
  • The molecular target or targets of cGMP in erectile tissue and the role of cAMP for normal penile erection are not known. (diva-portal.org)
  • to determine the levels of cAMP in olfactory tissue from people with chronic rhinosinusitis and other nasal disorders. (clinicaltrials.gov)
  • 2. to correlate preoperative olfactory function with cAMP levels from biopsied olfactory tissue. (clinicaltrials.gov)
  • Elevated degrees of cAMP are located in the kidney, liver organ, vascular smooth muscle tissue, and choroid plexus, in a variety of animal types of PKD.12C19 Arginine vasopressin (AVP) V2R antagonists reduced the degrees of cAMP in the kidneys and inhibit the development and progression of PKD in choices orthologous to ARPKD (PCK rat), adolescent nephronophthisis (mouse) and ADPKD type 2 (mouse). (movd2016.org)
  • The systems in charge of the deposition of cAMP in cystic tissue and because of its influence on cystogenesis aren't well understood. (movd2016.org)
  • NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between cAMP and all the analogues, therefore, cross reaction may still exist in some cases. (mybiosource.com)
  • Comparison with other single-wavelength cAMP sensors showed that cAMPr improved the quantitative detection of cAMP abundance. (sciencemag.org)
  • Elevated cyclic-AMP represses expression of exchange protein activated by cAMP (EPAC1) by inhibiting YAP-TEAD activity and HDAC-mediated histone deacetylation. (diagenode.com)
  • In other cells, cAMP enhances the degradation of storage fuels, increases the secretion of acid by the gastric mucosa, leads to the dispersion of melanin pigment gradules, and diminishes the aggregation of blood platelets. (wikibooks.org)
  • This could be secondary to basement membrane thickening, but there is also evidence that the cyclic AMP mechanism may be defective. (diabetesjournals.org)
  • [2] cAMP is considered a secondary messenger along with Ca 2+ . (wikipedia.org)
  • Sutherland won the Nobel Prize in 1971 for his discovery of the mechanism of action of epinephrine in glycogenolysis, that requires cAMP as secondary messenger. (wikipedia.org)
  • This protection effect did not occur in intact cells and was probably a consequence of patch excision, possibly representing ablation of a regulatory protein from the channel cyclic nucleotide binding site. (rupress.org)
  • Thus, the binding of divalent cations, probably via a regulatory protein, controls the sensitivity of the cAMP-gated channels to cAMP. (rupress.org)
  • cAMP binds to the regulatory sub-units. (wikipedia.org)