A form-genus of unicellular coccoid to rod-shaped CYANOBACTERIA, in the order Chroococcales. Three different clusters of strains from diverse habitats are included.
The process in certain BACTERIA; FUNGI; and CYANOBACTERIA converting free atmospheric NITROGEN to biologically usable forms of nitrogen, such as AMMONIA; NITRATES; and amino compounds.
A phylum of oxygenic photosynthetic bacteria comprised of unicellular to multicellular bacteria possessing CHLOROPHYLL a and carrying out oxygenic PHOTOSYNTHESIS. Cyanobacteria are the only known organisms capable of fixing both CARBON DIOXIDE (in the presence of light) and NITROGEN. Cell morphology can include nitrogen-fixing heterocysts and/or resting cells called akinetes. Formerly called blue-green algae, cyanobacteria were traditionally treated as ALGAE.
A modification of the freeze-drying method in which the ice within the frozen tissue is replaced by alcohol or other solvent at a very low temperature.
An enzyme system that catalyzes the fixing of nitrogen in soil bacteria and blue-green algae (CYANOBACTERIA). EC 1.18.6.1.
The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide using energy obtained from light rather than from the oxidation of chemical compounds. Photosynthesis comprises two separate processes: the light reactions and the dark reactions. In higher plants; GREEN ALGAE; and CYANOBACTERIA; NADPH and ATP formed by the light reactions drive the dark reactions which result in the fixation of carbon dioxide. (from Oxford Dictionary of Biochemistry and Molecular Biology, 2001)
The processes by which organisms utilize organic substances as their nutrient sources. Contrasts with AUTOTROPHIC PROCESSES which make use of simple inorganic substances as the nutrient supply source. Heterotrophs can be either chemoheterotrophs (or chemoorganotrophs) which also require organic substances such as glucose for their primary metabolic energy requirements, or photoheterotrophs (or photoorganotrophs) which derive their primary energy requirements from light. Depending on environmental conditions some organisms can switch between different nutritional modes (AUTOTROPHY; heterotrophy; chemotrophy; or PHOTOTROPHY) to utilize different sources to meet their nutrients and energy requirements.
Processes by which phototrophic organisms use sunlight as their primary energy source. Contrasts with chemotrophic processes which do not depend on light and function in deriving energy from exogenous chemical sources. Photoautotrophy (or photolithotrophy) is the ability to use sunlight as energy to fix inorganic nutrients to be used for other organic requirements. Photoautotrophs include all GREEN PLANTS; GREEN ALGAE; CYANOBACTERIA; and green and PURPLE SULFUR BACTERIA. Photoheterotrophs or photoorganotrophs require a supply of organic nutrients for their organic requirements but use sunlight as their primary energy source; examples include certain PURPLE NONSULFUR BACTERIA. Depending on environmental conditions some organisms can switch between different nutritional modes (AUTOTROPHY; HETEROTROPHY; chemotrophy; or phototrophy) to utilize different sources to meet their nutrients and energy requirements.
The first chemical element in the periodic table. It has the atomic symbol H, atomic number 1, and atomic weight [1.00784; 1.00811]. It exists, under normal conditions, as a colorless, odorless, tasteless, diatomic gas. Hydrogen ions are PROTONS. Besides the common H1 isotope, hydrogen exists as the stable isotope DEUTERIUM and the unstable, radioactive isotope TRITIUM.
That portion of the electromagnetic spectrum in the visible, ultraviolet, and infrared range.
Proteins found in any species of bacterium.
The phosphoprotein encoded by the BRCA1 gene (GENE, BRCA1). In normal cells the BRCA1 protein is localized in the nucleus, whereas in the majority of breast cancer cell lines and in malignant pleural effusions from breast cancer patients, it is localized mainly in the cytoplasm. (Science 1995;270(5237):713,789-91)
A large, nuclear protein, encoded by the BRCA2 gene (GENE, BRCA2). Mutations in this gene predispose humans to breast and ovarian cancer. The BRCA2 protein is an essential component of DNA repair pathways, suppressing the formation of gross chromosomal rearrangements. (from Genes Dev. 2000;14(11):1400-6)
Production of new arrangements of DNA by various mechanisms such as assortment and segregation, CROSSING OVER; GENE CONVERSION; GENETIC TRANSFORMATION; GENETIC CONJUGATION; GENETIC TRANSDUCTION; or mixed infection of viruses.
A nucleocytoplasmic transport protein that binds to ALPHA KARYOPHERINS and RAN GTP BINDING PROTEIN inside the CELL NUCLEUS and participates in their export into CYTOPLASM. It is also associated with the regulation of APOPTOSIS and microtubule assembly.
An autosomal recessive disorder characterized by telangiectatic ERYTHEMA of the face, photosensitivity, DWARFISM and other abnormalities, and a predisposition toward developing cancer. The Bloom syndrome gene (BLM) encodes a RecQ-like DNA helicase.
A Rec A recombinase found in eukaryotes. Rad51 is involved in DNA REPAIR of double-strand breaks.
A nonmetallic element with atomic symbol C, atomic number 6, and atomic weight [12.0096; 12.0116]. It may occur as several different allotropes including DIAMOND; CHARCOAL; and GRAPHITE; and as SOOT from incompletely burned fuel.
Hydrocarbon-rich byproducts from the non-fossilized BIOMASS that are combusted to generate energy as opposed to fossilized hydrocarbon deposits (FOSSIL FUELS).
Computer-based representation of physical systems and phenomena such as chemical processes.
Methods and techniques used to genetically modify cells' biosynthetic product output and develop conditions for growing the cells as BIOREACTORS.
The study of microorganisms living in a variety of environments (air, soil, water, etc.) and their pathogenic relationship to other organisms including man.
Messages between computer users via COMPUTER COMMUNICATION NETWORKS. This feature duplicates most of the features of paper mail, such as forwarding, multiple copies, and attachments of images and other file types, but with a speed advantage. The term also refers to an individual message sent in this way.
A single chain of deoxyribonucleotides that occurs in some bacteria and viruses. It usually exists as a covalently closed circle.
Change brought about to an organisms genetic composition by unidirectional transfer (TRANSFECTION; TRANSDUCTION, GENETIC; CONJUGATION, GENETIC, etc.) and incorporation of foreign DNA into prokaryotic or eukaryotic cells by recombination of part or all of that DNA into the cell's genome.
The heritable modification of the properties of a competent bacterium by naked DNA from another source. The uptake of naked DNA is a naturally occuring phenomenon in some bacteria. It is often used as a GENE TRANSFER TECHNIQUE.
The regular recurrence, in cycles of about 24 hours, of biological processes or activities, such as sensitivity to drugs and stimuli, hormone secretion, sleeping, and feeding.
The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The formation of crystalline substances from solutions or melts. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
The scattering of x-rays by matter, especially crystals, with accompanying variation in intensity due to interference effects. Analysis of the crystal structure of materials is performed by passing x-rays through them and registering the diffraction image of the rays (CRYSTALLOGRAPHY, X-RAY). (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
An enzyme that catalyzes the conversion of D-fructose 1,6-bisphosphate and water to D-fructose 6-phosphate and orthophosphate. EC 3.1.3.11.
Procedures carried out with regard to the teeth or tooth structures preparatory to specified dental therapeutic and surgical measures.
Complex sets of enzymatic reactions connected to each other via their product and substrate metabolites.
A species of gram-positive bacteria in the family Clostridiaceae, used for the industrial production of SOLVENTS.
A species of gram-positive bacteria in the family Clostridiaceae, capable of solventogenesis, and isolated from SOIL, infected WOUNDS, fermenting OLIVES, and spoiled CANDY.
The state of weariness following a period of exertion, mental or physical, characterized by a decreased capacity for work and reduced efficiency to respond to stimuli.
Databases containing information about PROTEINS such as AMINO ACID SEQUENCE; PROTEIN CONFORMATION; and other properties.
A process that includes the determination of AMINO ACID SEQUENCE of a protein (or peptide, oligopeptide or peptide fragment) and the information analysis of the sequence.
The procedures involved in combining separately developed modules, components, or subsystems so that they work together as a complete system. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
The protein complement of an organism coded for by its genome.
Linear POLYPEPTIDES that are synthesized on RIBOSOMES and may be further modified, crosslinked, cleaved, or assembled into complex proteins with several subunits. The specific sequence of AMINO ACIDS determines the shape the polypeptide will take, during PROTEIN FOLDING, and the function of the protein.
A non-heme iron-sulfur protein isolated from Clostridium pasteurianum and other bacteria. It is a component of NITROGENASE along with molybdoferredoxin and is active in nitrogen fixation.
A species of the genus SACCHAROMYCES, family Saccharomycetaceae, order Saccharomycetales, known as "baker's" or "brewer's" yeast. The dried form is used as a dietary supplement.
A group of proteins possessing only the iron-sulfur complex as the prosthetic group. These proteins participate in all major pathways of electron transport: photosynthesis, respiration, hydroxylation and bacterial hydrogen and nitrogen fixation.
A non-heme iron-sulfur protein isolated from Clostridium pasteurianum and other bacteria. It is a component of NITROGENASE, which is active in nitrogen fixation, and consists of two subunits with molecular weights of 59.5 kDa and 50.7 kDa, respectively.
A species of gram-negative, aerobic bacteria first isolated from soil in Vineland, New Jersey. Ammonium and nitrate are used as nitrogen sources by this bacterium. It is distinguished from other members of its genus by the ability to use rhamnose as a carbon source. (From Bergey's Manual of Determinative Bacteriology, 9th ed)
A genus of gram-negative, rod-shaped bacteria in the family PHYLLOBACTERIACEAE. They are able to invade root-hairs of a wide range of plants, inciting the production of PLANT ROOT NODULES.
7-carbon saturated monocarboxylic acids.
A genus of gram-negative, aerobic, nonsporeforming rods which usually contain granules of poly-beta-hydroxybutyrate. (From Bergey's Manual of Determinative Bacteriology, 9th ed)
Sequential operating programs and data which instruct the functioning of a digital computer.
The genetic complement of a BACTERIA as represented in its DNA.

Characterization of two potentially universal turn motifs that shape the repeated five-residues fold--crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142. (1/27)

The genome of the diurnal cyanobacterium Cyanothece sp. PCC 51142 has recently been sequenced and observed to contain 35 pentapeptide repeat proteins (PRPs). These proteins, while present throughout the prokaryotic and eukaryotic kingdoms, are most abundant in cyanobacteria. The sheer number of PRPs in cyanobacteria coupled with their predicted location in every cellular compartment argues for important, yet unknown, physiological and biochemical functions. To gain biochemical insights, the crystal structure for Rfr32, a 167-residue PRP with an N-terminal 29-residue signal peptide, was determined at 2.1 A resolution. The structure is dominated by 21 tandem pentapeptide repeats that fold into a right-handed quadrilateral beta-helix, or Rfr-fold, as observed for the tandem pentapeptide repeats in the only other PRP structure, the mycobacterial fluoroquinoline resistance protein MfpA from Mycobacterium tuberculosis. Sitting on top of the Rfr-fold are two short, antiparallel alpha-helices, bridged with a disulfide bond, that perhaps prevent edge-to-edge aggregation at the C terminus. Analysis of the main-chain (Phi,Psi) dihedral orientations for the pentapeptide repeats in Rfr32 and MfpA makes it possible to recognize the structural details for the two distinct types of four-residue turns adopted by the pentapeptide repeats in the Rfr-fold. These turns, labeled type II and type IV beta-turns, may be universal motifs that shape the Rfr-fold in all PRPs.  (+info)

Cloning, expression, crystallization and preliminary crystallographic analysis of a pentapeptide-repeat protein (Rfr23) from the bacterium Cyanothece 51142. (2/27)

A unique feature of cyanobacteria genomes is the abundance of genes that code for hypothetical proteins containing tandem pentapeptide repeats approximately described by the consensus motif A(N/D)LXX. To date, the structures of two pentapeptide-repeat proteins (PRPs) have been determined, with the tandem pentapeptide-repeat sequences observed to adopt a novel type of right-handed quadrilateral beta-helix, or Rfr-fold, in both structures. One structure, Mycobacterium tuberculosis MfpA, is a 183-residue protein that contains 30 consecutive pentapeptide repeats and appears to offer antibiotic resistance by acting as a DNA mimic. The other structure, Cyanothece 51142 Rfr32, is a 167-residue protein that contains 21 consecutive pentapeptide repeats. The function of Rfr32, like the other 35 hypothetical PRPs identified in the genome of Cyanothece, is unknown. In an effort to understand the role of PRPs in cyanobacteria and to better characterize the structural properties of Rfr-folds with different amino-acid sequences, a second PRP from Cyanothece 51142, Rfr23, has been cloned, expressed and purified. Selenomethione-substituted protein was crystallized by vapor diffusion in hanging drops. Nearly complete SAD and native diffraction data sets were collected from these crystals to 2.5 and 2.1 A resolution, respectively, using synchrotron radiation. The crystals belonged to space group I4(1), with unit-cell parameters a = b = 106.61, c = 53.37 A, and one molecule per asymmetric unit. Preliminary analysis of the electron-density map from the SAD data shows that Rfr23 contains an Rfr-fold.  (+info)

The cyanobacterial endosymbiont of the unicellular algae Rhopalodia gibba shows reductive genome evolution. (3/27)

 (+info)

Differential transcriptional analysis of the cyanobacterium Cyanothece sp. strain ATCC 51142 during light-dark and continuous-light growth. (4/27)

 (+info)

Global transcriptomic analysis of Cyanothece 51142 reveals robust diurnal oscillation of central metabolic processes. (5/27)

 (+info)

The genome of Cyanothece 51142, a unicellular diazotrophic cyanobacterium important in the marine nitrogen cycle. (6/27)

 (+info)

Structural characterization of the protein cce_0567 from Cyanothece 51142, a metalloprotein associated with nitrogen fixation in the DUF683 family. (7/27)

 (+info)

Effect of continuous light on diurnal rhythms in Cyanothece sp. ATCC 51142. (8/27)

 (+info)

Mono- and Stereopictres of 5.0 Angstrom coordination sphere of Arsenic atom in PDB 2o6w: Crystal Structure of A Pentapeptide Repeat Protein (RFR23) From the Cyanobacterium Cyanothece 51142
Cyanothece sp. ATCC ® 51142D-5™ Designation: Genomic DNA from Cyanothece sp. strain BH68 TypeStrain=False Application:
Cyanothece sp. ATCC ® 51142D-5™ Designation: Genomic DNA from Cyanothece sp. strain BH68 TypeStrain=False Application:
Cyanothece sp. PCC 7822 is an excellent cyanobacterial model organism with great potential to be applied as a biocatalyst for the production of high value compounds. Like other unicellular diazotrophic cyanobacterial species, it has a tightly regulated metabolism synchronized to the light-dark cycle. Utilizing transcriptomic and proteomic methods, we quantified the relationships between transcription and translation underlying central and secondary metabolism in response to nitrogen free, 12 hour light and 12 hour dark conditions. By combining mass-spectrometry based proteomics and RNA-sequencing transcriptomics, we quantitatively measured a total of 6766 mRNAs and 1322 proteins at four time points across a 24 hour light-dark cycle. Photosynthesis, nitrogen fixation, and carbon storage relevant genes were expressed during the preceding light or dark period, concurrent with measured nitrogenase activity in the late light period. We describe many instances of disparity in peak mRNA and protein abundances,
Cyanothece sp. PCC 7822 is an excellent cyanobacterial model organism with great potential to be applied as a biocatalyst for the production of high value compounds. Like other unicellular diazotrophic cyanobacterial species, it has a tightly regulated metabolism synchronized to the light-dark cycle. Utilizing transcriptomic and proteomic methods, we quantified the relationships between transcription and translation underlying central and secondary metabolism in response to nitrogen free, 12 hour light and 12 hour dark conditions. By combining mass-spectrometry based proteomics and RNA-sequencing transcriptomics, we quantitatively measured a total of 6766 mRNAs and 1322 proteins at four time points across a 24 hour light-dark cycle. Photosynthesis, nitrogen fixation, and carbon storage relevant genes were expressed during the preceding light or dark period, concurrent with measured nitrogenase activity in the late light period. We describe many instances of disparity in peak mRNA and protein abundances,
In the Himmerfjärden Bay a large excess of nitrogen over phosphorus in the discharge from a large sewage treatment plant (STP) has suppressed growth of diazotrophic cyanobacteria in its inner parts. Implementation of nitrogen removal in the STP in 1997 drastically reduced nitrogen load and triggered growth of diazotrophs, mainly Aphanizomenon sp. This study is part of a long-term series of experiments with the overall aim to test how algal biomass and production in a receiving area can be reduced, without stimulating nitrogen fixation and biomass growth by diazotrophic cyanobacteria. Nitrogen removal was discontinued in the STP during two years (2007-8) and resumed in 2009, and the discharge shifted from 25 to 10 m depth, above the seasonal pycnocline. Cellular 15N showed that N2 was the most important N source for diazotrophic cyanobacteria, and that uptake of combined nitrogen was insignificant. As biomass was declining and at the end of the productive season, we could detect a small, but ...
General Information: Cyanothece sp. PCC 7425 was isolated from a rice field in Senegal. Unlike some other Cyanothece strains, Cyanothece 7425 appears to be an obligate autotroph. Cyanothece may prove very important in biological hydrogen production, as it is missing the uptake hydrogenase enzyme. ...
General Information: Cyanothece sp. ATCC 51142 was isolated from intertidal sands from the Gulf of Mexico in Texas. The marine diazotrophic strain, Cyanothece sp. ATCC 51142, has a robust diurnal cycle in which photosynthesis is performed during the day and nitrogen fixation at night. ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
Homologous recombination (HR) is essential for the accurate repair of DNA double-strand breaks (DSBs), potentially lethal lesions. HR takes place in the late S-G2 phase of the cell cycle and involves the generation of a single-stranded region of DNA, followed by strand invasion, formation of a Holliday junction, DNA synthesis using the intact strand as a template, branch migration and resolution. It is investigated that RecA/Rad51 family proteins play a central role. The breast cancer susceptibility protein Brca2 and the RecQ helicase BLM (Bloom syndrome mutated) are tumor suppressors that maintain genome integrity, at least in part, through HR ...
Résumé: The Mediterranean Sea is one of the most oligotrophic marine areas on earth where nitrogen fixation has formally believed to play an important role in carbon and nitrogen fluxes. Although this view is under debate, the diazotrophs responsible for this activity have still not been investigated in the open sea. In this study, we characterised the surface distribution and species richness of unicellular and filamentous diazotrophs across the Mediterranean Sea by combining microscopic counts with size fractionated in situ hybridization (TSA-FISH), and 16S rDNA and nifH genes phylogenies. These genetic analyses were possible owing to the development of a new PCR protocol adapted to scarce microorganisms that can detect as few as 1 cell ml(-1) in cultures. Low concentrations of diazotrophic cyanobacteria were detected and this community was dominated at 99.9% by picoplankton hybridized to the Nitro821 probe, specific for unicellular diazotrophic cyanobacteria (UCYN). Among filamentous ...
Cyanothece 51142 may be new to science, but cyanobacteria, the group of organisms to which it belongs, have existed for at least 2.5 billion years, says Pakrasi, PhD, the George William and Irene Koechig Freiberg professor of biology in Arts & Sciences, and professor of energy in the School of Engineering. These ancient organisms have had to survive a wide variety of chemical environments and have the metabolic tricks to show for it.. All cyanobacteria have the ability to fix carbon from the atmosphere, stuffing it away in starch or glycogen, but Cyanothece is among the rarer strains that can also fix nitrogen, converting atmospheric nitrogen to ammonia and eventually to larger nitrogen-rich molecules.. Because it can fix both carbon and nitrogen, when conditions warrant Cyanothece can survive on air, water and sunlight alone. It is about as self-reliant an organism as it is possible to be.. There is one catch. Nitrogenase is very sensitive to oxygen and so carbon fixing (photosynthesis), which ...
In an important step toward engineering bacteria to produce biofuel, PNNL, UW-Madison, and Burnham Institute scientists developed a global model for the photosynthetic cyanobacterium Cyanothece.
Nutrient regulation of alkaline phosphatase (phosphomonoesterase - PMEase) was studied in some diazotrophic cyanobacterial strains like Anabaena variabilis, Anabaena torulosa, Calothrix brevissima, Scytonema javanicum and Hapalosiphon intricatus, in
Cyanobacteria are photosynthetic prokaryotes characterized by an unusually high metabolic versatility, therefore representing a promising source for biofuels and high value bioproducts with a wide range of commercial applications. However, the enormous potential of cyanobacteria for carbon sequestration technologies and end-product development remains far more unexplored than that of green microalgae. Here we present the first results of the research project Bioremediation of methane from mine ventilation air jointly funded by the Advanced Manufacturing Cooperative Research Centres (AMCRC) and MBD Energy Ltd, Australia, which aims to remediate CH4 and CO2 emissions from a coal mine using a dual bioreactor system of methanotrophic bacteria and cyanobacteria. Strain selection was based on a culture collection of native cyanobacteria from tropical freshwaters and soils in Queensland, NE Australia, comprising at least 5 different genera whose phylogeny and biochemical profiles (lipid and ...
Thank you for sharing this Applied and Environmental Microbiology article.. NOTE: We request your email address only to inform the recipient that it was you who recommended this article, and that it is not junk mail. We do not retain these email addresses.. ...
Profile cyanobacteria Genome-scale transcript and protein profiling suggest a new hypothesis on the metabolic relationship between oxygenic photosynthesis and nitrogenase-mediated hydrogen production in the ubiquitous oceanic cyanobacterium blue-green alga, Cyanothece 51142 pointing the way to a previously unknown source of hydrogen that could be...
APARATOARE FATA CADRU CUBE RFR O aparatoare inovatoare cu prindere rapida care se monteaza pe cadrul bicicletei. Caracteristici: - Compatibila cu roti 26, 27.5, 28, 29 - Pr ...
Lakkr s getur veri l fsh ttulegur segir Helga g sta Sigurj nsd ttir innkirtlas rfr ingur Vandam li er a lakkr s er settur svo margar matv rur
SET APARATORI NOROI RFR MUDGUARD JUNIOR KLICK&GO Caracteristici: Usor de montat fara unelte Compatibila cu biciclete cu roti de 20 si 22 Construite din plastic de inalta calitate ...
On Sun, 29 Oct 2006 16:24:59 -0200 Gunther Furtado ,[email protected], wrote: , Bem, é isso mesmo, o arquivo pot que traduzi trata do uso do software e , fica dentro do diretório /gnubiff-2.2.3/po/ do arquivo fonte , gnubiff_2.2.3.orig.tar.gz. , , De qualquer forma, grato pela ajuda. Peço desculpes se causei algum , transtorno. Transtorno algum! [] -- Herbert Parentes Fortes Neto (hpfn) Linux user number 416100 Debian GNU/kFreeBSD (qemu) 0x9834F79E -- http://pgp.mit.edu/ ...
2006/1/6, Felipe Augusto van de Wiel (faw) ,[email protected],: OK. -- Paulo Marcondes PU2PIX/PU1 Debian GNU/Linux = http://rj.debianbrasil.org ...
N₂ fixation adds bioavailable nitrogen to the global oceans and therewith drives modern-day marine primary productivity. The diazotrophs mainly responsible for the fixation of nitrogen are principally found in the cyanobacterial lineage with unicellular and filamentous non-heterocystous species dominating. There is evidence that diazotrophic cyanobacteria were of similar importance in ... read more the past nitrogen cycling, in particular during the formation of organic-rich deposits of the Phanerozoic (e.g. Pleistocene Mediterranean sapropels and Cretaceous black shales). However, the poor preservation potential and the lack of suitable geochemical tracers that are specific for N₂-fixing cyanobacteria have hampered their rigorous identification in the geological record. This thesis describes investigations aimed at a better understanding of the presence and past distribution of N₂-fixing cyanobacteria and their significance in the past nitrogen cycling. For this, a multiplicity of ...
Researchers have known that the organism Cyanothece 51142 makes hydrogen by drawing upon sugars it stores during growth. In this study, PNNL researchers found it also draws on a second, unexpected source of energy, using sunlight and water directly to make hydrogen.
Parazzini M, Galloni P, Piscitelli M, Pinto R et al. (2007): The authors have previously reported studies on the effect of RFR on the auditory system of animals. In this study they compared the effect of RFR exposure with that of gentamicin. Four groups of rats were used, with 8 in each group. Group 1 was treated with daily intramuscular injections of 150 mg/kg body weight for 15 days. Group 2 was similar but also exposed to RFR. Group 3 was exposed only to RFR. Group 4 was sham-exposed. The RFR exposure was for 2 h/day, 5 days a week, for 4 weeks at a frequency of 900 MHz and a SAR of 4 W/kg.. Distortion product otoacoustic emissions tests were carried out before, during and after the combined exposure. There was no effect of the RFR exposure on the inner auditory system of the animals, either in normal ears or in those damaged by gentamicin.. ...
Researchers have examined the effects of RFR on the autonomic nervous system, as measured by its impact on the cardiovascular system. Mann, Roschke and colleagues (1998) did not find any effect on heart rate in young men exposed to 900 MHz. Braune (1998) found a slight increase in resting blood pressure after 35 minutes exposure to RFR at 900 MHz. However, when the authors repeated this study using randomization of the sequence of exposure, they found that EMF exposure had no effect on any of the outcomes, including blood pressure (Braune, 2002). Tahvanainen (2004) also found that exposure to RFR at 900 or 1800 MHz had no effect on either blood pressure or heart rate. Chang Nam (2006) did not find any cardiovascular changes in teenagers or adults after RFR exposure from a CDMA phone. They did find decreased skin resistance in the teenage group and in the males of the study. However, they did not randomize the sequence of the RFR and sham exposures. The sham exposure was done first in all ...
吉川 正志 , N. Ohno , M. Seki , H. Ohshima , H. Tanaka , S. Kajita , Y. Hayashi , H. Natsume , H. Takano , I. Saeki , Masayuki YOSHIKAWA , H. van der Meiden … We have investigated detailed plasma structure around the recombination front region (RFR), where volume electron-ion recombination (EIR) strongly occurs in detached plasmas, by using two-dimensional (2D) movable probe system as well as laser Thomson scattering diagnostics. … The 2D distribution of electron density, electron temperature, and plasma potential around the RFR, has been revealed for the first time. … Nuclear Materials and Energy (19), 458-462, 2019-05 IR ...
chains in the Genus database with same CATH superfamily 3H8O A; 3BKZ A; 3BTY A; 3O1O A; 4NPM A; 5DAB A; 4IE7 A; 3O1P A; 3O1T A; 2FD8 A; 3S57 A; 4ZS2 A; 3H8R A; 3I3M A; 3RZH A; 3T3Y A; 3BI3 A; 4NIH A; 3T4H B; 3T4V A; 4QKF A; 3I2O A; 3LFM A; 4IE0 A; 4NPL A; 3O1U A; 3BUC A; 3S5A A; 4MG2 A; 4NID A; 4CXW A; 3BIE A; 4QKN A; 4RFR B; 3O1M A; 3O1S A; 3RZL A; 2FDI A; 2FDH A; 4JHT A; 2IUW A; 4NRP A; 3I3Q A; 4ZS3 A; 4NJ4 A; 3O1V A; 3KHB A; 3BU0 A; 4NRQ A; 3RZK A; 3RZJ A; 4CXY A; 4O7X A; 4CXX A; 4IE5 A; 4NIG A; 4QKD A; 4NII A; 3KHC A; 4O61 A; 3O1R A; 4OCT A; 5F8P A; 4QHO A; 4NRM A; 4MGT A; 3BTX A; 4ZHN A; 3RZM A; 3H8X A; 3RZG A; 2FDF A; 4IE6 A; 4IE4 A; 2FDK A; 3BTZ A; 2FDJ A; 2FDG A; 4QKB A; 4IDZ A; 4NRO A; 3I49 A; #chains in the Genus database with same CATH topology 1QY4 A; 1CAW A; 2PHU A; 4LR4 A; 3U4X A; 4Y26 A; 5B4N A; 1F5F A; 5FKB A; 5FPB A; 4CEW B; 1JYC A; 1UO9 A; 3CL1 A; 1QEX A; 5J98 B; 3ES1 A; 1HRV 2; 4M0H A; 4WV8 A; 4DY3 A; 3LWC A; 4Q4W 2; 2HYK A; 1JN2 P; 2Y6H A; 4AQT A; 4AEJ A; 3KVA A; 1XE7 A; 3O1V ...
Team WashU_StLouis The production of a bio-fertilizer could benefit the agricultural industry by decreasing the need for energy intensive nitrogen fixation processes. The nif cluster of Cyanothece 51142 consists of 29 genes that construct and regulate a nitrogenase protein complex, which catalyzes the fixation of atmospheric nitrogen. This year, our iGEM team aims to harness the power of nif to produce ammonia in Escherichia coli. After synthesizing a nif- containing plasmid (34 kbp) using the DNA assembler method (Shao et al 2009) and transforming that plasmid into E. coli, our team tested for nitrogenase activity using the acetylene reduction assay. The transformed E. coli were then compared to wild-type under limited nitrogen conditions to check for a competitive advantage. Future tests will evaluate the expression of various nitrogenase subunits, such as nifD and nifK. Our team also aims to further characterize the promoter sequences of the Cyanothece 51142 nif cluster. Between the cysE and ...
Organisms like cyanobacteria made life on the planet possible by producing the oxygen for our atmosphere 2.3 billion years ago. They also convert the abundant nitrogen in our atmosphere to a form that is essential for all plant life on the planet.. If we want to understand life on Earth, and how to improve it, this is a great place to start, said first author Hans Bernstein, a Linus Pauling distinguished postdoctoral fellow at PNNL. Bernstein and Beliaev are co-authors on the paper.. Many of these organisms are equipped with an enzyme called nitrogenase to convert inert atmospheric nitrogen to more usable forms for plants and other organisms. For a long time, scientists have known that nitrogenase produces small quantities of molecular hydrogen as a byproduct. When nitrogen is not available, the organism produces hydrogen. Its this attribute of the enzyme that scientists like Bernstein and Beliaev focus on.. The team set up Cyanothece 51142 in a bioreactor, limited the supply of nitrogen, and ...
...Researchers at Washington University in St. Louis have gained the firs...In general this study shows that during the day Cyanothece increases...The findings have implications down the road for energy production and...The study was published in the April online issue of the Proceedings o...,Single-celled,bacterium,works,24-7,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
Radiation exposure has long been a concern for the public, policy makers, and health researchers. Beginning with radar during World War II, human exposure to radio-frequency radiation (RFR) technologies has grown substantially over time. In 2011, the International Agency for Research on Cancer (IARC) reviewed the published literature and categorized RFR as a possible (Group 2B) human carcinogen. A broad range of adverse human health effects associated with RFR have been reported since the IARC review. In addition, three large-scale carcinogenicity studies in rodents exposed to levels of RFR that mimic lifetime human exposures have shown significantly increased rates of Schwannomas and malignant gliomas, as well as chromosomal DNA damage. Of particular concern are the effects of RFR exposure on the developing brain in children. Compared with an adult male, a cell phone held against the head of a child exposes deeper brain structures to greater radiation doses per unit volume, and the young, ...
Radiation exposure has long been a concern for the public, policy makers, and health researchers. Beginning with radar during World War II, human exposure to radio-frequency radiation (RFR) technologies has grown substantially over time. In 2011, the International Agency for Research on Cancer (IARC) reviewed the published literature and categorized RFR as a possible (Group 2B) human carcinogen. A broad range of adverse human health effects associated with RFR have been reported since the IARC review. In addition, three large-scale carcinogenicity studies in rodents exposed to levels of RFR that mimic lifetime human exposures have shown significantly increased rates of Schwannomas and malignant gliomas, as well as chromosomal DNA damage. Of particular concern are the effects of RFR exposure on the developing brain in children. Compared with an adult male, a cell phone held against the head of a child exposes deeper brain structures to greater radiation doses per unit volume, and the young, ...
Proposed by Project AGI and the Whole Brain Architecture Initiative (What is a Request for Research/RFR?) Summary Overview The brains of all bilaterally
Hørfrøolie Flax Seed Oil of Life 500 ml økologisk ren, koldpresset, skånsomt presset ved lav temperatur. Bør aldrig opvarmes. På køl hos naturoghelse.
Pentapeptide repeats are a class of proteins characterized by the presence of multiple repeating sequences five amino acids in length. The sequences fold into a right-handed β-helix with a roughly squ
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
CP000529.PE96 Location/Qualifiers FT CDS_pept complement(105043..105465) FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Pnap_0098 FT /product=UspA domain protein FT /note=PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA FT /db_xref=EnsemblGenomes-Gn:Pnap_0098 FT /db_xref=EnsemblGenomes-Tr:ABM35423 FT /db_xref=InterPro:IPR006015 FT /db_xref=InterPro:IPR006016 FT /db_xref=InterPro:IPR014729 FT /db_xref=UniProtKB/TrEMBL:A1VIE5 FT /protein_id=ABM35423.1 FT /translation=MKILLAVDGSSYTKKMLAYLVTHDALFDAKNEYAVLTVQPALPPH FT ARAAVGKEIVDSYYAEETGKVMAPVAEFLKHHGIIAKSDWKVGPAGETIAKFADEGKFD FT LLIMGSHGHGALGNLIMGSVTTQVLAHSKVPVLLVR atgaagattc ttctggccgt tgacggcagc agctacacca aaaaaatgct ggcctacctg 60 gtcacgcatg acgcgctgtt tgatgccaag aatgagtacg ccgttctcac ggtgcagccc 120 gccttgcctc cacacgcacg cgcggccgtg ggcaaggaaa tcgtggacag ctattacgcc 180 gaggaaaccg gcaaggtcat ggcgccggtg gccgaattcc tcaagcacca cggcatcatt 240 gccaaaagcg actggaaggt gggtccggcc ggcgaaacca ttgccaaatt tgccgacgag 300 ggcaagttcg ...
Starfsmaður í UT sem greinst hefur með slitgigt í hné hefur getað haldið áfram í starfi þökk sé nokkrum einföldum leiðréttingum. Þannig gat fyrirtækið sem hann starfar hjá haldið sérfræðistarfsmanni sem er fær um að þjálfa aðra.
The diazotrophic communities play an important role in sustaining primary productivity through adding new nitrogen to oligotrophic marine ecosystems. Yet, their composition in the oligotrophic Indian Ocean is poorly understood. Here, we report the first observation of phylogenetic diversity and distribution of diazotrophs in the Eastern Indian Ocean (EIO) surface water (to 200 m) during the pre-southwest monsoon period. Through high throughput sequencing of nifH genes, we identified diverse groups of diazotrophs in the EIO including both non-cyanobacterial and cyanobacterial phylotypes. Proteobacteria (mainly Alpha-, Beta-, and Gamma-proteobacteria) were the most diverse and abundant groups within all the diazotrophs, which accounted for more than 86.9% of the total sequences. Cyanobacteria were also retrieved, and they were dominated by the filamentous non-heterocystous cyanobacteria Trichodesmium spp. Other cyanobacteria such as unicellular diazotrophic cyanobacteria were detected ...
The diazotrophic cyanobacterium, Trichodesmium, is an integral component of the marine nitrogen cycle and contributes significant amounts of new nitrogen to oligotrophic, tropical/subtropical ocean surface waters. Trichodesmium forms macroscopic, fusiform (tufts), spherical (puffs) and raft-like colonies that provide a pseudobenthic habitat for a host of other organisms including marine invertebrates, microeukaryotes and numerous other microbes. The diversity and activity of denitrifying bacteria found in association with the colonies was interrogated using a series of molecular-based methodologies targeting the gene encoding the terminal step in the denitrification pathway, nitrous oxide reductase (nosZ). Trichodesmium spp. sampled from geographically isolated ocean provinces (the Atlantic Ocean, the Red Sea and the Indian Ocean) were shown to harbor highly similar, taxonomically related communities of denitrifiers whose members are affiliated with the Roseobacter clade within the ...
levels and temperature rise globally, scientists increasingly want to know which organisms will thrive and which will perish in the environment of tomorrow.. The answer to this question for nitrogen-fixing cyanobacteria (bacteria that obtain energy through photosynthesis, or blue-green algae) turns out to have implications for every living thing in the ocean. Nitrogen-fixing is when certain special organisms like cyanobacteria convert inert - and therefore unusable - nitrogen gas from the air into a reactive form that the majority of other living beings need to survive. Without nitrogen fixers, life in the ocean could not survive for long.. Our findings show that CO2 has the potential to control the biodiversity of these keystone organisms in ocean biology, and our fossil fuel emissions are probably responsible for changing the types of nitrogen fixers that are growing in the ocean, said David Hutchins, professor of marine environmental biology at the USC Dornsife College of Letters, Arts ...
...Marine scientists long believed that a microbe called Trichodesmium...New research results reported on-line today in a paper in Science Trichodesmium...Different nitrogen-fixing cyanobacteria scientists have discovered h...,More,than,1:,Long-reigning,microbe,controlling,ocean,nitrogen,shares,the,throne,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
As if SB 649 wasnt wreaking enough havoc on the ability for cities to protect their residents, the June 20, 2017 amendments completely deregulate and eliminate all oversight for micro-wireless facilities which can be equipment nearly three feet long dangling between utility poles, raising significant public safety issues such as obstructing traffic sight distance without any oversight. The bill also now applies a utility pole attachment rate formula which is inappropriate for equipment being placed on city buildings, street and traffic lights.. As amended, the bill is no longer limited to just small cells. It now applies broadly to all telecommunications providers and the equipment they use from micro-wireless to small cell to macro-towers. Its clear from the direction of this bill, that this is not about 5G wireless deployment, but more about local deregulation of the entire telecommunications industry. This latest version places a new ban on city/county regulation of placement or ...
Beginning on GD 5, groups of 56 time-mated F0 female rats were housed in specially designed reverberation chambers and received whole-body exposures to CDMA-modulated cell phone RFR at power levels of 0 (sham control), 1.5, 3, or 6 W/kg for 7 days per week, continuing throughout gestation and lactation. Exposure was up to 18 hours and 20 minutes per day with continuous cycling of 10 minutes on and 10 minutes off during the exposure periods. There were seven exposure groups per sex, including a shared sham control and three exposure groups for each modulation. At weaning, three males and three females per litter from 35 litters were randomly selected per exposure group for continuation. Weaning occurred on the day the last litter reached PND 21, marking the beginning of the 2-year studies. Groups of 105 male and 105 female F1 offspring continued to receive whole-body exposures to CDMA-modulated cell phone RFR at the same power levels and under the same exposure paradigm, 7 days per week for up to ...
Search for abbreviations and long forms in lifescience, results along with the related PubMed / MEDLINE information and co-occurring abbreviations.
chains in the Genus database with same CATH superfamily 5EQL A; 3KFQ C; 3MWZ A; 1G96 A; 4N6L A; 1RN7 A; 1CEW I; 5LC7 A; 1LXE A; 4N6M A; 1GD4 A; 3PXM A; 3QRD A; 3S67 A; 1ROA A; 1MOL A; 4N6U A; 5ELJ A; 1IV7 A; 2KXG A; 5A0O B; 1A90 A; 1CYV A; 1N5P A; 1WNH A; 2O9U X; 3PYJ A; 3LH4 A; 4EYC A; 1STF I; 1TIJ A; 1DVC A; 4N6O B; 4CCV A; 2W9Q A; 3IMA B; 4LZI A; 1FUW A; 1FA3 A; 2CH9 A; 4N6V 0; 1N9J A; 3PS8 A; 4ZM8 A; 1R4C A; 5ELU A; 2BO9 B; 3UL6 A; 1EQK A; 4N6N B; 1PFP A; 3NX0 A; 1NB5 I; 3SVA A; 3UL5 A; 1YVB I; 1KWI A; 1M9G A; 1GD3 A; 3GAX A; 1NB3 I; 1IV9 A; 4IT7 A; 1CYU A; 1A67 A; 2OCT A; 1DVD A; 2W9P A; 3L0R A; 3Q2P A; 4TX4 A; 3KSE D; 1N5H A; 1MNL A; 4N6T A; 3K9M C; 5LC6 A; #chains in the Genus database with same CATH topology 1JKG B; 2RSX A; 1Y4K A; 4J5G A; 3VSY A; 3CD6 3; 4JRF A; 2F99 A; 3S67 A; 1X1X A; 2KXG A; 3FLJ A; 2RFR A; 4RZM A; 1FGM A; 1TJD A; 2F98 A; 1V58 A; 3AHS A; 1PY3 A; 1YGW A; 5FGO A; 1ZS7 A; 1I3F A; 1SIH A; 3NHX A; 3LML A; 1QVG 2; 2CWU A; 1KC8 4; 1BNE A; 3PCR A; 5RNT A; 2E2V A; 1FYS A; 3CCU ...
RFR Holding bought a block of 30-plus rent-regulated apartments from the Cheshire Groups condo conversion of the Devonshire House for $32.5 million.
We assessed the influence of the marine diazotrophic cyanobacterium Trichodesmium on the bio-optical properties of western tropical South Pacific (WTSP) waters (18-22 degrees S, 160 degrees E-160 degrees W) during the February-March 2015 OUTPACE cruise. We performed measurements of backscattering and absorption coefficients, irradiance, and radiance in the euphotic zone with a Satlantic MicroPro free-fall profiler and took Underwater Vision Profiler 5 (UPV5) pictures for counting the largest Trichodesmium spp. colonies. Pigment concentrations were determined by fluorimetry and high-performance liquid chromatography and picoplankton abundance by flow cytometry. Trichome concentration was estimated from pigment algorithms and validated by surface visual counts. The abundance of large colonies counted by the UVP5 (maximum 7093 colonies m(-3)) was well correlated to the trichome concentrations (maximum 2093 trichomes L-1) with an aggregation factor of 600. In the Melanesian archipelago, a maximum of ...
During photosynthesis, photosystem II generates oxygen by splitting water molecules. Because oxygen inhibits nitrogen fixation, most nitrogen-fixing cyanobacteria only fix nitrogen at night, or do it in specialized cells. The lack of photosystem II enables the new microbe to fix nitrogen during the day, Zehr said. But without photosynthesis, it cant take carbon dioxide from the atmosphere and convert it into sugars. So its not clear how the new microbe feeds itself. Either it has some way of feeding on organic matter in its environment, or it lives in close association with other organisms that provide it with food, Zehr said.. It would make a perfect symbiont because it could feed nitrogen to its host and live on the carbon provided by the host, he said. Zehrs team was able to obtain a mostly pure sample of these unique cyanobacteria using a flow cytometer--a device that rapidly sorts individual cells based on size and color. The flow cytometer can take the cell soup from an ocean sample, ...
... from Cyanothece sp. CCY 0110 as biosorbent for heavy metals bioremediation: interactions between metals and RPS binding sites ...
Cyanothece ATCC 51142 is an important diazotrophic model organism. The smallest genomes have been found in Prochlorococcus spp ... The cyanobacteria Synechocystis and Cyanothece are important model organisms with potential applications in biotechnology for ...
Diazotrophic Cyanobacterium Cyanothece sp. ATCC 51142". Plant Physiology. 115 (3): 991-1000. doi:10.1104/pp.115.3.991. ISSN ... aerobic nitrogen-fixing cyanobacteria of the genus Cyanothece". Journal of Bacteriology. 175 (5): 1284-1292. doi:10.1128/jb. ... "Oscillating behavior of carbohydrate granule formation and dinitrogen fixation in the cyanobacterium Cyanothece sp. strain ATCC ...
ISBN 0-521-30419-9. Class Cyanophyceae Order Chroococcales (e.g., Cyanothece, Aphanothece, Merismopedia, Chroococcus, ...
In comparison with related species such as Crocosphaera watsonii and Cyanothece sp., which employ genomes which range in length ...
4 October 2011). "Novel metabolic attributes of the genus cyanothece, comprising a group of unicellular nitrogen-fixing ... Cyanothece ATCC 51442, which is a diazotroph. Thus, it has been proposed that Synechocystis originally possessed the ability to ... Cyanothece". mBio. 2 (5): e00214-11-e00214-11. doi:10.1128/mBio.00214-11. PMC 3187577. PMID 21972240. Turner S, Huang TC, Chaw ... major lineages of domain Bacteria Biofertilizer Biofuel Cyanobacteria Cyanobacterial RNA thermometer Cyanobiont Cyanothece ...
... crystal structure of Rfr23 from Cyanothece 51142". J. Struct. Biol. 162 (1): 184-92. doi:10.1016/j.jsb.2007.11.008. PMID ... crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142". Protein Sci. 15 (11): 2579-95. doi:10.1110/ ...
Lin R-F, and Huang, T-C (2009) Circadian rhythm of Cyanothece RF-1 (Synechococcus RF-1). Chapter 3 in: Bacterial Circadian ...
... the highly significant Trichodesmium and Cyanothece), as well as green sulfur bacteria, Azotobacteraceae, rhizobia and Frankia ...
... such as Trichodesmium and Cyanothece, are major contributors to oceanic nitrogen fixation. Anoxygenic photosynthetic bacteria ...
Cyanothece MeSH B03.440.475.100.210 - Cylindrospermopsis MeSH B03.440.475.100.500 - Microcystis MeSH B03.440.475.100.550 - ...
While Synechococcus species are usually cylindrical, Cyanothece species are normally oval and longer than 3 μm., Cyanothece's ... an exception is Cyanothece sp. PCC 7822 in which gene knock-outs can be generated. Cyanothece species are normally oval and ... Cyanothece has been found in a variety of environments all over the world. One point in common is that the pH is usually lower ... Cyanothece has the genes for the use of a variety of sugar molecules; although glycerol is the only one that has been used ...
ATCC ® 51142D-5™ Designation: Genomic DNA from Cyanothece sp. strain BH68 TypeStrain=False Application: ... Cyanothece sp. (ATCC® 51142D-5™) Strain Designations: Genomic DNA from Cyanothece sp. strain BH68 [ATCC® 51142™] / Type Strain ... Genomic DNA from Cyanothece sp. strain BH68 [ATCC® 51142™] Biosafety Level 1 Biosafety classification is based on U.S. Public ... Cyanothece sp. ATCC® 51142D-5™ freeze-dried Total DNA: At least 5 µg in 1X TE buffer ...
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
While Synechococcus species are usually cylindrical, Cyanothece species are normally oval and longer than 3 μm., Cyanotheces ... an exception is Cyanothece sp. PCC 7822 in which gene knock-outs can be generated. Cyanothece species are normally oval and ... Cyanothece has been found in a variety of environments all over the world. One point in common is that the pH is usually lower ... Cyanothece has the genes for the use of a variety of sugar molecules; although glycerol is the only one that has been used ...
Homologous recombination - Cyanothece sp. ATCC 51142 [ Pathway menu , Organism menu , Pathway entry , Download KGML , Show ...
Cyanothece sp. (strain PCC 7822). 401. UniRef90_B7K9Q5. Cluster: Phosphoglycerate kinase. 2. ... sp,B7K9Q5,PGK_CYAP7 Phosphoglycerate kinase OS=Cyanothece sp. (strain PCC 7424) OX=65393 GN=pgk PE=3 SV=1 ... Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)). ,p>This subsection of the ,a href="http://www.uniprot ...
... assigned to the genus Cyanothece Komárek 1976, which showed an unusually high content of light refractile inclusions when ... Unusual ultrastructural features in three strains of Cyanothece (cyanobacteria) Arch Microbiol. 2000 Feb;173(2):154-63. doi: ... Based on the common morphological and ultrastructural features, the three strains of Cyanothece examined constitute a distinct ... Three unicellular cyanobacterial strains (PCC 7425, PCC 8303, PCC 9308) assigned to the genus Cyanothece Komárek 1976, which ...
Cyanothece sp. (strain ATCC 51142)Imported. ,p>Information which has been imported from another database using automatic ... tr,B1WUS6,B1WUS6_CYAA5 Glutathione S-transferase OS=Cyanothece sp. (strain ATCC 51142) OX=43989 GN=gst5 PE=4 SV=1 ...
Low temperature delays timing and enhances the cost of nitrogen fixation in the unicellular cyanobacterium Cyanothece. Brauer, ... We tested these hypotheses in laboratory experiments with the unicellular cyanobacterium Cyanothece sp. BG043511. In line with ...
Author Summary Cyanobacteria have been promoted as platforms for biofuel production due to their useful physiological properties such as photosynthesis, relatively rapid growth rates, ability to accumulate high amounts of intracellular compounds and tolerance to extreme environments. However, development of a computational model is an important step to synthesize biochemical, physiological and regulatory understanding of photoautotrophic metabolism (either qualitatively or quantitatively) at a systems level, to make metabolic engineering of these organisms tractable. When integrated with other genome-scale data (e.g., expression data), numerical simulations can provide experimentally testable predictions of carbon fluxes and reductant partitioning to different biosynthetic pathways and macromolecular synthesis. This work is the first to computationally explore the interactions between components of photosynthetic and respiratory systems in detail. In silico predictions obtained from model analysis
Strains of the Cyanothece genus have been characterized as displaying robust grow and high rates of nitrogen fixation. The ... Enhanced nitrogen fixation in a glgX deficient strain of Cyanothece sp. ATCC 51142, a unicellular nitrogen-fixing ... Enhanced nitrogen fixation in a glgX deficient strain of Cyanothece sp. ATCC 51142, a unicellular nitrogen-fixing ... Enhanced nitrogen fixation in a glgX deficient strain of Cyanothece sp. ATCC 51142, a unicellular nitrogen-fixing ...
Diazotrophic Cyanobacteria of the Genus Cyanothece. Hongtao Min, Louis A. Sherman ...
This investigation of parallel transcriptional and translational activity within Cyanothece sp. PCC 7822 provided quantitative ... Cyanothece sp. PCC 7822 is an excellent cyanobacterial model organism with great potential to be applied as a biocatalyst for ... Diagram of differential gene expression in Cyanothece 7822 grown in 12-h light 12-h dark. Bar thickness is a qualitative ... From: Transcriptomic and proteomic dynamics in the metabolism of a diazotrophic cyanobacterium, Cyanothece sp. PCC 7822 during ...
This investigation of parallel transcriptional and translational activity within Cyanothece sp. PCC 7822 provided quantitative ... Cyanothece sp. PCC 7822 is an excellent cyanobacterial model organism with great potential to be applied as a biocatalyst for ... The relative fold change expression levels of both mRNA and protein for 47 genes involved with central metabolism in Cyanothece ... From: Transcriptomic and proteomic dynamics in the metabolism of a diazotrophic cyanobacterium, Cyanothece sp. PCC 7822 during ...
Purchase Recombinant Cyanothece sp. Photosystem I reaction center subunit IX(psaJ),partial. It is produced in Yeast. High ... Recombinant Cyanothece sp. Photosystem I reaction center subunit IX(psaJ),partial. Recombinant Cyanothece sp. Photosystem I ... Recombinant Cyanothece sp. Photosystem I reaction center subunit IX(psaJ),partial,E.coli. ... Recombinant Cyanothece sp. Photosystem I reaction center subunit IX(psaJ),partial,Mammalian cell. ...
Here, we report that the gene PCC7424_4054 of the strain Cyanothece sp. PCC 7424 encodes an enzymatically active protein that ... Genes coding for isocitrate lyase (ICL) and malate synthase were recently identified in two strains of the genus Cyanothece, ... We hypothesize that the glyoxylate shunt in Cyanothece sp. PCC 7424, and possibly other nitrogen-fixing cyanobacteria, is an ... 19. Feng X, Bandyopadhyay A, Berla B, Page L, Wu B et al. Mixotrophic and photoheterotrophic metabolism in Cyanothece sp. ATCC ...
sp,B8HMT1,RL13_CYAP4 50S ribosomal protein L13 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) OX=395961 GN=rplM PE=3 SV=1 ... Cyanothece sp. (strain PCC 7425 / ATCC 29141). ,p>This subsection of the ,a href="http://www.uniprot.org/help/names_and_ ...
Cyanothece sp. (ATCC® 51142D-5™) ATCC® Number: 51142D-5™ Strain Designations: Genomic DNA from Cyanothece sp. strain BH68 [ATCC ...
Cyanothece sp. NAD (P) H-quinone oxidoreductase subunit I datasheet and description hight quality product and Backed by our ... NAD (P) H-quinone oxidoreductase subunit I, Cyanothece sp. Short name: NAD (P) H-quinone oxidoreductase subunit I, Cyanothece ... NAD (P) H-quinone oxidoreductase subunit I, Recombinant Cyanothece sp. Alternative names: NAD(P)H dehydrogenase I subunit I, ... Nicotinamide adenine dinucleotide (P) H-quinone oxidoreductase functionnal sequence I, Cyanothece sp. ...
Optimisation of nutrient factors and the effect of some simple stresses on the ability of Cyanothece epiphytica to produce EPS ... Biolubricant potential of exopolysaccharides from the cyanobacterium Cyanothece epiphytica. [Mass Spectrometry - Glycomics] You ... Biolubricant potential of exopolysaccharides from the cyanobacterium Cyanothece epiphytica. [Mass Spectrometry - Glycomics]. ...
Structure of the cyanobactin oxidase ThcOx from Cyanothece sp. PCC 7425, the first structure to be solved at Diamond Light ...
... and Burnham Institute scientists developed a global model for the photosynthetic cyanobacterium Cyanothece. ... Cyanothece 51142. Cyanothece 51142 has completely different lifestyles in the day and the night. During the day it uses ... Cyanotheces complete metabolism described. Results: In an important step toward engineering bacteria to produce biofuel, ... They used a novel custom-built photobioreactor at PNNL to test the predicted changes in growth rates of Cyanothece 51142 in ...
Cyanothece sp. (strain ATCC 51142). Loading... B1XDP6 10 kDa chaperonin. Escherichia coli (strain K12 / DH10B). Loading... ...
Cyanothece sp. (strain PCC 8801). Loading... B7KGC8 NAD(P)H-quinone oxidoreductase subunit O. Cyanothece sp. (strain PCC 7424) ...
Anagnostidis, K. and J. Kom rek. 1988. Modern approach to the classification system of cyanophytes. 3-Oscillatoriales. Arch. Hydrobiol. (Suppl 80) Algol. Stud. 50/53:327-472.. Barbrook, A. C., P. J. Lockhart, and C. J. Howe. 1998. Phylogenetic analysis of plastid origins based on secA sequences. Current Genetics 34:336-341.. Bhattacharya, D. and L. Medlin. 1995. The phylogeny of plastids: a review based on comparisons of small-subunit ribosomal RNA coding regions. Journal of Phycology 31:489-498.. Bergman, B., J. Gallon, A. N. Rai, and L. Stal. 1997. Nitrogen fixing non-heterocystous cyanobacteria. FEMS Microbiological Reviews 19:139-185. Bryant, D. B. (ed.) 1994. The Molecular Biology of Cyanobacteria. Kluwer Academic Publishers, Dordrecht, Boston.. Capone, D. G, J. P. Zehr, H. W.Paerl, B. Bergman, and E. J.Carpenter. 1997. Trichodesmium, a globally significant marine cyanobacterium. Science 276:1221-1229. Carr, N. G. and B. A. Whitton (eds.) 1982. The Biology of Cyanobacteria. Blackwell ...
PNNL team presents new insight into H2 production by cyanobacterium Cyanothece 11 November 2015 Researchers at the US ... PNNL team presents new insight into H2 production by cyanobacterium Cyanothece. ... have presented a new and more complete view on the way a cyanobacterium-Cyanothece 51142-produces hydrogen. Using genome-scale ...
KO68DGA) and Cyanothece sp. (ATCC 51142) showed more than 95% identity, NifB accumulation was only detected for the Gloeothece ...
Cyanothece sp. PCC 8802 genome, GCA_000024045.1. *Candidatus Atelocyanobacterium thalassa isolate ALOHA genome, GCA_000025125.1 ...
Rhythmic and sustained oscillations in metabolism and gene expression of Cyanothece sp. ATCC 51142 under constant light. In: ... Rhythmic and sustained oscillations in metabolism and gene expression of Cyanothece sp. ATCC 51142 under constant light. ... Rhythmic and sustained oscillations in metabolism and gene expression of Cyanothece sp. ATCC 51142 under constant light. / ... T1 - Rhythmic and sustained oscillations in metabolism and gene expression of Cyanothece sp. ATCC 51142 under constant light ...
CYANOTHECE SP. ATCC 51142. OC Bacteria; Cyanobacteria; Chroococcales; Cyanothece. OX NCBI_TaxID=43989; RN [0] RP -.; RG -.; RL ... CC Cyanothece sp. ATCC 51142 chromosome chromosome circular, complete CC sequence. CC -!- ANNOTATIONS ORIGIN:B1WUH8_CYAA5 CC ...
CYANOTHECE SP. ATCC 51142. OC Bacteria; Cyanobacteria; Chroococcales; Cyanothece. OX NCBI_TaxID=43989; RN [0] RP -.; RG -.; RL ... CC Cyanothece sp. ATCC 51142 plasmid A, complete sequence. CC 1..36860 annotated by Ensembl Genomes CC -!- ANNOTATIONS ORIGIN: ...

No FAQ available that match "cyanothece"