Cyanothece: A form-genus of unicellular coccoid to rod-shaped CYANOBACTERIA, in the order Chroococcales. Three different clusters of strains from diverse habitats are included.Nitrogen Fixation: The process in certain BACTERIA; FUNGI; and CYANOBACTERIA converting free atmospheric NITROGEN to biologically usable forms of nitrogen, such as AMMONIA; NITRATES; and amino compounds.Cyanobacteria: A phylum of oxygenic photosynthetic bacteria comprised of unicellular to multicellular bacteria possessing CHLOROPHYLL a and carrying out oxygenic PHOTOSYNTHESIS. Cyanobacteria are the only known organisms capable of fixing both CARBON DIOXIDE (in the presence of light) and NITROGEN. Cell morphology can include nitrogen-fixing heterocysts and/or resting cells called akinetes. Formerly called blue-green algae, cyanobacteria were traditionally treated as ALGAE.Freeze Substitution: A modification of the freeze-drying method in which the ice within the frozen tissue is replaced by alcohol or other solvent at a very low temperature.Nitrogenase: An enzyme system that catalyzes the fixing of nitrogen in soil bacteria and blue-green algae (CYANOBACTERIA). EC 1.18.6.1.Photosynthesis: The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide using energy obtained from light rather than from the oxidation of chemical compounds. Photosynthesis comprises two separate processes: the light reactions and the dark reactions. In higher plants; GREEN ALGAE; and CYANOBACTERIA; NADPH and ATP formed by the light reactions drive the dark reactions which result in the fixation of carbon dioxide. (from Oxford Dictionary of Biochemistry and Molecular Biology, 2001)Heterotrophic Processes: The processes by which organisms utilize organic substances as their nutrient sources. Contrasts with AUTOTROPHIC PROCESSES which make use of simple inorganic substances as the nutrient supply source. Heterotrophs can be either chemoheterotrophs (or chemoorganotrophs) which also require organic substances such as glucose for their primary metabolic energy requirements, or photoheterotrophs (or photoorganotrophs) which derive their primary energy requirements from light. Depending on environmental conditions some organisms can switch between different nutritional modes (AUTOTROPHY; heterotrophy; chemotrophy; or PHOTOTROPHY) to utilize different sources to meet their nutrients and energy requirements.Phototrophic Processes: Processes by which phototrophic organisms use sunlight as their primary energy source. Contrasts with chemotrophic processes which do not depend on light and function in deriving energy from exogenous chemical sources. Photoautotrophy (or photolithotrophy) is the ability to use sunlight as energy to fix inorganic nutrients to be used for other organic requirements. Photoautotrophs include all GREEN PLANTS; GREEN ALGAE; CYANOBACTERIA; and green and PURPLE SULFUR BACTERIA. Photoheterotrophs or photoorganotrophs require a supply of organic nutrients for their organic requirements but use sunlight as their primary energy source; examples include certain PURPLE NONSULFUR BACTERIA. Depending on environmental conditions some organisms can switch between different nutritional modes (AUTOTROPHY; HETEROTROPHY; chemotrophy; or phototrophy) to utilize different sources to meet their nutrients and energy requirements.Hydrogen: The first chemical element in the periodic table. It has the atomic symbol H, atomic number 1, and atomic weight [1.00784; 1.00811]. It exists, under normal conditions, as a colorless, odorless, tasteless, diatomic gas. Hydrogen ions are PROTONS. Besides the common H1 isotope, hydrogen exists as the stable isotope DEUTERIUM and the unstable, radioactive isotope TRITIUM.Technology Transfer: Spread and adoption of inventions and techniques from one geographic area to another, from one discipline to another, or from one sector of the economy to another. For example, improvements in medical equipment may be transferred from industrial countries to developing countries, advances arising from aerospace engineering may be applied to equipment for persons with disabilities, and innovations in science arising from government research are made available to private enterprise.Public Opinion: The attitude of a significant portion of a population toward any given proposition, based upon a measurable amount of factual evidence, and involving some degree of reflection, analysis, and reasoning.Biological Science Disciplines: All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.Consumer Participation: Community or individual involvement in the decision-making process.Intellectual Property: Property, such as patents, trademarks, and copyright, that results from creative effort. The Patent and Copyright Clause (Art. 1, Sec. 8, cl. 8) of the United States Constitution provides for promoting the progress of science and useful arts by securing for limited times to authors and inventors, the exclusive right to their respective writings and discoveries. (From Black's Law Dictionary, 5th ed, p1014)Entrepreneurship: The organization, management, and assumption of risks of a business or enterprise, usually implying an element of change or challenge and a new opportunity.Technology, Pharmaceutical: The application of scientific knowledge or technology to pharmacy and the pharmaceutical industry. It includes methods, techniques, and instrumentation in the manufacture, preparation, compounding, dispensing, packaging, and storing of drugs and other preparations used in diagnostic and determinative procedures, and in the treatment of patients.Metalloproteins: Proteins that have one or more tightly bound metal ions forming part of their structure. (Dorland, 28th ed)NorwayLimbus Corneae: An annular transitional zone, approximately 1 mm wide, between the cornea and the bulbar conjunctiva and sclera. It is highly vascular and is involved in the metabolism of the cornea. It is ophthalmologically significant in that it appears on the outer surface of the eyeball as a slight furrow, marking the line between the clear cornea and the sclera. (Dictionary of Visual Science, 3d ed)Biodegradation, Environmental: Elimination of ENVIRONMENTAL POLLUTANTS; PESTICIDES and other waste using living organisms, usually involving intervention of environmental or sanitation engineers.Membrane Proteins: Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.HydrocarbonsMolecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Salmonella enterica: A subgenus of Salmonella containing several medically important serotypes. The habitat for the majority of strains is warm-blooded animals.Salmonella Infections, Animal: Infections in animals with bacteria of the genus SALMONELLA.Salmonella arizonae: Gram-negative rods widely distributed in LIZARDS and SNAKES, and implicated in enteric, bone (BONE DISEASES), and joint infections (JOINT DISEASES) in humans.Salmonella Infections: Infections with bacteria of the genus SALMONELLA.Salmonella typhimurium: A serotype of Salmonella enterica that is a frequent agent of Salmonella gastroenteritis in humans. It also causes PARATYPHOID FEVER.Lipoproteins: Lipid-protein complexes involved in the transportation and metabolism of lipids in the body. They are spherical particles consisting of a hydrophobic core of TRIGLYCERIDES and CHOLESTEROL ESTERS surrounded by a layer of hydrophilic free CHOLESTEROL; PHOSPHOLIPIDS; and APOLIPOPROTEINS. Lipoproteins are classified by their varying buoyant density and sizes.Bacterial Outer Membrane Proteins: Proteins isolated from the outer membrane of Gram-negative bacteria.Protein Structure, Tertiary: The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.Databases, Protein: Databases containing information about PROTEINS such as AMINO ACID SEQUENCE; PROTEIN CONFORMATION; and other properties.Sequence Alignment: The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.Sequence Analysis, Protein: A process that includes the determination of AMINO ACID SEQUENCE of a protein (or peptide, oligopeptide or peptide fragment) and the information analysis of the sequence.Haloferax mediterranei: A species of halophilic archaea found in the Mediterranean Sea. It produces bacteriocins active against a range of other halobacteria.Proteins: Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.Holliday Junction Resolvases: Enzymes that recognize CRUCIFORM DNA structures and introduce paired incisions that help to resolve the structure into two DNA helices.DNA, Cruciform: A cross-shaped DNA structure that can be observed under the electron microscope. It is formed by the incomplete exchange of strands between two double-stranded helices or by complementary INVERTED REPEAT SEQUENCES that refold into hairpin loops on opposite strands across from each other.Endodeoxyribonucleases: A group of enzymes catalyzing the endonucleolytic cleavage of DNA. They include members of EC 3.1.21.-, EC 3.1.22.-, EC 3.1.23.- (DNA RESTRICTION ENZYMES), EC 3.1.24.- (DNA RESTRICTION ENZYMES), and EC 3.1.25.-.Recombinases: A broad category of enzymes that are involved in the process of GENETIC RECOMBINATION.Recombination, Genetic: Production of new arrangements of DNA by various mechanisms such as assortment and segregation, CROSSING OVER; GENE CONVERSION; GENETIC TRANSFORMATION; GENETIC CONJUGATION; GENETIC TRANSDUCTION; or mixed infection of viruses.HSP40 Heat-Shock Proteins: A family of heat-shock proteins that contain a 70 amino-acid consensus sequence known as the J domain. The J domain of HSP40 heat shock proteins interacts with HSP70 HEAT-SHOCK PROTEINS. HSP40 heat-shock proteins play a role in regulating the ADENOSINE TRIPHOSPHATASES activity of HSP70 heat-shock proteins.DNA Helicases: Proteins that catalyze the unwinding of duplex DNA during replication by binding cooperatively to single-stranded regions of DNA or to short regions of duplex DNA that are undergoing transient opening. In addition DNA helicases are DNA-dependent ATPases that harness the free energy of ATP hydrolysis to translocate DNA strands.Veillonella: A genus of gram-negative, anaerobic cocci parasitic in the mouth and in the intestinal and respiratory tracts of man and other animals.Bacteria: One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.RNA, Ribosomal, 16S: Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.Metagenome: A collective genome representative of the many organisms, primarily microorganisms, existing in a community.Dental Plaque: A film that attaches to teeth, often causing DENTAL CARIES and GINGIVITIS. It is composed of MUCINS, secreted from salivary glands, and microorganisms.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Bacteria, AnaerobicUbiquitin-Conjugating Enzymes: A class of enzymes that form a thioester bond to UBIQUITIN with the assistance of UBIQUITIN-ACTIVATING ENZYMES. They transfer ubiquitin to the LYSINE of a substrate protein with the assistance of UBIQUITIN-PROTEIN LIGASES.Saccharomyces cerevisiae: A species of the genus SACCHAROMYCES, family Saccharomycetaceae, order Saccharomycetales, known as "baker's" or "brewer's" yeast. The dried form is used as a dietary supplement.Ligases: A class of enzymes that catalyze the formation of a bond between two substrate molecules, coupled with the hydrolysis of a pyrophosphate bond in ATP or a similar energy donor. (Dorland, 28th ed) EC 6.Genes, Fungal: The functional hereditary units of FUNGI.Adenovirus E1B Proteins: Proteins transcribed from the E1B region of ADENOVIRUSES which are involved in regulation of the levels of early and late viral gene expression.Ubiquitins: A family of proteins that are structurally-related to Ubiquitin. Ubiquitins and ubiquitin-like proteins participate in diverse cellular functions, such as protein degradation and HEAT-SHOCK RESPONSE, by conjugation to other proteins.

Characterization of two potentially universal turn motifs that shape the repeated five-residues fold--crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142. (1/27)

The genome of the diurnal cyanobacterium Cyanothece sp. PCC 51142 has recently been sequenced and observed to contain 35 pentapeptide repeat proteins (PRPs). These proteins, while present throughout the prokaryotic and eukaryotic kingdoms, are most abundant in cyanobacteria. The sheer number of PRPs in cyanobacteria coupled with their predicted location in every cellular compartment argues for important, yet unknown, physiological and biochemical functions. To gain biochemical insights, the crystal structure for Rfr32, a 167-residue PRP with an N-terminal 29-residue signal peptide, was determined at 2.1 A resolution. The structure is dominated by 21 tandem pentapeptide repeats that fold into a right-handed quadrilateral beta-helix, or Rfr-fold, as observed for the tandem pentapeptide repeats in the only other PRP structure, the mycobacterial fluoroquinoline resistance protein MfpA from Mycobacterium tuberculosis. Sitting on top of the Rfr-fold are two short, antiparallel alpha-helices, bridged with a disulfide bond, that perhaps prevent edge-to-edge aggregation at the C terminus. Analysis of the main-chain (Phi,Psi) dihedral orientations for the pentapeptide repeats in Rfr32 and MfpA makes it possible to recognize the structural details for the two distinct types of four-residue turns adopted by the pentapeptide repeats in the Rfr-fold. These turns, labeled type II and type IV beta-turns, may be universal motifs that shape the Rfr-fold in all PRPs.  (+info)

Cloning, expression, crystallization and preliminary crystallographic analysis of a pentapeptide-repeat protein (Rfr23) from the bacterium Cyanothece 51142. (2/27)

A unique feature of cyanobacteria genomes is the abundance of genes that code for hypothetical proteins containing tandem pentapeptide repeats approximately described by the consensus motif A(N/D)LXX. To date, the structures of two pentapeptide-repeat proteins (PRPs) have been determined, with the tandem pentapeptide-repeat sequences observed to adopt a novel type of right-handed quadrilateral beta-helix, or Rfr-fold, in both structures. One structure, Mycobacterium tuberculosis MfpA, is a 183-residue protein that contains 30 consecutive pentapeptide repeats and appears to offer antibiotic resistance by acting as a DNA mimic. The other structure, Cyanothece 51142 Rfr32, is a 167-residue protein that contains 21 consecutive pentapeptide repeats. The function of Rfr32, like the other 35 hypothetical PRPs identified in the genome of Cyanothece, is unknown. In an effort to understand the role of PRPs in cyanobacteria and to better characterize the structural properties of Rfr-folds with different amino-acid sequences, a second PRP from Cyanothece 51142, Rfr23, has been cloned, expressed and purified. Selenomethione-substituted protein was crystallized by vapor diffusion in hanging drops. Nearly complete SAD and native diffraction data sets were collected from these crystals to 2.5 and 2.1 A resolution, respectively, using synchrotron radiation. The crystals belonged to space group I4(1), with unit-cell parameters a = b = 106.61, c = 53.37 A, and one molecule per asymmetric unit. Preliminary analysis of the electron-density map from the SAD data shows that Rfr23 contains an Rfr-fold.  (+info)

The cyanobacterial endosymbiont of the unicellular algae Rhopalodia gibba shows reductive genome evolution. (3/27)

 (+info)

Differential transcriptional analysis of the cyanobacterium Cyanothece sp. strain ATCC 51142 during light-dark and continuous-light growth. (4/27)

 (+info)

Global transcriptomic analysis of Cyanothece 51142 reveals robust diurnal oscillation of central metabolic processes. (5/27)

 (+info)

The genome of Cyanothece 51142, a unicellular diazotrophic cyanobacterium important in the marine nitrogen cycle. (6/27)

 (+info)

Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family. (7/27)

 (+info)

Effect of continuous light on diurnal rhythms in Cyanothece sp. ATCC 51142. (8/27)

 (+info)

Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Arsenic atom in PDB 2o6w: Crystal Structure of A Pentapeptide Repeat Protein (RFR23) From the Cyanobacterium Cyanothece 51142
Cyanothece sp. ATCC ® 51142D-5™ Designation: Genomic DNA from Cyanothece sp. strain BH68 TypeStrain=False Application:
Cyanothece sp. ATCC ® 51142D-5™ Designation: Genomic DNA from Cyanothece sp. strain BH68 TypeStrain=False Application:
In the Himmerfjärden Bay a large excess of nitrogen over phosphorus in the discharge from a large sewage treatment plant (STP) has suppressed growth of diazotrophic cyanobacteria in its inner parts. Implementation of nitrogen removal in the STP in 1997 drastically reduced nitrogen load and triggered growth of diazotrophs, mainly Aphanizomenon sp. This study is part of a long-term series of experiments with the overall aim to test how algal biomass and production in a receiving area can be reduced, without stimulating nitrogen fixation and biomass growth by diazotrophic cyanobacteria. Nitrogen removal was discontinued in the STP during two years (2007-8) and resumed in 2009, and the discharge shifted from 25 to 10 m depth, above the seasonal pycnocline. Cellular 15N showed that N2 was the most important N source for diazotrophic cyanobacteria, and that uptake of combined nitrogen was insignificant. As biomass was declining and at the end of the productive season, we could detect a small, but ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
Homologous recombination (HR) is essential for the accurate repair of DNA double-strand breaks (DSBs), potentially lethal lesions. HR takes place in the late S-G2 phase of the cell cycle and involves the generation of a single-stranded region of DNA, followed by strand invasion, formation of a Holliday junction, DNA synthesis using the intact strand as a template, branch migration and resolution. It is investigated that RecA/Rad51 family proteins play a central role. The breast cancer susceptibility protein Brca2 and the RecQ helicase BLM (Bloom syndrome mutated) are tumor suppressors that maintain genome integrity, at least in part, through HR ...
Résumé: The Mediterranean Sea is one of the most oligotrophic marine areas on earth where nitrogen fixation has formally believed to play an important role in carbon and nitrogen fluxes. Although this view is under debate, the diazotrophs responsible for this activity have still not been investigated in the open sea. In this study, we characterised the surface distribution and species richness of unicellular and filamentous diazotrophs across the Mediterranean Sea by combining microscopic counts with size fractionated in situ hybridization (TSA-FISH), and 16S rDNA and nifH genes phylogenies. These genetic analyses were possible owing to the development of a new PCR protocol adapted to scarce microorganisms that can detect as few as 1 cell ml(-1) in cultures. Low concentrations of diazotrophic cyanobacteria were detected and this community was dominated at 99.9% by picoplankton hybridized to the Nitro821 probe, specific for unicellular diazotrophic cyanobacteria (UCYN). Among filamentous ...
Cyanothece 51142 may be new to science, but cyanobacteria, the group of organisms to which it belongs, have existed for at least 2.5 billion years, says Pakrasi, PhD, the George William and Irene Koechig Freiberg professor of biology in Arts & Sciences, and professor of energy in the School of Engineering. These ancient organisms have had to survive a wide variety of chemical environments and have the metabolic tricks to show for it.. All cyanobacteria have the ability to fix carbon from the atmosphere, stuffing it away in starch or glycogen, but Cyanothece is among the rarer strains that can also fix nitrogen, converting atmospheric nitrogen to ammonia and eventually to larger nitrogen-rich molecules.. Because it can fix both carbon and nitrogen, when conditions warrant Cyanothece can survive on air, water and sunlight alone. It is about as self-reliant an organism as it is possible to be.. There is one catch. Nitrogenase is very sensitive to oxygen and so carbon fixing (photosynthesis), which ...
In an important step toward engineering bacteria to produce biofuel, PNNL, UW-Madison, and Burnham Institute scientists developed a global model for the photosynthetic cyanobacterium Cyanothece.
Nutrient regulation of alkaline phosphatase (phosphomonoesterase - PMEase) was studied in some diazotrophic cyanobacterial strains like Anabaena variabilis, Anabaena torulosa, Calothrix brevissima, Scytonema javanicum and Hapalosiphon intricatus, in
Cyanobacteria are photosynthetic prokaryotes characterized by an unusually high metabolic versatility, therefore representing a promising source for biofuels and high value bioproducts with a wide range of commercial applications. However, the enormous potential of cyanobacteria for carbon sequestration technologies and end-product development remains far more unexplored than that of green microalgae. Here we present the first results of the research project "Bioremediation of methane from mine ventilation air" jointly funded by the Advanced Manufacturing Cooperative Research Centres (AMCRC) and MBD Energy Ltd, Australia, which aims to remediate CH4 and CO2 emissions from a coal mine using a dual bioreactor system of methanotrophic bacteria and cyanobacteria. Strain selection was based on a culture collection of native cyanobacteria from tropical freshwaters and soils in Queensland, NE Australia, comprising at least 5 different genera whose phylogeny and biochemical profiles (lipid and ...
Profile cyanobacteria Genome-scale transcript and protein profiling suggest a new hypothesis on the metabolic relationship between oxygenic photosynthesis and nitrogenase-mediated hydrogen production in the ubiquitous oceanic cyanobacterium blue-green alga, Cyanothece 51142 pointing the way to a previously unknown source of hydrogen that could be...
APARATOARE FATA CADRU CUBE RFR O aparatoare inovatoare cu prindere rapida care se monteaza pe cadrul bicicletei. Caracteristici: - Compatibila cu roti 26, 27.5, 28, 29 - Pr ...
SET APARATORI NOROI RFR MUDGUARD JUNIOR KLICK&GO Caracteristici: Usor de montat fara unelte Compatibila cu biciclete cu roti de 20 si 22 Construite din plastic de inalta calitate ...
On Sun, 29 Oct 2006 16:24:59 -0200 Gunther Furtado ,[email protected], wrote: , Bem, é isso mesmo, o arquivo pot que traduzi trata do uso do software e , fica dentro do diretório /gnubiff-2.2.3/po/ do arquivo fonte , gnubiff_2.2.3.orig.tar.gz. , , De qualquer forma, grato pela ajuda. Peço desculpes se causei algum , transtorno. Transtorno algum! [] -- Herbert Parentes Fortes Neto (hpfn) Linux user number 416100 Debian GNU/kFreeBSD (qemu) 0x9834F79E -- http://pgp.mit.edu/ ...
Researchers have known that the organism Cyanothece 51142 makes hydrogen by drawing upon sugars it stores during growth. In this study, PNNL researchers found it also draws on a second, unexpected source of energy, using sunlight and water directly to make hydrogen.
Parazzini M, Galloni P, Piscitelli M, Pinto R et al. (2007): The authors have previously reported studies on the effect of RFR on the auditory system of animals. In this study they compared the effect of RFR exposure with that of gentamicin. Four groups of rats were used, with 8 in each group. Group 1 was treated with daily intramuscular injections of 150 mg/kg body weight for 15 days. Group 2 was similar but also exposed to RFR. Group 3 was exposed only to RFR. Group 4 was sham-exposed. The RFR exposure was for 2 h/day, 5 days a week, for 4 weeks at a frequency of 900 MHz and a SAR of 4 W/kg.. Distortion product otoacoustic emissions tests were carried out before, during and after the combined exposure. There was no effect of the RFR exposure on the inner auditory system of the animals, either in normal ears or in those damaged by gentamicin.. ...
Researchers have examined the effects of RFR on the autonomic nervous system, as measured by its impact on the cardiovascular system. Mann, Roschke and colleagues (1998) did not find any effect on heart rate in young men exposed to 900 MHz. Braune (1998) found a slight increase in resting blood pressure after 35 minutes exposure to RFR at 900 MHz. However, when the authors repeated this study using randomization of the sequence of exposure, they found that EMF exposure had no effect on any of the outcomes, including blood pressure (Braune, 2002). Tahvanainen (2004) also found that exposure to RFR at 900 or 1800 MHz had no effect on either blood pressure or heart rate. Chang Nam (2006) did not find any cardiovascular changes in teenagers or adults after RFR exposure from a CDMA phone. They did find decreased skin resistance in the teenage group and in the males of the study. However, they did not randomize the sequence of the RFR and sham exposures. The sham exposure was done first in all ...
Organisms like cyanobacteria made life on the planet possible by producing the oxygen for our atmosphere 2.3 billion years ago. They also convert the abundant nitrogen in our atmosphere to a form that is essential for all plant life on the planet.. "If we want to understand life on Earth, and how to improve it, this is a great place to start," said first author Hans Bernstein, a Linus Pauling distinguished postdoctoral fellow at PNNL. Bernstein and Beliaev are co-authors on the paper.. Many of these organisms are equipped with an enzyme called nitrogenase to convert inert atmospheric nitrogen to more usable forms for plants and other organisms. For a long time, scientists have known that nitrogenase produces small quantities of molecular hydrogen as a byproduct. When nitrogen is not available, the organism produces hydrogen. Its this attribute of the enzyme that scientists like Bernstein and Beliaev focus on.. The team set up Cyanothece 51142 in a bioreactor, limited the supply of nitrogen, and ...
...Researchers at Washington University in St. Louis have gained the firs...In general this study shows that during the day Cyanothece increases...The findings have implications down the road for energy production and...The study was published in the April online issue of the Proceedings o...,Single-celled,bacterium,works,24-7,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
Radiation exposure has long been a concern for the public, policy makers, and health researchers. Beginning with radar during World War II, human exposure to radio-frequency radiation (RFR) technologies has grown substantially over time. In 2011, the International Agency for Research on Cancer (IARC) reviewed the published literature and categorized RFR as a "possible" (Group 2B) human carcinogen. A broad range of adverse human health effects associated with RFR have been reported since the IARC review. In addition, three large-scale carcinogenicity studies in rodents exposed to levels of RFR that mimic lifetime human exposures have shown significantly increased rates of Schwannomas and malignant gliomas, as well as chromosomal DNA damage. Of particular concern are the effects of RFR exposure on the developing brain in children. Compared with an adult male, a cell phone held against the head of a child exposes deeper brain structures to greater radiation doses per unit volume, and the young, ...
Pentapeptide repeats are a class of proteins characterized by the presence of multiple repeating sequences five amino acids in length. The sequences fold into a right-handed β-helix with a roughly squ
CP000529.PE96 Location/Qualifiers FT CDS_pept complement(105043..105465) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Pnap_0098" FT /product="UspA domain protein" FT /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA" FT /db_xref="EnsemblGenomes-Gn:Pnap_0098" FT /db_xref="EnsemblGenomes-Tr:ABM35423" FT /db_xref="InterPro:IPR006015" FT /db_xref="InterPro:IPR006016" FT /db_xref="InterPro:IPR014729" FT /db_xref="UniProtKB/TrEMBL:A1VIE5" FT /protein_id="ABM35423.1" FT /translation="MKILLAVDGSSYTKKMLAYLVTHDALFDAKNEYAVLTVQPALPPH FT ARAAVGKEIVDSYYAEETGKVMAPVAEFLKHHGIIAKSDWKVGPAGETIAKFADEGKFD FT LLIMGSHGHGALGNLIMGSVTTQVLAHSKVPVLLVR" atgaagattc ttctggccgt tgacggcagc agctacacca aaaaaatgct ggcctacctg 60 gtcacgcatg acgcgctgtt tgatgccaag aatgagtacg ccgttctcac ggtgcagccc 120 gccttgcctc cacacgcacg cgcggccgtg ggcaaggaaa tcgtggacag ctattacgcc 180 gaggaaaccg gcaaggtcat ggcgccggtg gccgaattcc tcaagcacca cggcatcatt 240 gccaaaagcg actggaaggt gggtccggcc ggcgaaacca ttgccaaatt tgccgacgag 300 ggcaagttcg ...
The diazotrophic communities play an important role in sustaining primary productivity through adding new nitrogen to oligotrophic marine ecosystems. Yet, their composition in the oligotrophic Indian Ocean is poorly understood. Here, we report the first observation of phylogenetic diversity and distribution of diazotrophs in the Eastern Indian Ocean (EIO) surface water (to 200 m) during the pre-southwest monsoon period. Through high throughput sequencing of nifH genes, we identified diverse groups of diazotrophs in the EIO including both non-cyanobacterial and cyanobacterial phylotypes. Proteobacteria (mainly Alpha-, Beta-, and Gamma-proteobacteria) were the most diverse and abundant groups within all the diazotrophs, which accounted for more than 86.9% of the total sequences. Cyanobacteria were also retrieved, and they were dominated by the filamentous non-heterocystous cyanobacteria Trichodesmium spp. Other cyanobacteria such as unicellular diazotrophic cyanobacteria were detected ...
The diazotrophic cyanobacterium, Trichodesmium, is an integral component of the marine nitrogen cycle and contributes significant amounts of new nitrogen to oligotrophic, tropical/subtropical ocean surface waters. Trichodesmium forms macroscopic, fusiform (tufts), spherical (puffs) and raft-like colonies that provide a pseudobenthic habitat for a host of other organisms including marine invertebrates, microeukaryotes and numerous other microbes. The diversity and activity of denitrifying bacteria found in association with the colonies was interrogated using a series of molecular-based methodologies targeting the gene encoding the terminal step in the denitrification pathway, nitrous oxide reductase (nosZ). Trichodesmium spp. sampled from geographically isolated ocean provinces (the Atlantic Ocean, the Red Sea and the Indian Ocean) were shown to harbor highly similar, taxonomically related communities of denitrifiers whose members are affiliated with the Roseobacter clade within the ...
levels and temperature rise globally, scientists increasingly want to know which organisms will thrive and which will perish in the environment of tomorrow.. The answer to this question for nitrogen-fixing cyanobacteria (bacteria that obtain energy through photosynthesis, or "blue-green algae") turns out to have implications for every living thing in the ocean. Nitrogen-fixing is when certain special organisms like cyanobacteria convert inert - and therefore unusable - nitrogen gas from the air into a reactive form that the majority of other living beings need to survive. Without nitrogen fixers, life in the ocean could not survive for long.. "Our findings show that CO2 has the potential to control the biodiversity of these keystone organisms in ocean biology, and our fossil fuel emissions are probably responsible for changing the types of nitrogen fixers that are growing in the ocean," said David Hutchins, professor of marine environmental biology at the USC Dornsife College of Letters, Arts ...
...Marine scientists long believed that a microbe called Trichodesmium...New research results reported on-line today in a paper in Science Trichodesmium...Different nitrogen-fixing cyanobacteria scientists have discovered h...,More,than,1:,Long-reigning,microbe,controlling,ocean,nitrogen,shares,the,throne,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
SOME DESCRIPTIVE TITLE. # Copyright (C) YEAR THE PACKAGES COPYRIGHT HOLDER # This file is distributed under the same license as the movim package. # FIRST AUTHOR ,[email protected],, YEAR. # msgid msgstr Project-Id-Version: movim\n Report-Msgid-Bugs-To: [email protected]\n POT-Creation-Date: 2019-10-16 08:06-0400\n PO-Revision-Date: 2019-10-16 08:13-0400\n Language-Team: \n MIME-Version: 1.0\n Content-Type: text/plain; charset=UTF-8\n Content-Transfer-Encoding: 8bit\n X-Generator: Poedit 2.2.4\n Last-Translator: Jorge Neto ,[email protected],\n Plural-Forms: nplurals=2; plural=(n , 1);\n Language: pt_BR\n #. Type: string #. Description #: ../movim.templates:1001 msgid Admin username: msgstr Nome de usuário do administrador: #. Type: string #. Description #. Type: password #. Description #: ../movim.templates:1001 ../movim.templates:2001 msgid Movim has an administration tool to configure various settings, which is protected by an admin user and ...
Beginning on GD 5, groups of 56 time-mated F0 female rats were housed in specially designed reverberation chambers and received whole-body exposures to CDMA-modulated cell phone RFR at power levels of 0 (sham control), 1.5, 3, or 6 W/kg for 7 days per week, continuing throughout gestation and lactation. Exposure was up to 18 hours and 20 minutes per day with continuous cycling of 10 minutes on and 10 minutes off during the exposure periods. There were seven exposure groups per sex, including a shared sham control and three exposure groups for each modulation. At weaning, three males and three females per litter from 35 litters were randomly selected per exposure group for continuation. Weaning occurred on the day the last litter reached PND 21, marking the beginning of the 2-year studies. Groups of 105 male and 105 female F1 offspring continued to receive whole-body exposures to CDMA-modulated cell phone RFR at the same power levels and under the same exposure paradigm, 7 days per week for up to ...
Search for abbreviations and long forms in lifescience, results along with the related PubMed / MEDLINE information and co-occurring abbreviations.
RFR Holding bought a block of 30-plus rent-regulated apartments from the Cheshire Groups condo conversion of the Devonshire House for $32.5 million.
During photosynthesis, photosystem II generates oxygen by splitting water molecules. Because oxygen inhibits nitrogen fixation, most nitrogen-fixing cyanobacteria only fix nitrogen at night, or do it in specialized cells. The lack of photosystem II enables the new microbe to fix nitrogen during the day, Zehr said. But without photosynthesis, it cant take carbon dioxide from the atmosphere and convert it into sugars. So its not clear how the new microbe feeds itself. Either it has some way of feeding on organic matter in its environment, or it lives in close association with other organisms that provide it with food, Zehr said.. "It would make a perfect symbiont because it could feed nitrogen to its host and live on the carbon provided by the host," he said. Zehrs team was able to obtain a mostly pure sample of these unique cyanobacteria using a flow cytometer--a device that rapidly sorts individual cells based on size and color. The flow cytometer can take the cell soup from an ocean sample, ...
There exist a great number of studies showing the negative effects of non-native EMF. As usual, the cell phone industry has led the way in burying this evidence under fallacious claims of safety and labeling whistle-blowers and truth-tellers as wackos.. Just standard operating procedure to keep the cash flow uninterrupted. Where have we seen this before?. "Radiofrequency radiation (RFR), e.g. electromagnetic waves emitted by our cell phones and Wi-Fi, are referred to as non-ionizing. This means that in contrast to the ionizing radiation, which does induce ionization of water and biologically important macromolecules, RFR does not have a capacity for such effects. Unlike, for example X-rays, the energy of RFR is not enough to break electrons off the molecules. However, is RFR completely safe for public health? Traditionally, the industry and the public bodies said yes. Nevertheless, new research data change this perception.. "Oxidative stress is an induced imbalance between pro-oxidant and ...
View auction details, art exhibitions and online catalogues; bid, buy and collect contemporary, impressionist or modern art, old masters, jewellery, wine, watches, prints, rugs and books at sothebys auction house
We are scientists engaged in the study of biological and health effects of non-ionizing electromagnetic fields (EMF). Based upon peer-reviewed, published research, we have serious concerns regarding the ubiquitous and increasing exposure to EMF generated by electric and wireless devices. These include-but are not limited to-radiofrequency radiation (RFR) emitting devices, such as cellular and cordless…
Komárek J, Kaštovský J, Mareš J, Johansen JR (2014). "Taxonomic classification of cyanoprokaryotes (cyanobacterial genera) 2014, using a polyphasic approach" (PDF). Preslia. 86: 295-335 ...
Radiofrequency radiation (RFR), e.g. electromagnetic waves emitted by our cell phones and Wi-Fi, are referred to as non-ionizing. This means that in contrast to the ionizing radiation, which does induce ionization of water and biologically important macromolecules, RFR does not have a capacity for such effects. Unlike, for example X-rays, the energy of RFR is not enough to break electrons off the molecules. However, is RFR completely safe for public health? Traditionally, the.... Key words: Cancer; Electrohypersensitivity; Oxidative stress; Radiofrequency radiation ...
Drudge links to an interesting news report on a recent study which demonstrates slowed reaction times from cell phone radiation. The report is a little bit misleading, in that the actual paper does not say people were having a conversation while tested for reaction times and memory recall; they were only being exposed to the cellphone (a Nokia 6110) radiation. The dosage was eqivalent to a 30 minute phone call. This part was cool (from the paper -- not the news report.): Interestingly, Huber et al., 2002 and Huber et al., 2005 observed an increase in relative regional cerebral blood flow (rCBF) in the dorsolateral prefrontal cortex ipsilateral to 30 min pulse modulated RFR from a 900 MHz DMP. Such a finding implicates that blood flow changes caused by RFR may underlie some of the cognitive changes that have been observed with DMP RFR, given that the prefrontal cortex plays a major role in working memory.. The paper passes muster to my scientific reading of it; its not guilty of a selection bias ...
Author Summary Cyanobacteria have been promoted as platforms for biofuel production due to their useful physiological properties such as photosynthesis, relatively rapid growth rates, ability to accumulate high amounts of intracellular compounds and tolerance to extreme environments. However, development of a computational model is an important step to synthesize biochemical, physiological and regulatory understanding of photoautotrophic metabolism (either qualitatively or quantitatively) at a systems level, to make metabolic engineering of these organisms tractable. When integrated with other genome-scale data (e.g., expression data), numerical simulations can provide experimentally testable predictions of carbon fluxes and reductant partitioning to different biosynthetic pathways and macromolecular synthesis. This work is the first to computationally explore the interactions between components of photosynthetic and respiratory systems in detail. In silico predictions obtained from model analysis
Darden/IH only obtained a (manufacture/sell) license for about 55% of the world energy market.(With the option of "RFR"). If Rossi wanted to sell the license for the other 45% or any part there of, Darden inc could match any offer plus (10% if I recall correctly) and obtain the additional territories.. I see nothing in the contract to prevent Rossi from starting his own operations, but also dont see that as a show stopper for Darden. Rossi would likely abide by the implied no compete of the contract being an original signing member to the contract.. However, I believe Darden inc got a rude awakening while shopping around investors into IH. China singly tendered an offer of $200 Million dollars for a non controlling interest in IH for an as yet unproven technology. Do you think this is of no significance. Then why did Darden/IH make serious note of it in documents. Surprise-They were caught off guard.. NO Corporation can compete financially against major Governments such as the Saudis, India, ...
I have had continuous light to moderately heavy vaginal bleeding for 3 months. I went to get a pap smear and my doctor said I had blood in my cervix but didnt go into further details on why I would have blood in my cervix. I have not bee
Message-Id: Date: 15 Apr 1996 16:14:21 -0700 From: "Jason T Vincent" ,[email protected], To: "[email protected]" ,[email protected], (Return requested) Subject: Form based Uploads Hey All :) I have the document rfr1867.txt that gives the proposal for form-based file upload in HTML: (using MIME to send files, instead of attaching to email messages). I heard that there was a site that had implemented this. Dose anybody know of this web site? Thanks Jason V. PS thanks for the replies to my previous message. Date: Mon, 15 Apr 1996 16:11:59 -0500 (EST) From: Foteos Macrides ,[email protected], Subject: Re: mailto: + parameters? To: [email protected] Cc: [email protected] Message-Id: ,[email protected], Abigail ,[email protected], wrote: ,You, Michele Bassan wrote: ,++ ,++ My question is probably marginal to html, but I did not find a thread about ,++ it elsewhere. ,++ Do you know whether it is possible to pass to the "mailto:" method also some ,++ parameters, ...
In another experiment, we studied the effect of RFR exposure on reference memory (long-term memory) [Wang and Lai, 2000]. Performance in a water maze was investigated. In this test, a rat is required to locate a submerged platform in a circular water pool. It is released into the pool, and the time taken for it to land on the platform is recorded. Rats were trained in several sessions to learn the location of the platform. The learning rate of RFR-exposed rats was slower, but, after several learning trials, they finally caught up with the control (unexposed) rats (found the platform as fast). However, the story did not end here. After the rats had learned to locate the platform, in a last session, the platform was removed and rats were released one at a time into the pool. We observed that unexposed rats, after being released into the pool, would swim around circling the area where the platform was once located, whereas RFR-exposed rats showed more random swimming patterns. To understand this, ...
Mánudaginn 9. september varði Vigdís Stefánsdóttir doktorsritgerð sína í líf- og læknavísindum við Læknadeild Háskóla Íslands. Ritgerðin ber heitið: Notkun rafrænna gagnagrunna í krabbameinserfðaráðgjöf. Electronic Genealogy and Cancer Databases in Cancer Genetic Counselling.. Andmælendur voru dr. Alison Metcalfe, prófessor við Sheffield Hallam University í Englandi, og dr. Ástríður Pálsdóttir, rannsóknarprófessor emerita.. Umsjónarkennari og leiðbeinandi voru dr. Jón Jóhannes Jónsson, prófessor við Læknadeild, og dr. Heather Skirton, prófessor emerita. Auk þeirra sátu í doktorsnefnd dr. Hrafn Tulinius prófessor, dr. Laufey Tryggvadóttir, klínískur prófessor, og dr. Óskar Þór Jóhannsson, sérfræðingur.. Engilbert Sigurðsson, prófessor og forseti Læknadeildar, stjórnaði athöfninni sem fór fram í Hátíðasal Háskóla Íslands kl. 10:00 - 14:00.. Ágrip af rannsókn. Meginmarkmið rannsóknarinnar var að kanna notkun rafrænna ...
Komárek J. & Komárková J. 2010: Lyngbya-další rod sinic vyvolávající vodní květy v tropických ekosystémech; příčiny výskytu, ekologický dopad, možnost likvidace. (Lyngbya - another cyanobacterial genus producing water blooms in tropical ecosystems, causes occurence, ecological impact, the possibility of liquidation.) In: Maršálek B., Maršálková E., Vinklárková D. (eds.) Cyanobakterie 2010 - příčiny, důsledky a řešení rozvoje vodních květů sinic, BÚ AV ČR, 169 - ...
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
CONICET Digital, el repositorio institucional del CONICET, un servicio gratuito para acceder a la producción científico-tecnológica de investigadores, becarios y demás personal del CONICET.
Two unicellular cyanobacteria Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942 showed contrasting responses to chromate stress with EC50 of 12 ± 2 and 150 ± 15 μM potassium dichromate respectively. There was no depletion of chromate in growth medium in both the cases. Using labeled chromate, very low accumulation (,1 nmol/108 cells) was observed in Synechocystis after incubation for 24 h in light. No accumulation of chromate could be observed in Synechococcus under these conditions. Chromate oxyanion is known to enter the cells using sulfate uptake channels. Therefore, inhibition of sulfate uptake caused by chromate was monitored using 35S labeled sulfate. IC50 values of chromate for 35sulfate uptake were higher in Synechococcus as compared to Synechocystis. The results suggested that the sulfate transporters in Synechococcus have lower affinity to chromate than those from Synechocystis possibly due to differences in affinity of sulfate receptors for chromate. Bioinformatic ...
National Institute of Environmental Health Sciences (NIEHS) High exposure to radiofrequency radiation (RFR) in rodents resulted in tumors in tissues surrounding nerves in the hearts of male rats, but not female rats or any mice, according to draft studies from the National Toxicology Program (NTP). The exposure levels used in the studies were equal to and higher than the highest level permitted for local tissue exposure in cell phone emissions today. Cell phones typically emit lower levels of RFR than the maximum level allowed. NTPs draft conclusions were released today as two technical reports, one for rat studies and one for mouse studies. NTP will hold an external expert review of its complete findings from these rodent studies March 26-28.. ...
CP001791.PE313 Location/Qualifiers FT CDS 334440..335279 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Bsel_0325" FT /product="binding-protein-dependent transport systems inner FT membrane component" FT /note="PFAM: binding-protein-dependent transport systems FT inner membrane component; KEGG: rfr:Rfer_1101 FT binding-protein-dependent transport systems inner membrane FT component" FT /db_xref="EnsemblGenomes-Gn:Bsel_0325" FT /db_xref="EnsemblGenomes-Tr:ADH97865" FT /db_xref="GOA:D6XWM3" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR035906" FT /db_xref="UniProtKB/TrEMBL:D6XWM3" FT /inference="protein motif:PFAM:PF00528" FT /protein_id="ADH97865.1" FT /translation="MKSEKQKTLISKILLYIGLSIVSLASLFPFYWMFVMATNSNEMIN FT RTPPVMVPGDRLVDNFQNVLNSIPFFQTMLNSLIAATSITLGVLLLTSIAGFAFAKLEF FT PARNILFFFILGTMMIPPQLGLIPTYFIITELGWLSDLRAVIVPGLMNAFGIFWMRQYV FT ASAVPDEIIEAARIDGCSNFRIYWNIVVPVILPAFATLGIIVFMFVWGDYLWPLVVLQD FT QSSQTIQVALRSLMDDRSRDYGMILSGTFWATVPLVVVFLFFNKLFIRSIADGAVKS" MKSEKQKTLI SKILLYIGLS ...
... manufacturers and isoxepac suppliers Directory - Find isoxepac Manufacturers, Exporters and isoxepac suppliers on ECVERY.com
Amoebae are unicellular eukaryotes that consume microbial prey through phagocytosis, playing a role in shaping microbial food webs. Many amoebal species can be cultivated axenically in rich media or monoxenically with a single bacterial prey species. Here, we characterize heterolobosean amoeba LPG3, a recent natural isolate, which is unable to grow on unicellular cyanobacteria, its primary food source, in the absence of a heterotrophic bacterium, a Pseudomonas species coisolate. To investigate the molecular basis of this requirement for heterotrophic bacteria, we performed a screen using the defined nonredundant transposon library of Vibrio cholerae, which implicated genes in corrinoid uptake and biosynthesis. Furthermore, cobalamin synthase deletion mutations in V. cholerae and the Pseudomonas species coisolate do not support the growth of amoeba LPG3 on cyanobacteria. While cyanobacteria are robust producers of a corrinoid variant called pseudocobalamin, this variant does not support the ...
Ingestion of the unicellular cyanobacterium Synechococcus by the mixotrophic red tide ciliate Mesodinium rubrum - grazing impact;ingestion;Mesodinium;mixotrophy;Synechococcus;
In Episode 129 of The Real Food Reel we are joined by Professor Gregor Reid, scientist at Lawson Health Research Institute and Professor at University of Western Ontario. Professor Reid specialises in beneficial microbes, and to date, has developed novel probiotic therapies used by several million people around the world. Today we discuss beneficial bacteria and their impact on immunity and reproduction, and probiotics and prebiotics for optimal health.. Show Notes: ...
An intuitive and clear description of various solar based hydrogen production systems Deals explicitly and comprehensively with efficiencies of solar
Tritium emits a continuous light source when not using batteries or electricity in low or no light conditions. Front post is centered between two tritium points of reference to allow for proper alignment and sight orientation in low-light conditions. Sight is designed to work on same plane rail systems only. Will not work with a railed gas block that is higher or lower than the receiver. Fits the SR-556 , SR-762 , SR-22 , and AR style of rifle with Picatinny rails on it. Made in the U.S.A. by Troy Industries ...
... from Cyanothece sp. CCY 0110 as biosorbent for heavy metals bioremediation: interactions between metals and RPS binding sites ...
ISBN 0-521-30419-9. Class Cyanophyceae Order Chroococcales (e.g., Cyanothece, Aphanothece, Merismopedia, Chroococcus, ...
Diazotrophic Cyanobacterium Cyanothece sp. ATCC 51142". Plant Physiology. 115 (3): 991-1000. doi:10.1104/pp.115.3.991. ISSN ... "Oscillating behavior of carbohydrate granule formation and dinitrogen fixation in the cyanobacterium Cyanothece sp. strain ATCC ... aerobic nitrogen-fixing cyanobacteria of the genus Cyanothece". Journal of Bacteriology. 175 (5): 1284-1292. ISSN 0021-9193. ...
... the highly significant Trichodesmium and Cyanothece), as well as green sulfur bacteria, Azotobacteraceae, rhizobia and Frankia ...
Cyanothece MeSH B03.440.475.100.210 --- Cylindrospermopsis MeSH B03.440.475.100.500 --- Microcystis MeSH B03.440.475.100.550 ...
Cyanothece ATCC 51142 is an important diazotrophic model organism. The smallest genomes have been found in Prochlorococcus spp ...
While Synechococcus species are usually cylindrical, Cyanothece species are normally oval and longer than 3 μm., Cyanothece's ... an exception is Cyanothece sp. PCC 7822 in which gene knock-outs can be generated. Cyanothece species are normally oval and ... Cyanothece has been found in a variety of environments all over the world. One point in common is that the pH is usually lower ... Cyanothece has the genes for the use of a variety of sugar molecules; although glycerol is the only one that has been used ...
Cyanothece ATCC 51442, which is a diazotroph. Thus, it has been proposed that Synechocystis originally possessed the ability to ... "Novel Metabolic Attributes of the Genus Cyanothece, Comprising a Group of Unicellular Nitrogen-Fixing Cyanobacteria". mBio. 2 ( ... major lineages of domain Bacteria Biofertilizer Biofuel Cyanobacteria Cyanobacterial RNA thermometer Cyanobiont Cyanothece ...
... crystal structure of Rfr23 from Cyanothece 51142". J. Struct. Biol. 162 (1): 184-92. doi:10.1016/j.jsb.2007.11.008. PMID ... crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142". Protein Sci. 15 (11): 2579-95. doi:10.1110/ ...
Lin R-F, and Huang, T-C (2009) Circadian rhythm of Cyanothece RF-1 (Synechococcus RF-1). Chapter 3 in: Bacterial Circadian ...
The uptake hydrogenase in the unicellular diazotrophic cyanobacterium Cyanothece sp. Within the framework of a prospective ...
Low temperature delays timing and enhances the cost of nitrogen fixation in the unicellular cyanobacterium Cyanothece. In ...
Cyanothece sp. PCC 7425, complete genome. Triose-phosphate isomerase. 3e-31. 135. ...
Mota, R., Pereira, S. B., Meazzini, M., Fernandes, R., et al. (2015). Effects of heavy metals on Cyanothece sp. CCY 0110 growth ... Mota, R., Pereira, S. B., Meazzini, M., Fernandes, R., et al. (2015). Differential proteomes of the cyanobacterium Cyanothece ... Production and characterization of extracellular carbohydrate polymer from Cyanothece sp. CCY 0110. Carbohydrate Polymers, 92(2 ...
Cyanothece sp. PCC 7425, complete genome. GCN5-related N-acetyltransferase. 4e-06. 50.8. ...
Cyanothece_sp_ATCC_51142′:0.088208,Microcystis_aeruginosa_NIES_843′:0.108904):0.018975,Synechocystis_sp_PCC_6803′:0.111161): ...
Cyanothece Cyanothece Cyanothece Cylindrospermopsis Cylindrospermopsis Cylindrospermopsis Escherichia coli K12 Escherichia coli ...
Analysis of Protein Complexes in the Unicellular Cyanobacterium Cyanothece ATCC 51142. Aryal, Uma K; Ding, Ziyun; Hedrick, ... The unicellular cyanobacterium Cyanothece ATCC 51142 is capable of oxygenic photosynthesis and biological N2 fixation (BNF), a ... Bacterial Proteins/chemistry , Cyanothece/chemistry , Multiprotein Complexes/chemistry , Phycocyanin/metabolism , Protein ... Cyanothece/metabolism , Glycolysis/physiology , Mass Spectrometry , Multiprotein Complexes/metabolism , Nitrogen/metabolism , ...
Mota, R., Rossi, F., Andrenelli, L., Pereira, S. B., et al. (2016). Released polysaccharides (RPS) from Cyanothece sp. CCY 0110 ... Production and characterization of extracellular carbohydrate polymer from Cyanothece sp. CCY 0110. Carbohydrate Polymers, 92(2 ...
Cyanothece sp. ATCC 51142 .................................................. 166 2 hits {cyanobacteria} acetyl-CoA carboxylase ... Cyanothece sp. CCY 0110 .................................................... 166 2 hits {cyanobacteria} acetyl-CoA carboxylase ... Cyanothece sp. PCC 7424 .................................................... 167 2 hits {cyanobacteria} acetyl-CoA carboxylase ... Cyanothece sp. PCC 7425 .................................................... 158 2 hits {cyanobacteria} acetyl-CoA carboxylase ...
studies sent used by Tal Galili, with Cyanothece to the chapter education. q2w dose; 2018 R-bloggers. Econometricsby ...
Cyanothece sp. PCC 7424 Bacteria n/a normal 1 -. NC_008312 Tery_4315 saccharopine dehydrogenase 25.33 ...
Cyanothece/enzimologia. Cyanothece/crescimento & desenvolvimento. Glioxilatos/metabolismo. Processos Heterotr ficos/gen tica. ... Here, we report that the gene PCC7424_4054 of the strain Cyanothece sp. PCC 7424 encodes an enzymatically active protein that ... Genes coding for isocitrate lyase (ICL) and malate synthase were recently identified in two strains of the genus Cyanothece, ... We hypothesize that the glyoxylate shunt in Cyanothece sp. PCC 7424, and possibly other nitrogen-fixing cyanobacteria, is an ...
Cyanothece sp. PCC 7425 Bacteria normal 1 normal 1 -. NC_008312 Tery_4782 TPR repeat-containing serine/threonin protein kinase ... Cyanothece sp. PCC 7424 Bacteria n/a hitchhiker 0.00000131061 -. NC_011894 Mnod_2480 peptidase C14 caspase catalytic subunit ... Cyanothece sp. PCC 7425 Bacteria normal 0.204203 normal 0.945333 -. NC_011894 Mnod_7349 peptidase C14 caspase catalytic subunit ...
Composition of the carbohydrate granules of the cyanobacterium, Cyanothece sp. It is concluded that the intravascular ...
CP000806_1668(CP000806,pid:none) Cyanothece sp. ATCC 51142 circu... 239 3e-61. AM920437_1668(AM920437,pid:none) Penicillium ... CP001291_3451(CP001291,pid:none) Cyanothece sp. PCC 7424, comple... 229 3e-58. AE005673_2352(AE005673,pid:none) Caulobacter ... CP001287_1192(CP001287,pid:none) Cyanothece sp. PCC 8801, comple... 125 4e-27. CP001014_456(CP001014,pid:none) Thermoproteus ...
UP000001203 CYAA5 Cyanothece access. UP000002384 CYAP7 Cyanothece ebook. UP000002511 CYAP4 Cyanothece photo. It is that people ... UP000001203 CYAA5 Cyanothece supply. UP000002384 CYAP7 Cyanothece Chair. UP000002511 CYAP4 Cyanothece ebook Groundwater Arsenic ... UP000002511 CYAP4 Cyanothece paper. UP000008206 CYAP2 Cyanothece &. UP000008204 CYAP8 Cyanothece ebook Groundwater Arsenic. ... UP000008206 CYAP2 Cyanothece hydatidosis. UP000008204 CYAP8 Cyanothece personnage. UP000006282 CYCSP Cycloclasticus ebook ...
Crystal structure of a lipoxygenase from Cyanothece sp. may reveal novel features for substrate acquisition. J. Lipid. Res., 57 ...
Cyanothece sp. ATCC 51142. No. Yes Cyanobacterium stanieri PCC 7202. No. Yes Clostridium saccharoperbutylacetonicum N1-4(HMT). ...
... ikiiLPKEkrfsenvqkfafQFTwtQNITTELD 138 Cyanothece ... BAG05000 119 --------------------------------lifsenfldeqfkngfadyINLSkknidn ... nfyqslsdkLRLNSEKQNF 168 Cyanothece ... BAG05000 165 Yqylskllnn----------------------------------------------------lfeneqedLLFII ... rgqafyeinqqgTYIQETPENA 178 Cyanothece ... BAK15701 153 Gryiysvkgdkdvgy------------------------------------------cempnlipsaiicKG ... VLTKHINKFFGNDQAPIFIPaarsllsflkltnlnfdsfninildqgfIGMTEIIKPEFQNDLREIIDIIKGNK 244 Cyanothece ... BAG05000 193 TV----TYSDLFEKYLFASI ...
CYANOTHECE SP. ATCC 51142. OC Bacteria; Cyanobacteria; Chroococcales; Cyanothece. OX NCBI_TaxID=43989; RN [0] RP -.; RG -.; RL ... CC Cyanothece sp. ATCC 51142 plasmid A, complete sequence. CC 1..36860 annotated by Ensembl Genomes CC -!- ANNOTATIONS ORIGIN: ...
Cyanothece sp. CCY0110 EAZ91823.1 - Putative pre-16S rRNA nuclease; Could be a nuclease involved in processing of the 5-end of ... Cyanothece sp. PCC7425 ACL44415.1 - PFAM: HEAT domain containing protein; PBS lyase HEAT domain protein repeat-containing ...
Cyanothece PCC 7424, Nostoc punctiforme, and Anabaena variabilis, the rbcX gene is located between the rbcL and rbcS genes to ...
Cyanothece/citologia , Cyanothece/metabolismo , Espaço Extracelular/metabolismo , Polissacarídeos Bacterianos/biossíntese , ... Proteínas de Bactérias/metabolismo , Cyanothece/fisiologia , Cyanothece/ultraestrutura , Metais Pesados/farmacologia , Proteoma ... In this work, Cyanothece sp. CCY 0110 was used as model organism. Our results revealed that this strain is among the most ... Considering that Cyanothece is a highly efficient RPS-producer and that RPS can be easily separated from the culture, ...
... the colony forming Trichodesmium IMS101 and the unicellular strains Cyanothece ATCC51142, Crocosphaera watsonii WH8501 and ... the colony forming Trichodesmium IMS101 and the unicellular strains Cyanothece ATCC51142, Crocosphaera watsonii WH8501 and ... Cyanothece sp. ATCC51142 (hereafter referred to as Cyanothece), isolated in an intertidal marsh (Reddy et al., 1993), and two ... Figure 1. Evolution of the in vivo Chl a fluorescence (in relative fluorescence units) in Trichodesmium IMS101, Cyanothece ...
  • Pakrasi led the sequencing of Cyanothece 54112 as the focus of a Department of Energy "grand challenge project" that resulted in the sequencing and annotation of a cyanobacterium gene that could yield clues to how environmental conditions influence key carbon fixation processes at the gene-mRNA-protein levels in an organism. (blogspot.com)
  • Interestingly, the iron-containing CspLOX2 (EC 1.13.11.B6) from Cyanothece PCC8801 also produces bis-allylic hydroperoxides. (mpg.de)
  • To probe the consequences of modifying the cycle of glycogen accumulation and subsequent mobilization, we engineered a strain of Cyanothece 51142 in which the glgX gene was genetically disrupted. (asm.org)
  • Here, we report that the gene PCC7424_4054 of the strain Cyanothece sp. (microbiologyresearch.org)
  • To see the effect of day-night cycles on the overall physiology of Cyanothece, lead author Jana Stckel, Ph.D., Washington University post-doctoral researcher, and other members of this research team examined the expression of 5,000 genes, measuring the amount of messenger RNA for each gene in alternating dark and light periods over 48 hours. (bio-medicine.org)
  • Overall, Cyanothece 51142 carries one large circular chromosome and four small chromosomes called plasmids, and the linear one. (phys.org)
  • Though the team is experimenting with several genetically modified algae, their research will focus primarily on three types of algae - Cyanothece sp. (oilgae.com)
  • Because it can fix both carbon and nitrogen, when conditions warrant Cyanothece can survive on air, water and sunlight alone. (innovations-report.com)
  • So Cyanothece fixes carbon glycogen molecules during the day, producing oxygen as a byproduct, and it fixes nitrogen in ammonia during the night, producing hydrogen as a byproduct. (innovations-report.com)
  • 8. A photobioreactor is used to make Cyanothece convert available sunlight into thick mats of green biomass, from which liquid ethanol can be extracted. (oilgae.com)
  • At Washington University, Pakrasi and his collaborators have designed a photobioreactor to watch Cyanothece convert available sunlight into thick mats of green biomass, from which liquid ethanol can be extracted. (blogspot.com)
  • Cyanothece also makes ethanol and hydrogen, activities that drew the attention of the DOE and others looking for new ways to make fuel. (phys.org)
  • The rate of oxygen created by photosystem II is much higher when Cyanothece does not fix nitrogen (when the medium is nitrogen-replete). (wikipedia.org)
  • RL13_CYAP4 50S ribosomal protein L13 OS=Cyanothece sp. (uniprot.org)
  • Specifically, Pakrasi and his collaborators are focusing on the amazing cyanobacterium Cyanothece, a one-celled marine cyanobacterium, which is a bacterium with a well-defined circadian rhythm, or biological clock. (psychcentral.com)
  • To unravel the mystery, Pakrasi and his collaborators are growing Cyanothece cells in photobioreactors, testing cells every hour to try to understand the cycles at different times of the day. (psychcentral.com)
  • They used a novel custom-built photobioreactor at PNNL to test the predicted changes in growth rates of Cyanothece 51142 in response to changes in light input. (pnnl.gov)
  • A novel photobioreactor has been designed for mass balance analysis of Cyanothece cells during circadian cycles, and atomic structures for five proteins involved in sequestering such key nutrients as iron, nitrate and bicarbonate have been determined through X-ray crystallography. (psychcentral.com)
  • More strangely, entrained Cyanothece incubated under continuous light evolve more hydrogen than those cycling between light and dark. (innovations-report.com)
  • Beliaev added, 'Developing a computational model brings us closer to a systems-level understanding of the metabolism of photoautrophs such as Cyanothece , putting metabolic engineering of these organisms within reach. (pnnl.gov)
  • During nitrogen-fixing conditions, Cyanothece creates inclusion storage bodies under the control of a circadian rhythm. (wikipedia.org)
  • Just as a prisoner kept in solitary confinement will maintain a roughly 24-hour sleep/wake cycle, Cyanothece will continue to fix nitrogen even if it is incubated under continuous light. (innovations-report.com)
  • Both viruses also encode a distinct DNA polymerase B that is closely related to those found in plasmids of Cyanothece sp. (ntu.edu.sg)
  • Production and characterization of extracellular carbohydrate polymer from Cyanothece sp. (up.pt)
  • As a single-celled bacterium, however, Cyanothece cannot separate these antagonistic processes in space. (bio-medicine.org)
  • The reactor instrument couples on-line gas monitoring and feedback-controlled lighting to obtain high-resolution physiological details of the relationship between photosynthetic O 2 evolution and H 2 production in Cyanothece 51142. (pnnl.gov)
  • Detection of concomitant production of both H2 and O2 by N-deprived Cyanothece 51142 cultures in the light. (pnl.gov)
  • The PNNL team grew cultures of Cyanothece sp. (pnl.gov)
  • The team set up Cyanothece 51142 in a bioreactor, limited the supply of nitrogen, and kept the lights on 24 hours a day for several weeks. (pnnl.gov)
  • With this in mind, the team set up Cyanothece 51142 in a bioreactor, limited the supply of nitrogen, and illuminated the vessel 24 hours a day for several weeks. (spectroscopynow.com)
  • The team isolated an unstudied Cyanothece strain of chlorite dismutase and examined the protein's crystal structure at specific pH values to determine the impact of pH on chlorite conversion. (phys.org)
  • Chi Z, Su CD, Lu WD (2007) A new exopolysaccharide produced by marine Cyanothece sp. (springer.com)
  • Optimisation of nutrient factors and the effect of some simple stresses on the ability of Cyanothece epiphytica to produce EPS were tested. (ccamp.res.in)
  • Cyanothece 51142 has completely different lifestyles in the day and the night. (pnnl.gov)
  • Model predictions of Cyanothece 51142 growth rate and electron transport pathways at different photon uptake rates through PS II and PS I. (pnnl.gov)