Cucumis sativus
Cucumis melo
Cucumis
Cucurbitaceae
Coriandrum
Lawsonia Plant
Peronospora
Cucurbita
Cotyledon
A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)
Glutamate Synthase (NADH)
Plant Roots
Protochlorophyllide
Chromosomes, Plant
Plant Proteins
Plant Leaves
Gene Expression Regulation, Plant
Plant Growth Regulators
Hypocotyl
The region of the stem beneath the stalks of the seed leaves (cotyledons) and directly above the young root of the embryo plant. It grows rapidly in seedlings showing epigeal germination and lifts the cotyledons above the soil surface. In this region (the transition zone) the arrangement of vascular bundles in the root changes to that of the stem. (From Concise Dictionary of Biology, 1990)
Plants
Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.
Chlorophyll
Books, Illustrated
Product Labeling
Algorithms
Gardening
Taste
Nigella sativa
Thrombectomy
Biological Science Disciplines
All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.
Computer-Assisted Instruction
Brassinosteroids
Steroids, Heterocyclic
Environmental Pollution
Cholestanols
Ribosome Inactivating Proteins, Type 1
N-Glycosyl Hydrolases
Phytolacca americana
Photosynthesis
The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide using energy obtained from light rather than from the oxidation of chemical compounds. Photosynthesis comprises two separate processes: the light reactions and the dark reactions. In higher plants; GREEN ALGAE; and CYANOBACTERIA; NADPH and ATP formed by the light reactions drive the dark reactions which result in the fixation of carbon dioxide. (from Oxford Dictionary of Biochemistry and Molecular Biology, 2001)
Thiol-dependent degradation of protoporphyrin IX by plant peroxidases. (1/376)
Protoporphyrin IX (PP) is the last porphyrin intermediate in common between heme and chlorophyll biosynthesis. This pigment normally does not accumulate in plants because its highly photodynamic nature makes it toxic. While the steps leading to heme and chlorophylls are well characterized, relatively little is known of the metabolic fate of excess PP in plants. We have discovered that plant peroxidases can rapidly degrade this pigment in the presence of thiol-containing substrates such as glutathione and cysteine. This thiol-dependent degradation of PP by horseradish peroxidase consumes oxygen and is inhibited by ascorbic acid. (+info)Enhancer-like properties of an RNA element that modulates Tombusvirus RNA accumulation. (2/376)
Prototypical defective interfering (DI) RNAs of the plus-strand RNA virus tomato bushy stunt virus contain four noncontiguous segments (regions I-IV) derived from the viral genome. Region I corresponds to 5'-noncoding sequence, regions II and III are derived from internal positions, and region IV represents a 3'-terminal segment. We analyzed the internally located region III in a prototypical DI RNA to understand better its role in DI RNA accumulation. Our results indicate that (1) region III is not essential for DI RNA accumulation, but molecules that lack it accumulate at significantly reduced levels ( approximately 10-fold lower), (2) region III is able to function at different positions and in opposite orientations, (3) a single copy of region III is favored over multiple copies, (4) the stimulatory effect observed on DI RNA accumulation is not due to region III-mediated RNA stabilization, (5) DI RNAs lacking region III permit the efficient accumulation of head-to-tail dimers and are less effective at suppressing helper RNA accumulation, and (6) negative-strand accumulation is also significantly depressed for DI RNAs lacking region III. Collectively, these results support a role for region III as an enhancer-like element that facilitates DI RNA replication. A scanning-type mutagenesis strategy was used to define portions of region III important for its stimulatory effect on DI RNA accumulation. Interestingly, the results revealed several differences in the requirements for activity when region III was in the forward versus the reverse orientation. In the context of the viral genome, region III was found to be essential for biological activity. This latter finding defines a critical role for this element in the reproductive cycle of the virus. (+info)Conversion of cucumber linoleate 13-lipoxygenase to a 9-lipoxygenating species by site-directed mutagenesis. (3/376)
Multiple lipoxygenase sequence alignments and structural modeling of the enzyme/substrate interaction of the cucumber lipid body lipoxygenase suggested histidine 608 as the primary determinant of positional specificity. Replacement of this amino acid by a less-space-filling valine altered the positional specificity of this linoleate 13-lipoxygenase in favor of 9-lipoxygenation. These alterations may be explained by the fact that H608V mutation may demask the positively charged guanidino group of R758, which, in turn, may force an inverse head-to-tail orientation of the fatty acid substrate. The R758L+H608V double mutant exhibited a strongly reduced reaction rate and a random positional specificity. Trilinolein, which lacks free carboxylic groups, was oxygenated to the corresponding (13S)-hydro(pero)xy derivatives by both the wild-type enzyme and the linoleate 9-lipoxygenating H608V mutant. These data indicate the complete conversion of a linoleate 13-lipoxygenase to a 9-lipoxygenating species by a single point mutation. It is hypothesized that H608V exchange may alter the orientation of the substrate at the active site and/or its steric configuration in such a way that a stereospecific dioxygen insertion at C-9 may exclusively take place. (+info)Cucumber cotyledon lipoxygenase during postgerminative growth. Its expression and action on lipid bodies. (4/376)
In cucumber (Cucumis sativus), high lipoxygenase-1 (LOX-1) activity has been detected in the soluble fraction prepared from cotyledons of germinating seeds, and the involvement of this enzyme in lipid turnover has been suggested (K. Matsui, M. Irie, T. Kajiwara, A. Hatanaka [1992] Plant Sci 85: 23-32; I. Fuessner, C. Wasternack, H. Kindl, H. Kuhn [1995] Proc Natl Acad Sci USA 92: 11849-11853). In this study we have investigated the expression of the gene lox-1, corresponding to the LOX-1 enzyme. LOX-1 expression is highly coordinated with that of a typical glyoxysomal enzyme, isocitrate lyase, during the postgerminative stage of cotyledon development. In contrast, although icl transcripts accumulated in tissue during in vitro senescence, no accumulation of lox-1 mRNA could be observed, suggesting that lox-1 plays a specialized role in fat mobilization. LOX-1 is also known to be a major lipid body protein. The partial peptide sequences of purified LOX-1 and lipid body LOX-1 entirely coincided with that deduced from the lox-1 cDNA sequence. The data strongly suggest that LOX-1 and lipid body LOX-1 are derived from a single gene and that LOX-1 can exist both in the cytosol and on the lipid bodies. We constructed an in vitro oxygenation system to address the mechanism of this dual localization and to investigate the action of LOX-1 on lipids in the lipid bodies. LOX-1 cannot act on the lipids in intact lipid bodies, although degradation of lipid body proteins, either during seedling growth or by treatment with trypsin, allows lipid bodies to become susceptible to LOX-1. We discuss the role of LOX-1 in fat mobilization and its mechanism of action. (+info)Both RNA rearrangement and point mutation contribute to repair of defective chimeric viral genomes to form functional hybrid viruses in plants. (5/376)
The putative movement protein gene (p27) plus 5' and 3' flanking sequences of cucumber leaf spot aureusvirus (CLSV) was inserted into an infectious cucumber necrosis tombusvirus (CNV) cDNA clone containing a deletion in the cell-to-cell movement protein gene. Approximately 5% of plants inoculated with synthetic transcripts of two such defective chimeric CNV/CLSV cDNA clones developed systemic symptoms 7-19 days postinoculation. Reverse transcription-polymerase chain reaction and sequence analysis of virus obtained from systemically infected leaves indicated that both point mutation and RNA rearrangement (deletion) contributed to the formation of movement competent CNV/CLSV hybrid viruses. The hybrid viruses were found to accumulate to high levels in infected plants, to form stable virions, and to be mechanically transmissible. In addition, a hybrid virus that lacked 50 amino acids at the carboxyl-terminal region of CLSV p27 was still capable of facilitating CNV movement. These data provide experimental evidence for the role of CLSV p27 in viral cell-to-cell movement and demonstrate that p27 can enable efficient movement of the CNV genome. Moreover, the data show that RNA rearrangements known to occur during CNV RNA replication can contribute to rapid evolution of the CNV genome. (+info)alpha-oxidation of fatty acids in higher plants. Identification of a pathogen-inducible oxygenase (piox) as an alpha-dioxygenase and biosynthesis of 2-hydroperoxylinolenic acid. (6/376)
A pathogen-inducible oxygenase in tobacco leaves and a homologous enzyme from Arabidopsis were recently characterized (Sanz, A., Moreno, J. I., and Castresana, C. (1998) Plant Cell 10, 1523-1537). Linolenic acid incubated at 23 degrees C with preparations containing the recombinant enzymes underwent alpha-oxidation with the formation of a chain-shortened aldehyde, i.e., 8(Z),11(Z), 14(Z)-heptadecatrienal (83%), an alpha-hydroxy acid, 2(R)-hydroxy-9(Z),12(Z),15(Z)-octadecatrienoic acid (15%), and a chain-shortened fatty acid, 8(Z),11(Z),14(Z)-heptadecatrienoic acid (2%). When incubations were performed at 0 degrees C, 2(R)-hydroperoxy-9(Z),12(Z),15(Z)-octadecatrienoic acid was obtained as the main product. An intermediary role of 2(R)-hydroperoxy-9(Z), 12(Z),15(Z)-octadecatrienoic acid in alpha-oxidation was demonstrated by re-incubation experiments, in which the hydroperoxide was converted into the same alpha-oxidation products as those formed from linolenic acid. 2(R)-Hydroperoxy-9(Z),12(Z), 15(Z)-octadecatrienoic acid was chemically unstable and had a half-life time in buffer of about 30 min at 23 degrees C. Extracts of cells expressing the recombinant oxygenases accelerated breakdown of the hydroperoxide (half-life time, about 3 min at 23 degrees C), however, this was not attributable to the recombinant enzymes since the same rate of hydroperoxide degradation was observed in the presence of control cells not expressing the enzymes. No significant discrimination between enantiomers was observed in the degradation of 2(R,S)-hydroperoxy-9(Z)-octadecenoic acid in the presence of recombinant oxygenases. A previously studied system for alpha-oxidation in cucumber was re-examined using the newly developed techniques and was found to catalyze the same conversions as those observed with the recombinant enzymes, i.e. enzymatic alpha-dioxygenation of fatty acids into 2(R)-hydroperoxides and a first order, non-stereoselective degradation of hydroperoxides into alpha-oxidation products. It was concluded that the recombinant enzymes from tobacco and Arabidopsis were both alpha-dioxygenases, and that members of this new class of enzymes catalyze the first step of alpha-oxidation in plant tissue. (+info)Spider mite-induced (3S)-(E)-nerolidol synthase activity in cucumber and lima bean. The first dedicated step in acyclic C11-homoterpene biosynthesis. (7/376)
Many plant species respond to herbivory with de novo production of a mixture of volatiles that attracts carnivorous enemies of the herbivores. One of the major components in the blend of volatiles produced by many different plant species in response to herbivory by insects and spider mites is the homoterpene 4,8-dimethyl-1,3(E), 7-nonatriene. One study (J. Donath, W. Boland [1995] Phytochemistry 39: 785-790) demonstrated that a number of plant species can convert the acyclic sesquiterpene alcohol (3S)-(E)-nerolidol to this homoterpene. Cucumber (Cucumis sativus L.) and lima bean (Phaseolus lunatus L.) both produce 4,8-dimethyl-1,3(E),7-nonatriene in response to herbivory. We report the presence in cucumber and lima bean of a sesquiterpene synthase catalyzing the formation of (3S)-(E)-nerolidol from farnesyl diphosphate. The enzyme is inactive in uninfested cucumber leaves, slightly active in uninfested lima bean leaves, and strongly induced by feeding of the two-spotted spider mite (Tetranychus urticae Koch) on both plant species, but not by mechanical wounding. The activities of the (3S)-(E)-nerolidol synthase correlated well with the levels of release of 4, 8-dimethyl-1,3(E),7-nonatriene from the leaves of the different treatments. Thus, (3S)-(E)-nerolidol synthase is a good candidate for a regulatory role in the release of the important signaling molecule 4,8-dimethyl-1,3(E),7-nonatriene. (+info)Phloem long-distance transport of CmNACP mRNA: implications for supracellular regulation in plants. (8/376)
Direct support for the concept that RNA molecules circulate throughout the plant, via the phloem, is provided through the characterisation of mRNA from phloem sap of mature pumpkin (Cucurbita maxima) leaves and stems. One of these mRNAs, CmNACP, is a member of the NAC domain gene family, some of whose members have been shown to be involved in apical meristem development. In situ RT-PCR analysis revealed the presence of CmNACP RNA in the companion cell-sieve element complex of leaf, stem and root phloem. Longitudinal and transverse sections showed continuity of transcript distribution between meristems and sieve elements of the protophloem, suggesting CmNACP mRNA transport over long distances and accumulation in vegetative, root and floral meristems. In situ hybridization studies conducted on CmNACP confirmed the results obtained using in situ RT-PCR. Phloem transport of CmNACP mRNA was proved directly by heterograft studies between pumpkin and cucumber plants, in which CmNACP transcripts were shown to accumulate in cucumber scion phloem and apical tissues. Similar experiments were conducted with 7 additional phloem-related transcripts. Collectively, these studies established the existence of a system for the delivery of specific mRNA transcripts from the body of the plant to the shoot apex. These findings provide insight into the presence of a novel mechanism likely used by higher plants to integrate developmental and physiological processes on a whole-plant basis. (+info)
Cucumber Plant Leaves Baby Cucumber Plant Cucumber Seeds Baby Baby Cucumber Plant Leaves Cucumber Plant Leaves Turning Yellow...
UTJECAJ SUMPOROVODIKA (H2S) NA VIGOR SJEMENA KRASTAVCA (Cucumis sativus L.) U UVJETIMA SOLNOG STRESA | Croatian Digital Theses...
EFFECT OF BREAD YEAST APPLICATION AND SEAWEED EXTRACT ON CUCUMBER (Cucumis sativus L.) PLANT GROWTH, YIELD AND FRUIT QUALITY.
Expression characteristics of CS-ACS1, CS-ACS2 and CS-ACS3, three members of the 1-aminocyclopropane-1-carboxylate synthase...
Comparison of de novo assembling of Cucumis sativus L. genotypes and their somaclones | XL-th IEEE-SPIE Joint Symposium Wilga...
Squirting Cucumber Plants: What Are Squirting Cucumbers And Where Do They Grow
INGREDIENSER - Pure & Care
LOX-DB - LipOXygenases DataBase - Literature
Cucumis Sativus - Cosmetic Analysis
Assessment of physiological potential of cucumber seeds using the software Seedling Vigor Imaging SystemĀ® (SVISĀ®)
Publikationen: Leibniz-Institut für Pflanzenbiochemie
Publikationen: Leibniz-Institut für Pflanzenbiochemie
é»ē(Cucumis Sativus)ęåē© - 蔨é¢ę“»ę§å - 蔨é¢ę“»ę§åē¾ē§ - 第1é
é»ē(Cucumis Sativus)ę²¹ - 蔨é¢ę“»ę§å - 蔨é¢ę“»ę§åē¾ē§ - 第1é
Chill-induced decrease in capacity of RuBP carboxylation and associated H2O2 accumulation in cucumber leaves are alleviated by...
The relationship between carbon and nitrogen metabolism in cucumber leaves acclimated to salt stress [PeerJ]
Non-destructive measurement of cucumber leaf chlorophyll content by NIR spectroscopy based on simulated annealing algorithm -...
Why Are My Cucumber Leaves Turning Yellow And Dying?
Products That Contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT || Skin DeepĀ® Cosmetics
Products That Contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT || Skin DeepĀ® Cosmetics
Pectic polysaccharide breakdown of cell walls in cucumber roots grown with calcium starvation - Fingerprint
- Tohoku...
What Causes Rust Spots on Cucumber Plants? | Home Guides | SF Gate
Genome-wide identification, structure characterization, and expression pattern profiling of aquaporin gene family in cucumber |...
J Integr Plant Biol
Fruit By The Foot Are Cucumbers Fruit
3-hydroxy-3-phenylpropanoic acid is an intermediate in the biosynthesis of benzoic acid and salicylic acid but benzaldehyde is...
Matrix Science Medica : Table of Contents
Morphogenesis of some agriculture species at in vitro conditions - UGD Repository
24-Epibrassinolide alleviates organic pollutants-retarded root elongation by promoting redox homeostasis and secondary...
Research Publications | cct - Part 3
IN VITRO SCREENING OF ANTIOXIDANT AND ANTIAGING POTENTIAL OF CUCUMIS SATIVUS FRUIT EXTRACT
| Asian Journal of...
MARKETMORE SEEDS (CUCUMBER) - Plant World Seeds
I Have Bugs Eating My Cucumber Plants | Garden Guides
PPT - Cucumber Cucumis sativus PowerPoint presentation | free to view - id: 1577d4-YjdhO
japanese cucumbers yellow
Effects of Hexaconazole on Growth and Antioxidant Potential of Cucumber Seedlings under UV-B Radiation | Korea Science
Horticulture/Gourd Family - Wikibooks, open books for an open world
Cucumis sativus ( Jazzer Cucumber ) | Backyard Gardener
Expression and functional analysis of the propamocarb-related gene CsMAPEG in cucumber | BMC Plant Biology | Full Text
CUM10 - CUM10 - Cucumis sativus (Cucumber) - CUM10 gene & protein
Mustika Ratu Oxigenated Spray Green Tea - Review Female Daily
Transcriptome analyses of early cucumber fruit growth identifies distinct gene modules associated with phases of development
repotting - What can I do to help root-bound cucumber plants? - Gardening & Landscaping Stack Exchange
Cucumber - Health Benefits - TRCB
The Gilmer Mirror - Cool Cucumbers
What Makes a Cucumber Turn Yellow? | Home Guides | SF Gate
Cucumber Plants: Problems & Diseases
Cucumber
4LLF CRYSTAL STRUCTURE OF CUCUMBER NECROSIS VIRUS | 4LLF I | P15183 | | Capsid protein | 3D Structure | Cancer
The Cucumber leaf spot virus p25 auxiliary replicase protein binds and modifies the endoplasmic reticulum via N-terminal...
Cucumis - Wikipedia, a enciclopedia libre
In my home garden, my cucumber plant leaves are turning brown/ yellow. It... - Ask an Expert
China Fungicide Control Blight and Downy Mildew on Cucumber, Tomato. Famoxadone & Cymoxanil Wdg - China Famoxadone, Cymoxanil
Chill-Induced Inhibition of Photosynthesis: Genotypic Variation within Cucumis sativus : Plant and Cell Physiology - oi
Pesquisa | Portal Regional da BVS
Variations in the level of enzyme activity and immunolocalization of calcium-dependent protein kinases in the phloem of...
5 In 1 Natural Moisturizing Face Sunscreen - Suntegrity
- Holistic Beauty Bar...
Frontiers | QTL Mapping by SLAF-seq and Expression Analysis of Candidate Genes for Aphid Resistance in Cucumber | Plant Science
Instantly Vivid - Cancel Your Membership
raphanus sativus germination
Have you eaten Sikkim Cucumber ? ~ Proud to be a Sikkimese
Huggies One & Done Refreshing Wipes, Refill Pack, Scented, Alcohol-free, Hypoallergenic Cucumber & Green Tea | Walgreens
SID.ir | EFFECT OF PARTICLE SIZE DISTRIBUTION OF PERLITE AND ITS MIXTURE WITH ORGANIC SUBSTRATES ON CUCUMBER IN HYDROPONICS...
Poor Fruiting on Cucumber, Squash and other Vine Crops :: Melinda Myers
Be Cool this Summer with Cucumber Facts: The Basics on Preparing and Storing Cucumbers | NY Farmers Market SNAP Program
Chicago Pickling Cucumber
- Revival Seeds
kate somerville ceramides + omegas serum review
cucumber beetle insecticide
Antinociceptive and anti-inflammatory effects of Crocus sativus L. stigma and petal extracts in mice | BMC Pharmacology | Full...
Pickled cucumbers from the garden - Down to Earth
Stamp and Food of the day: Cucumbers
Project : USDA ARS
white egg | Skin Care Skin Products
Poniente - Organic (F1) Cucumber Seed | Johnnys Selected Seeds
ADC Adstation 5660E 3.5V Wall Extension Module - 5660E - MFI Medical
Cucumbers Bitter - Knowledgebase Question - Garden.org
Garden Maintenance Late-June - Urban Seedling
Super gardenblahblahblah. Prepare thyself.
Sedoheptulose-bisphosphatase - Wikipedia
Itachi - (F1) Cucumber Seed | Johnnys Selected Seeds
How to Make Cucumber Juice (with Pictures) - wikiHow
Health Benefits of Cucumber, Cucumber benefits Skin, Heart, Digestion
NSTA Science Store :: Bitterness and Non-Bitterness in Cucumbers: A Story of Mutation (Teacher Edition) :: Book Chapter
myacadaxtra: 9 Health Benefits of Cucumbers
Cucumber Tea Sandwiches No Null Seeded Cucumber Recipes | Foodily
Cucumber Soup Chilled Cucumber No (southern Living) Recipes | Foodily
Chive-Stuffed Cucumbers | Canadian Living
FY446662 Raphanus sativus GSK3-1 seedling Raphanus sativus cDNA clone - Nucleotide - NCBI
FY446276 Raphanus sativus GSK3-1 seedling Raphanus sativus cDNA clone - Nucleotide - NCBI
Raphanus sativus Radish, Cultivated radish PFAF Plant Database
Daucus carota ssp. sativus Cosmic Purple - photo
Raphanus sativus p67 protein
Summary Report | CureHunter
Phytophthora hydropathica
Cucumber (Cucumis sativus cv. Orient Express): damping off of seedlings. Azaleas (Rhodoendron Kurume hybrid cv. Hershey's Red ...
List of Bohol flora and fauna
Cucumis sativus pipino - Cucumber; zuchinni; Cucurbita pepo radish; Raphanus repolyo - cabbage; Brassica oleracea saluyot - ... watermelon - Curcubita citrullus Linn.; also Citrullus vulgaris Schrad.; pakwan (INTRODUCED) ahos - Garlic; Allium sativum; ... Oryza sativa) baka - Philippine cow; Bos taurus Baboy ihÔs - baboy damó; wild boar; Sus scrofa bóngcaras - sea cow; Dugong ... bottle gourd Corindrium sativum - coriander leaf adelfa - Oleander; South sea rose; Nerium indicum Mill.; Neroum oleander ...
Pseudomonas tomato
lachrymans attacks cucumbers (Cucumis sativus). 'Pseudomonas tomato' pv. maculicola attacks members of Brassica and Raphanus. ' ...
List of organisms by chromosome count
Cucumis melo) 24 [39] Rice. (Oryza sativa) 24 [21] Silverleaf nightshade. (Solanum elaeagnifolium) 24 [40] ... Raphanus sativus) 18 [21] Carrot. (Daucus carota) 18 The genus Daucus includes around 25 species. D. carota has nine chromosome ... Allium sativum) 16 [26] Itch mite. (Sarcoptes scabiei) 17/18 According to the observation of embryonic cells of egg, chromosome ... Medicago sativa) 32 Cultivated alfalfa is tetraploid, with 2n=4x=32. Wild relatives have 2n=16.[21]:165 [21] ...
Plastocyanin family of copper-binding proteins
... from Cucumis sativus (Cucumber) peelings; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from ...
List of sequenced plant genomes
December 2009). "The genome of the cucumber, Cucumis sativus L". Nature Genetics. 41 (12): 1275-81. doi:10.1038/ng.475. PMID ... Bell L, Chadwick M, Puranik M, Tudor R, Methven L, Kennedy S, Wagstaff C (2020). "The Eruca sativa Genome and Transcriptome: A ... July 2012). "The genome of melon (Cucumis melo L.)". Proceedings of the National Academy of Sciences of the United States of ... April 2002). "A draft sequence of the rice genome (Oryza sativa L. ssp. indica)". Science. 296 (5565): 79-92. Bibcode:2002Sci ...
Plant genome assembly
The genome of the cucumber, (Cucumis sativus), was one of the plant genomes that used the NGS Illumina reads in combination ... December 2009). "The genome of the cucumber, Cucumis sativus L". Nature Genetics. 41 (12): 1275-81. doi:10.1038/ng.475. PMID ... To sequence and assemble the genome of Oryza Sativa (japonica), the same strategy was used. For Oryza Sativa a total of 3,401 ... April 2002). "A draft sequence of the rice genome (Oryza sativa L. ssp. japonica)". Science. 296 (5565): 92-100. Bibcode: ...
BGI Group
Cucumis sativus L". Nature Genetics. 41 (12): 1275-1281. doi:10.1038/ng.475. PMID 19881527. S2CID 10711523. "Honors and Awards ...
Cucurbitacin
... C, from Cucumis sativus (Cucumber) [1]:11. Cucurbitacin D[edit]. Cucurbitacin D ... Cucurbitacin A found in some species of Cucumis [1]:1 *Pentanorcucurbitacin A, or 22-hydroxy-23,24,25,26,27-pentanorcucurbit-5- ...
Cucumber
Cucumis sativus flower An Indian yellow cucumber Komkommer (Cucumis sativus 'Gele Tros') A varietal grown by the Hmong people ... A tendril emerges from cucumber vines to facilitate climbing Flower of Cucumis sativus Pollen grains of Cucumis sativus A ... Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55: 193-195. doi: ... Cucumber (Cucumis sativus) is a widely-cultivated creeping vine plant in the Cucurbitaceae gourd family that bears cucumiform ...
Tryptophol
In Cucumis sativus (cucumber), the enzymes indole-3-acetaldehyde reductase (NADH) and indole-3-acetaldehyde reductase (NADPH) ... "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol. Chem. 251 (4): 907-13. PMID ...
Indole-3-acetaldehyde reductase (NADPH)
Brown HM, Purves WK (1976). "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol ...
List of cucumber varieties
"Photosensitivity of Cucumber (Cucumis sativus L.) Seedlings Exposed to Ultraviolet-B Radiation". Chilean Journal of ...
Anthroponics
Copyright 2015 Elsevier B.V. All rights reserved Trollblad, VerƄnika (2016). Odling av Cucumis Sativus L. med aska frƄn trƤd ... Hemmaodlat, Malmƶ, Sweden SƔnchez, Henrique (2016). Wood ash as a nutrient supplement for Cucumis Sativus in an anthroponics ... ISSN 1064-3389 SƔnchez, Henrique (2015). Lactuca sativa production in an anthroponics system. Hemmaodlat, Malmƶ, Sweden Pradhan ...
Cucumber
Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55: 193. doi: ... has been applied to Cucumis anguria L., a related species of Cucumis sativus, the most common cucumber plant.[14] ... The cucumber (Cucumis sativus), or less formally cuke, is a widely cultivated plant in the gourd family, Cucurbitaceae. It is a ... This is not the same species as the common cucumber (Cucumis sativus) although it is closely related. Armenian cucumbers have ...
Melon necrotic spot virus
In particular, the hosts include watermelons (Citrullus lanatus), cucumbers (Cucumis sativus), and melons (Cucumis melo). On ... Kishi first discovered MNSV on Cucumis melo in a greenhouse setting in that year. For the next two decades, there were minor ... It is considered to be an endemic virus in greenhouses and field productions of Cucurbitaceae crops, including melon (Cucumis ... in Cucumis melo L. 'Doublon'". Euphytica. 134 (3): 319. doi:10.1023/B:EUPH.0000004969.95036.1d. S2CID 41736537. Herrera-VƔsquez ...
Inositol 3-alpha-galactosyltransferase
"Partial characterization of the galactinol forming enzyme from leaves of Cucumis sativus L". Plant Sci. Lett. 23: 25-33. doi: ...
Nannotrigona testaceicornis
2008). "Pollination of cucumber, Cucumis sativus L. (Cucurbitales: Cucurbitaceae), by the stingless bees Scaptotrigona aff. ...
Sedoheptulose-bisphosphatase
7-bisphosphatase from Cucumis sativus". Scientia Horticulturae. 129 (3): 414-420. doi:10.1016/j.scienta.2011.04.010. Anderson ...
List of sequenced plastomes
Plader W, Yukawa Y, Sugiura M, Malepszy S (2007). "The complete structure of the cucumber (Cucumis sativus L.) chloroplast ... February 2005). "The Genomes of Oryza sativa: a history of duplications". PLOS Biology. 3 (2): e38. doi:10.1371/journal.pbio. ... Oryza sativa) chloroplast genome: intermolecular recombination between distinct tRNA genes accounts for a major plastid DNA ...
Trichoderma harzianum
Induction of defense responses in cucumber plants (Cucumis sativus L.) by the biocontrol agent Trichoderma harzianum. Appl. ...
Steven A. Hill
Cucumis sativus L.) (PhD thesis). University of Edinburgh. hdl:1842/14071. OCLC 606083438. EThOS uk.bl.ethos.652440. Hill, S. A ... Cucumis sativus L.) Cotyledons during Early Seedling Growth". Plant Physiology. 99 (1): 60-66. doi:10.1104/pp.99.1.60. ISSN ... of Edinburgh where he was awarded a PhD in 1990 for research on the regulation on mitochondrial function in Cucumis sativus L. ...
Aluminium
Cucumis sativus)". Environmental and Experimental Botany. 57 (1-2): 106-115. doi:10.1016/j.envexpbot.2005.05.004. Andersson, ...
Trans,cis-2,6-Nonadienal
Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55 (1): 193-195. ...
Cucurbitaceae
Schaefer H, Kocyan A, Renner SS (2007). "Phylogenetics of Cucumis (Cucurbitaceae): Cucumber (C. sativus) belongs in an Asian/ ... and others Cucumis - cucumber (C. sativus), various melon Momordica - bitter melon Luffa - the common name is also luffa, ... f. 1867 (3 spp.) Cucumis L. (65 spp.) Dactyliandra Hook.f. (2 spp.) Diplocyclos (Endl.) T.Post & Kuntze (4 spp.) Indomelothria ...
Childbirth in Trinidad and Tobago
Cucumis sativus), garlic (Allium sativum), and tamarind leaf (Tamarindus indica) were also used to control high blood pressure ...
Chris J. Leaver
Cucumis sativus L.). ed.ac.uk (PhD thesis). University of Edinburgh. hdl:1842/14071. OCLC 606083438. EThOS uk.bl.ethos.652440. ...
List of honey plants
C.lanatus Nakai Cucumis melo L. Cucumis sativus L. Cucurbita maxima Duchesne Cucurbita pepo L. Luffa cylindrica M.Roem. ... gongylodes Eruca sativa Mill. Lobularia maritima (L.) Desv. Sinapis alba L. Apuleia molaris Spruce ex Benth. Bauhinia forficata ... Medicago sativa L. Melilotus alba Medik. Melilotus officinalis Lam. Myrocarpus frondosus M.Allemão Sweetia fruticosa var. ... Apium graveolens L. Daucus carota L. Pastinaca sativa L. Petroselinum crispum Hoffm. All the plants of this family are found in ...
Cucumber mosaic virus
This virus was first found in cucumbers (Cucumis sativus) showing mosaic symptoms in 1934, hence the name Cucumber mosaic. ...
Alternanthera mosaic virus
Cucumis sativus), and black-eyed peas (Vigna unguiculata) also became systemically infected. Many of these plants showed mild ...
FamƮleya kundiran - WƮkƮpediya
Gindor (qawin, petêx) (Cucumis melo). *Dolmik, kundir (Cucurbita). *Cehik (xiyar, arûf) (Cucurbita sativus) ...
Triptofol
Kod krastavca Cucumis sativus, enzimi indole-3-acetaldehid-reduktaza (NADH) I indol-3-acetaldehid-reduktaza (NADPH) koriste ... Brown HM, Purves WK (1976). "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol ...
List of vegetables used in Assamese cuisine
Cucumis sativus. Mula. Radish. Raphanus sativus. Gajor. Carrot. Daucus carota. Bilahee. Tomato. Solanum lycopersicum. ...
FotomorfoÄ£enÄze - VikipÄdija
Growth and morphological responses to different UV wavebands in cucumber (Cucumis sativum) and other dicotyledonous seedlings. ...
ą®
ą®²ąÆą®®ą®æą®©ą®æą®Æą®®ąÆ - ą®¤ą®®ą®æą®“ąÆ ą®µą®æą®ąÆą®ą®æą®ŖąÆą®ŖąÆą®ą®æą®Æą®¾
2006). "Effect of aluminum on Ī“-aminolevulinic acid dehydratase (ALA-D) and the development of cucumber (Cucumis sativus)". ...
Cucurbitaceae - ŠŠøŠŗŠøŠæŠµŠ“ŠøŃŠ°
Schaefer H, Kocyan A, Renner SS (2007). āPhylogenetics of Cucumis (Cucurbitaceae): Cucumber (C. sativus) belongs in an Asian/ ...
Chigheummao
O chigheummao (cucumis sativus) o l'è unn-a verdùa da famiggia de cucurbitacee. ...
ą¦
সমৰ শাą¦-ą¦Ŗą¦¾ą¦ą¦²ą¦æą§° ą¦¤ą¦¾ą¦²ą¦æą¦ą¦¾ - ą¦
ą¦øą¦®ą§ą¦Æą¦¼ą¦¾ ą§±ą¦æą¦ą¦æą¦Ŗą¦æą¦”িয়া
Cucumis sativus ą¦®ą§ą¦²ą¦¾ Radish Raphanus sativus ą¦ą¦¾ą¦ą§° Carrot Daucus carota বিলাহৠTomato Solanum lycopersicum ...
Cucumis, a enciclopedia libre
Cucumis sativus (cogombro). VĆ©xase tamĆ©n[editar , editar a fonte]. Ligazóns externas[editar , editar a fonte]. Wikispecies ... Cucumis sativus) ou o meloeiro (Cucumis melo). ... Cucumis Ć© un xĆ©nero con 243 especies de plantas con flores ... TraĆdo desde "https://gl.wikipedia.org/w/index.php?title=Cucumis&oldid=4271483" ...
Cucumis melo
Melo sativus Sageret. *Melo vulgaris Moench ex Cogn.. *Melo zard Pangalo. *Melo Ć ambiguua Pangalo ... Cucumis melo, also known as melon,[2][3] is a species of Cucumis that has been developed into many cultivated varieties. The ... Wikimedia Commons has media related to: Cucumis melo (category). *Cucumis melo L. - Purdue University, Center for New Crops & ... "Cucumis melo". Germplasm Resources Information Network (GRIN). Agricultural Research Service (ARS), United States Department of ...
Aluminium
Cucumis sativus)". Environmental and Experimental Botany. 57 (1-2): 106-115. doi:10.1016/j.envexpbot.2005.05.004.. ...
ąØą©ąØ°ąØ¾ - ąØµąØæąØą©ąØŖą©ąØ”ą©ąØ, ąØąØ ąØ
ąØąØ¼ąØ¾ąØ¦ ąØµąØæąØøąØ¼ąØµąØąØæąØąØØąØą©ąØøąØ¼
ąØą©ąØ°ąØ¾ (Eng: Cucumber, Cucumis sativus) ąØą©ąØ¤ąØæąØ ਪਰਵਾਰ ąØµąØæą©±ąØ ąØą©±ąØ ąØµąØæąØąØŖąØ ąØąØ¾ąØøąØ¼ąØ¤ ąØµąØ¾ąØ²ą© ąØŖą©ąØ¦ąØ¾ ਹą©, ąØą©ąØąØ°ą©ąØ¬ą©ąØąØ¾ąØøą©ąØ ąØąØ¹ ąØą©±ąØ ąØ°ą©ąØąØąØ£ ąØµąØ¾ąØ²ą© ąØµą©ąØ² ąØ¹ą© ąØą© ...
White clover mosaic virus
Cucumis sativus), squash ( Cucurbita pepo ), and tomatoes (Lycopersicon esculentum). This virus is believed to be distributed ... It is also known to infect peas (Pisum sativum), faba beans (Vicia faba), green beans (Phaseolus vulgaris), cowpea (Vigna ...
Mitochondrial DNA
The genome of the mitochondrion of the cucumber (Cucumis sativus) consists of three circular chromosomes (lengths 1556, 84 and ...
List of leaf vegetables
"Entity Display : Pisum sativum". Archive.is. Archived from the original on 2012-07-14. Retrieved 2018-02-28.CS1 maint: bot: ... "Cucumis prophetarum - Useful Tropical Plants". tropical.theferns.info. Retrieved 5 March 2021. John H. Wiersema (2005-02-22). " ... "Entity Display : Raphanus sativus Bailey". Ecoport.org. Retrieved 2018-02-28. "GRIN #1015". npgsweb.ars-grin.gov. "Entity ... "Entity Display : Pastinaca sativa". Ecoport.org. Retrieved 2018-02-28. "Entity Display : Paulownia tomentosa". Ecoport.org. ...
Asparagus virus 1
rapa Capsicum frutescens Celosia cristata Chenopodium murale Cucumis sativus Cucurbita pepo Datura stramonium Daucus carota ... its host range is limited and it causes only necrotic local lesions in Chenopodium quinoa and no symptoms in Cucumis sativus, ... Nicotiana glutinosa Nicotiana sylvestris Nicotiana tabacum Ocimum basilicum Petunia x hybrida Phaseolus vulgaris Pisum sativum ... Dianthus caryophyllus Glycine max, Gomphrena globosa Lactuca sativa Lilium elegans Lycopersicon esculentum Nicotiana ...
Armenian cucumber
The Armenian cucumber, Cucumis melo var. flexuosus, is a type of long, slender fruit which tastes like a cucumber and looks ... It is actually a variety of muskmelon (C. melo), a species closely related to the cucumber (C. sativus). It is also known as ... Cucumis chate", which is today included in the Armenian variety. It is said by Hasselquist to be the "queen of cucumbers, ... The Cucumis melo subspecies Chate was the most frequently encountered cucurbit in ancient Mediterranean images and texts, and ...
List of vascular plants of Norfolk Island
multicava (Naturalised) Cucurbitaceae Cucumis anguria (Naturalised) Diplocyclos palmatus subsp. affinis Sicyos australis ... Vicia sativa subsp. nigra (Naturalised) Vicia tetrasperma (Naturalised) Vigna marina Frankeniaceae Frankenia pulverulenta ( ... Avena sativa (Naturalised) Axonopus fissifolius (Naturalised) Bothriochloa macra (Naturalised) Briza maxima (Naturalised) Briza ... Coriandrum sativum (Naturalised) Daucus glochidiatus (Naturalised) Foeniculum vulgare (Naturalised) Petroselinum crispum ( ...
List of companion plants
Cucumis sativus L.) in a plastic tunnel". PLoS ONE. 8 (4): 1-7. Bibcode:2013PLoSO...862173X. doi:10.1371/journal.pone.0062173. ... Cucumis sativus L.)". Archives of Phytopathology and Plant Protection. 47 (9): 1112-1119. doi:10.1080/03235408.2013.830809. ... El-Darier, Salama M.; Zein El-Dien, Marwa H. (2011). "Biological activity of Medicago sativa L. (alfalfa) residues on ... Morris, Michael C.; Li, Frank Y. (2000). "Coriander (Coriandrum sativum) "companion plants" can attract hoverflies, and may ...
Phosphoenolpyruvate carboxykinase
It has also been discovered that, in cucumber (Cucumis sativus L.), PEPCK levels are increased by multiple effects that are ...
List of food origins
Clymenia platypoda Clymenia polyandra Corynocarpus cribbianus Cryptocarya aromatica Cucumis sativus (cucumber) Dillenia ... Barley (Hordeum vulgare/sativum, descended from the wild H. spontaneum) Einkorn (Triticum monococcum, descended from the wild T ... Pisum sativum) Carrots Leeks Lettuce Onions Parsley Radishes Almond Linseed (Linum usitatissimum) Asafoetida Mustard Fig (Ficus ... Oryza sativa (rice) Alocasia macrorrhizos (giant taro) Alpinia galanga (lengkuas) Alpinia vanoverberghii (akbab) Amomum acre ( ...
Minerva's Garden (Salerno)
... esculenta Conium maculatum Coriandrum sativum Cornus mas Crataegus azarolus Crithmum maritimum Crocus sativus Cucumis sativus ... majorana Origanum vulgare Osmunda regalis P Paeonia officinalis Pastinaca sativa Petroselinum crispum Petroselinum sativum ...
Bathukamma
Cucumis Sativus leaves & flowers, Memecylon edule, Tridax procumbens, Trachyspermum ammi, Katla, Teku Flowers, etc., which ...
Cucumis dipsaceus
The coloration of the seeds are a caramel brown when dry which can be compared to that of the European cucumber, C. sativus, ... the occurrence of Cucumis dipsaceus in India was reported. The source of Cucumis dipsaceus is unknown; probably the seeds might ... CUCUMIS_DIPSACEUS_EHRENB_EX_SPACH_IN_INDIA/links/551cdb600cf2909047bcaf27.pdf "Cucumis Dipsaceus: Info From PIER (PIER Species ... Cucumis dipsaceus is an annual climbing herb that can be found in different habitats. C. dipsaceus grows in tropical and arid ...
EWG Skin DeepĀ® | What is CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT
CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT, CUCUMIS SATIVUS (CUCUMBER) INFUSION, CUCUMIS SATIVUS EXTRACT, CUCUMIS SATIVUS FRUIT ... Cucumis sativus.. CUCUMBER EXTRACT, CUCUMBER FRUIT EXTRACT, CUCUMBER INFUSION, CUCUMBER, EXT., CUCUMIS SATIVUS (CUCUMBER) ... CUCUMIS SATIVUS INFUSION, EXTRACT OF CUCUMBER, and EXTRACT OF CUCUMIS SATIVUS ... CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT. Click here for all products containing this ingredient ...
CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT || Skin DeepĀ® Cosmetics Database | EWG
CUCUMIS SATIVUS (CUCUMBER) EXTRACT; CUCUMIS SATIVUS EXTRACT; CUCUMIS SATIVUS FRUIT EXTRACT; EXTRACT OF CUCUMBER; EXTRACT OF ... About CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT: Extract of the fruit of the cucumber, Cucumis sativus.. Function(s): Skin- ... Show all 447 recent products that contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT.. ...
Map of Cucumis sativus -- Discover Life
Cucumber Cucumis sativus 'General Lee'
KEGG GENOME: Cucumis sativus (cucumber)
Cucumis sativus Cucumber, Garden cucumber PFAF Plant Database
CUM10 - CUM10 - Cucumis sativus (Cucumber) - CUM10 gene & protein
Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... Camelina sativa (False flax) (Myagrum sativum). Brassica napus (Rape). Capsella bursa-pastoris (Shepherds purse) (Thlaspi ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
Photo of Cucumber (Cucumis sativus 'Straight Eight'): crab spider - Garden.org
WRKY37 - WRKY protein - Cucumis sativus (Cucumber) - WRKY37 gene & protein
Cucumis sativus | Applied and Environmental Microbiology
Cucumis sativus ( Jazzer Cucumber ) | Backyard Gardener
Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.). -...
Expression and epigenetic profile of protoplast cultures ( Cucumis sativus L.) | SpringerLink
CĆ”pal, P., OndÅej, V. Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.). In Vitro Cell.Dev.Biol.- ... Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.). *Petr CĆ”pal1,2. & ... NavrĆ”tilovĆ” B, LuhovĆ” L, PetÅivalský M (2008) Effect of UV-C irradiation on mesophyll protoplasts of Cucumis sativus. Plant ... OndÅej V, NavrĆ”tilovĆ” B, Lebeda A (2009b) The heterochromatin as a marker for protoplast differentiation of Cucumis sativus. ...
Proteomic characterization of iron deficiency responses in Cucumis sativus L. roots
Production of Table Cucumber (Cucumis sativa) on Two Trellis Systems in North Florida
Frontiers | Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress |...
Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress. Xingwang Liu1,2ā ... Citation: Liu X, Liu B, Xue S, Cai Y, Qi W, Jian C, Xu S, Wang T and Ren H (2016) Cucumber (Cucumis sativus L.) Nitric Oxide ...
PPT - Cucumber Cucumis sativus PowerPoint presentation | free to view - id: 1577d4-YjdhO
Cucumis sativus) - Cucumber (Cucumis sativus) Introduction Both cucumbers and melons are members of the same genus: Cucumis ... Cucumber Cucumis sativus. 1. Cucumber (Cucumis sativus)*Introduction *Both cucumbers and melons are members of the same genus ... Cucumis Sativus L. - Cucumis Sativus L. Nick Lorenz May 1, 2006 Phylogeny Interesting Facts Cucumbers originated in India where ... Cucumber Cucumis sativus. Description:. Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ...
Cucumis sativus | definition of Cucumis sativus by Medical dictionary
Cucumis sativus explanation free. What is Cucumis sativus? Meaning of Cucumis sativus medical term. What does Cucumis sativus ... Looking for online definition of Cucumis sativus in the Medical Dictionary? ... Cucumis sativus. Also found in: Dictionary, Thesaurus, Encyclopedia, Wikipedia.. Related to Cucumis sativus: Tribulus ... Cucumis sativus , definition of Cucumis sativus by Medical dictionary https://medical-dictionary.thefreedictionary.com/Cucumis+ ...
Orange-fleshed cucumber ( Cucumis sativus var. sativus L.) germplasm from North-East India: agro-morphological, biochemical and...
Ranjan, P., Pandey, A., Munshi, A.D. et al. Orange-fleshed cucumber (Cucumis sativus var. sativus L.) germplasm from North-East ... Orange-fleshed cucumber (Cucumis sativus var. sativus L.) germplasm from North-East India: agro-morphological, biochemical and ... Qi C, Yuan Z, Li Y (1983) A new type of cucumber-Cucumis sativus L. var. xishuangbannanesis [sic]. Acta Hortic Sin 10:259-264 ... Lv J, Qi J, Shi Q, Shen D, Zhang S, Shao G et al (2012) Genetic diversity and population structure of cucumber (Cucumis sativus ...
Frontiers | The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis...
... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... Liu, L. (2008). Inheritance Analysis and QTL Mapping of Powdery Mildew Resistance in Cucumber (Cucumis sativus L.). Doctors ... The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus ...
The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls - ePrints Soton
Morrell, Clare Katrina (1987) The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls. University of ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ...
PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L.)
Knowing the extent and structure of genetic variation in germplasm collections is essential for the conservation and utilization of biodiversity in cultivated plants. Cucumber is the fourth most important vegetable crop worldwide and is a model system for other Cucurbitaceae, a family that also includes melon, watermelon, pumpkin and squash. Previous isozyme studies revealed a low genetic diversity in cucumber, but detailed insights into the crops genetic structure and diversity are largely missing. We have fingerprinted 3,342 accessions from the Chinese, Dutch and U.S. cucumber collections with 23 highly polymorphic Simple Sequence Repeat (SSR) markers evenly distributed in the genome. The data reveal three distinct populations, largely corresponding to three geographic regions. Population 1 corresponds to germplasm from China, except for the unique semi-wild landraces found in Xishuangbanna in Southwest China and East Asia; population 2 to Europe, America, and Central and West Asia; and population 3
Photosynthetic pigments content, ĆĀ“-aminolevulinic acid dehydratase and acid phosphatase activities and mineral nutrients...
Pot experiments were conducted on cucumber (Cucumis sativus L.) plants in the green house of the National Research Center. ... EFFECTS OF SALICYLIC ACID ON SEEDLING GROWTH AND NITROGEN METABOLISM IN CUCUMBER (CUCUMIS SATIVUS L.). Singh, Pramod Kumar; ... Subplastidic preparations from cotyledons of cucumber (Cucumis sativus L.) were tested for their ability to synthesize ... Cucumis sativus L.) exposed to NaCl stress. Salt stress reduced net photosynthetic rates (P), actual photochemical efficiency ...
24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress | Springer for...
Water/ethanol extract of Cucumis sativus L. fruit attenuates lipopolysaccharide-induced inflammatory response in endothelial...
Effect of Cucumis sativus L. extract (CSE) on LPS induced HO-1 expression. a Expression of HO-1 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS induced TLR4 expression. a Expression of TLR4 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS-induced pAECs toxicity. a Representative images of pAECs morphology under LPS ... Effect of Cucumis sativus L. extract on LPS-induced angiogenesis. pAECs were cultured on a extracellular matrix with LPS (10 μg ...
24-Epibrassinolide alleviates organic pollutants-retarded root elongation by promoting redox homeostasis and secondary...
... organic pollutants-retarded root elongation by promoting redox homeostasis and secondary metabolism in Cucumis sativus L, ... Induction of systemic stress tolerance by brassinosteroid in Cucumis sativus. Xia, X.J.; Zhou, Y.H.; Ding, J.; Shi, K.; Asami, ... Effects of aqueous root extracts and hydrophobic root exudates of cucumber (Cucumis sativus L.) on nuclei DNA content and ... Selective trans-cinnamic acid uptake impairs [Ca2+](cyt) homeostasis and growth in Cucumis sativus L ...
Transcriptomic analysis of short-fruit 1 (sf1) reveals new insights into the variation of fruit-related traits in Cucumis...
... reveals new insights into the variation of fruit-related traits in Cucumis sativus, Scientific Reports" on DeepDyve, the ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), Chinese long 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), Chinese long 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14), a member of the family Cucurbitaceae, is one of the most economically important ...
Testing of disease-resistance of pokeweed antiviral protein gene (PacPAP) in transgenic cucumber (|i|Cucumis sativus|/i|)
...
NOPR: Age dependent alterations in photosystem II acceptor side in <i>Cucumis sativus</i> cotyledonary leaf thylakoids:...
Chill-Induced Inhibition of Photosynthesis: Genotypic Variation within Cucumis sativus : Plant and Cell Physiology - oi
Cucumber is generally a thermophilic species; however, cultivars have been selected for higher yield during winter cultivation in unheated glasshouses in temperate regions. We tested whether photosynthesis in these varieties had greater chilling tolerance. There was no difference in the instantaneous reduction of photosynthesis at low temperature between four winter glasshouse and four summer field cultivars. After 5 d of 10°C and 100 µmol m-2 s-1 photon flux density, the four field cultivars had a sustained depression of photosynthesis after returning to clement conditions. This inhibition was associated with reduced rates of CO2 fixation and photosystem II (PSII) electron transport in the light, but not with sustained PSII photoinhibition. However, photosynthesis in the glasshouse genotypes was nearly identical to the pre-chill rates. Chill impacts on light-adapted chlorophyll fluorescence parameters, such as the quantum yield of PSII electron transport (ĻPSII), correlated well with overall ...
CucurbitaceaeCucumbersMeloEXTRACTGeneHypocotylsSpeciesSeedlingsPisumRaphanusIsolated from cucumberLactucaEmbryogenesisGenesGourdFruitOryzaAlliumExtractsGerminationANNUAL CLIMBERGeneticProteinXishuangbannaProtoplastPlantsErucaCastaneaPhotosyntheticNigellaMedicagoGenomeGermplasmAntioxidant enzymeNicotianaChryseobacteriumCannabis
Cucurbitaceae2
- Cucumber plant is a spicies of Cucumis Sativus, belongs to the family Cucurbitaceae and native to Western Asia. (blogspot.com)
- It is considered to be an endemic virus in greenhouses and field productions of Cucurbitaceae crops, including melon (Cucumis melo), cucumber (Cucumbis sativus), and watermelon (Citrullus lanatus). (wikipedia.org)
Cucumbers7
- Comparison of inoculation methods with Didymella bryoniae on Cucumis sativus cucumbers, stem and fruit rot. (thefreedictionary.com)
- Cucumbers ( Cucumis sativus ) are especially sensitive to the type of downy mildew (Pseudoperonospora cubensis) that affects other cucurbits, including melons, pumpkins and squash. (thefreedictionary.com)
- Royalty free images: picking mini cucumbers Cucumis sativus Author: Benjamin RedeleitDate: 2005-07-31 Maximum available size: 18 Mpix. (tradebit.com)
- Online Buy Huang Gua Zi é»ēå Cucumber Seed Cucumis Sativus L. Pickling Cucumbers Direct From China Herb Market Supplier. (999tcm.shop)
- This bulk herb Huang Gua Zi é»ēå Cucumber Seed Cucumis Sativus L. Pickling Cucumbers i s of premium quality. (999tcm.shop)
- Description : Name: Marketmore 76 Cucumber Scientific Name: Cucumis Sativus Color: Dark Green With Yellow Flowers Plant Seeds: Outdoors After Frost / Indoors Weeks Before Last Frost Harvest: 65 Days Plant Height: 18 - 24" Plant Spacing: Hills Of 2-3 Plants Per Hill Spaced 36-48" Apart Light Requirements: Sun Soil & Water Preferences: Average Quantity: 200 Seeds Other: These Are The Big Ole Cucumbers You Have Been Dreaming Of! (artfire.com)
- In particular, the hosts include watermelons (Citrullus lanatus), cucumbers (Cucumis sativus), and melons (Cucumis melo). (wikipedia.org)
Melo8
- Henan I, Tlili I, R'him T, Ali AB, Jebari H (2016) Carotenoid content and antioxidant activity of local varieties of muskmelon ( Cucumis melo L.) grown in Tunisia. (springer.com)
- Effects of grafting on physiological characteristics of melon (Cucumis melo) seedlings under copper stress. (ebscohost.com)
- The effects of grafting on physiological characters of melon (Cucumis melo) seedlings under copper stress were investigated with Pumpkin Jingxinzhen No.3 as stock and oriental melon IVF09 as scion. (ebscohost.com)
- Honey Dew Melon 'Dulce Nectar' (Cucumis melo var. (davesgarden.com)
- radicis - cucumerinum Vakalounakis (Forc) is the causal agent of root and stem rot in cucurbits resulting in severe damage, particularly in greenhouse cucumber ( Cucumis sativus ) and muskmelon ( C . melo ). (nature.com)
- The reference is to the chate cucumber ( Cucumis melo , var. (encyclopedia.com)
- Cucumis melo agrestis - (Naudin. (pfaf.org)
- Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). (pfaf.org)
EXTRACT6
- The main purpose of the present research was, in a well-defined in vitro model of endothelial cells, to investigate whether a water/ethanol extract of Cucumis sativus L. (CSE) fruit can attenuate the damaging effect of pro-inflammatory lipopolysaccharide (LPS). (biomedcentral.com)
- Moreover, the in vitro angiogenesis induced by inflammatory LPS was prevented by the presence of Cucunis sativus L. extract, at any doses tested. (biomedcentral.com)
- Our results have clearly demonstrated that Cucumis sativus L. extract has attenuated lipopolysaccharide-induced inflammatory response in endothelial cells. (biomedcentral.com)
- Non-sensitizing plant extract (also known by its Latin name of Cucumis sativus). (cosdna.com)
- 0.0001) inhibitory activity by n-butanol fraction of C. sativus fruits extract was maximum, IC50 at a concentration of 52.76 μg/ml. (innovareacademics.in)
- In conclusion, the consumption of C. sativus seed extract with daily dose of 500 mg results in desirable effects on serum lipid profile in adult hyperlipidemic patients. (ac.ir)
Gene7
- Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L. (nih.gov)
- Here, we functionally characterized the cucumber ( Cucumis sativus L .) nitric oxide synthase-associated gene, NITRIC OXIDE ASSOCIATED 1 ( CsNOA1 ). (frontiersin.org)
- Cucumber beetle resistance and mite susceptibility controlled by the bitter gene in Cucumis sativus L. (thefreedictionary.com)
- Altunoglu YC, Baloglu P, Yer EN, Pekol S, Baloglu MC (2016) Identification and expression analysis of LEA gene family members in cucumber genome. (springer.com)
- Molecular cloning and expression analysis of the ethylene insensitive3 (EIN3) gene in cucumber (Cucumis sativus). (qxmd.com)
- cDNA cloning and characterization of a gibberellin-responsive gene in hypocotyls of Cucumis sativus L. (elsevier.com)
- Fingerprint Dive into the research topics of 'cDNA cloning and characterization of a gibberellin-responsive gene in hypocotyls of Cucumis sativus L.'. Together they form a unique fingerprint. (elsevier.com)
Hypocotyls2
- The influence of plant growth regulators on callus induction from hypocotyls of cucumber (Cucumis sativus L. (thefreedictionary.com)
- Cucumber hypocotyls (Cucumis sativus L. (elsevier.com)
Species4
- Ondrej V, Navratilova B, Lebeda A (2002) Influence of GA 3 on the zygotic embryogenesis of Cucumis species in vitro . (springer.com)
- Hypocotyl explants have been used to achieve regenerated plants in several species including Capsicum (Gunay and Rao, 1978), Peganum harmala (Ehsanpour and Saadat, 2002), and Cucumis sativus (Andr'yskova et al. (thefreedictionary.com)
- sativus, the carrot, a plant species. (wikipedia.org)
- 8 Foot Sativa, a New Zealand-based metal band Sativa (JhenƩ Aiko song) Sativanorte and Sativasur, towns/municipalities in the Colombian department of BoyacƔ Sativum (disambiguation) Sativus (disambiguation) Allen J. Coombes The A to Z of Plant Names: A Quick Reference Guide to 4000 Garden Plants, p. 59, at Google Books The major species of Cannabis are sativa, indica, and ruderalis. (wikipedia.org)
Seedlings3
- Peroxidase activity (POD) and catalase (CAT) in seeds (2, 12 and 24 hours) and seedlings (168 hours) of Cucumis sativus L. (thefreedictionary.com)
- We investigated the effects of exogenous spermidine (Spd) on growth, photosynthesis and expression of the Calvin cycle-related genes in cucumber seedlings ( Cucumis sativus L.) exposed to NaCl stress. (ebscohost.com)
- Effect of seed pretreatment by magnetic field on the sensitivity of cucumber ( Cucumis sativus ) seedlings to ultraviolet-B radiation. (thefreedictionary.com)
Pisum2
- For example, the masculine Crocus sativus and neuter Pisum sativum. (wikipedia.org)
- Pisum sativum, pea plant. (wikipedia.org)
Raphanus3
- Cucumis sativus (cucumber), Raphanus sativus radicula (radish) and Eruca vesicaria sativa (rocket salad). (thefreedictionary.com)
- Changes in Growth, Biochemical Constituents, and Antioxidant Potentials in Radish ( Raphanus sativus L.) under Cobalt Stress. (ebscohost.com)
- The effects of cobalt (Co) stress on seedling vigor, photosynthetic pigment content, biochemical constituents, mineral status, and the activity of antioxidant enzymes in Raphanus sativus L. were studied. (ebscohost.com)
Isolated from cucumber1
- A full-length cDNA encoding transketolase (TK, designated as CsTK) was isolated from cucumber leaves (Cucumis sativa L. cv 'Jinyou 3') by RT-PCR and RACE. (qxmd.com)
Lactuca1
- Lactuca sativa, Lollo rosso lettuce. (wikipedia.org)
Embryogenesis4
- Malinowski R, Filipecky M, Tagashira N, Wisniewska A, Gaj P, Plader W, Malepsy S (2004) Xyloglucan endotransglucosylase/hydrolase genes in cucumber ( Cucumis sativus )-differential expression during somatic embryogenesis. (springer.com)
- Somatic embryogenesis and plant regeneration from cell suspension cultures of Cucumis sativus L. (thefreedictionary.com)
- To improve somatic embryogenesis of Cucumis sativus , two types of explants (cotyledons and stem sections) were cultured on Murashige and Skoog (MS) media supplemented with 2,4-D (2.0 mgĀ·L -1 ) + kinetin (0.5 mgĀ·L -1 ). (ashs.org)
- Embryogenesis and Plant Regeneration from Cotyledon Protoplast Culture of Cucumber ( Cucumis sativus L. (naver.com)
Genes3
- Transcriptomic analysis reveals the roles of microtubule-related genes and transcription factors in fruit length regulation in cucumber (Cucumis sativus L. (deepdyve.com)
- Brassinosteroids promote photosynthesis and growth by enhancing activation of Rubisco and expression of photosynthetic genes in Cucumis sativus. (qxmd.com)
- Effects of light quality on CO2 assimilation, chlorophyll-fluorescence quenching, expression of Calvin cycle genes and carbohydrate accumulation in Cucumis sativus. (qxmd.com)
Gourd2
- Chen JF, Zhang SL, Zhang XG (1994) The Xishuangbanna gourd ( Cucumis sativus var. (springer.com)
- In host range studies, Cucumber ( Cucumis sativus L.), Ash gourd (Benincasa hispida Thumb. (thefreedictionary.com)
Fruit5
- Cuevas HE, Song H, Staub JE, Simon PW (2010) Inheritance of beta-carotene-associated flesh color in cucumber ( Cucumis sativus L.) fruit. (springer.com)
- In the present study, we have investigated the mechanism through which carbon dioxide induces ethylene biosynthesis in cucumber ( Cucumis sativus L.) fruit. (oup.com)
- The present study was designed to screen the anti-aging and anti-wrinkle potential of Cucumis sativus fruit through in vitro estimation of antioxidant, anti-hyaluronidase, anti-elastase, anti-collagenase/anti-matrix metalloproteinase (MMP)-1, and anti-tyrosinase activity. (innovareacademics.in)
- In the study of the lyophilized juice of Cucumis sativus fruit (CSLJ) and its antioxidant , anti-hyaluronidase, and anti-elastase activity found that Content of ascorbic acid was calculated with respect to the standard compound and it was found to be 3.5 ± 0.23% w/w. (blogspot.com)
- CSLJ is the rich source of ascorbic acid and this study thereby rationalizes the use of C. sativus as potential anti-wrinkle agent in cosmetic products, according to " Cucumis sativus fruit-potential antioxidant , anti-hyaluronidase, and anti-elastase agen t" by Nema NK, Maity N, Sarkar B, Mukherjee PK. (blogspot.com)
Oryza1
- Antioxidant and anti-aging assays of Oryza sativa extracts, vanillin and coumaric acid. (innovareacademics.in)
Allium1
- Examples Examples of crops incorporating this word and its variations into their Latin name include: Allium sativum, garlic. (wikipedia.org)
Extracts2
- 3) Evaluation of the Effects of Cucumis sativus Seed Extracts on Serum Lipids in Adult Hyperlipidemic Patients: A Randomized Double-Blind Placebo-Controlled Clinical Trial. (brettelliott.com)
- In the research of six plant parts (leaves, stems, roots, whole fruits, calyxes, and fruits without calyxes) of Cucumis sativus and theirs inhibitory effects on melanogenesis found that the depigmenting mechanism of extracts from leaves and stems of C. SATIVUS involves the expression of tyrosinase. (blogspot.com)
Germination1
- Percentage, germination speed index (GSI) and average time of germination (AGT) of Cucumis sativus L. (thefreedictionary.com)
ANNUAL CLIMBER1
- Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). (pfaf.org)
Genetic5
- Aydemir I (2009) Determination of genetic diversity in cucumber ( Cucumis sativus L.) germplasms. (springer.com)
- Bisht IS, Bhat KV, Tanwar SPS, Bhandari DC, Joshi K, Sharma AK (2004) Distribution and genetic diversity of Cucumis sativus var. (springer.com)
- Horejsi T, Staub JE (1999) Genetic variation in cucumber ( Cucumis sativus L.) as assessed by random amplified poly-morphic DNA. (springer.com)
- PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L. (plos.org)
- Genetic Diversity and Population Structure of Cucumber ( Cucumis sativus L. (plos.org)
Protein1
- We monitored the protein, chlorophyll and electron transport activities in Cucumis sativus cv Poinsette cotyledonary leaves and observed that by 20th day, there was a 50%, 41 % and 30-33% decline in the chlorophyll, protein and photosystem II activity respectively when compared to 6th day cotyledonary leaves taken as control. (niscair.res.in)
Xishuangbanna1
- Molecular mapping reveals structural rearrangements and quantitative trait loci underlying traits with local adaptation in semi-wild Xishuangbanna cucumber (Cucumis sativus L. var. (deepdyve.com)
Protoplast3
- Expression and epigenetic profile of protoplast cultures ( Cucumis sativus L. (springer.com)
- GajdovƔ J, NavrƔtilovƔ B, SmolnƔ J, Lebeda A (2007) Factors affecting protoplast isolation and cultivation of Cucumis spp. (springer.com)
- OndÅej V, NavrĆ”tilovĆ” B, Lebeda A (2009b) The heterochromatin as a marker for protoplast differentiation of Cucumis sativus . (springer.com)
Plants4
- Increasing Resistance to Oxidative Damage in Cucumber (Cucumis sutivus L.) Plants by Exogenous Application of Salicylic Acid and Paclobutrazol. (ebscohost.com)
- Pot experiments were conducted on cucumber (Cucumis sativus L.) plants in the green house of the National Research Center. (ebscohost.com)
- To view Cucumis plants offered near you, enter your postcode or log in . (greenplantswap.co.uk)
- Cannabidiol is one of the components of the Cannabis sativa and Cannabis indica plants. (paulaschoice.com)
Eruca1
- Eruca sativa, the rocket or arugula, a leaf vegetable. (wikipedia.org)
Castanea1
- Castanea sativa, sweet chestnut. (wikipedia.org)
Photosynthetic1
- Kinetin improves photosynthetic and antioxidant responses of Nigella sativa to counteract salt stress. (ebscohost.com)
Nigella1
- The present study involves analysis of growth, photosynthesis, oxidant (HO) accumulation, and antioxidant enzyme activities in Nigella sativa L. as affected by foliar kinetin (KIN) application during salt stress. (ebscohost.com)
Medicago1
- Medicago sativa, alfalfa. (wikipedia.org)
Genome1
- The genome of the cucumber, Cucumis sativus L. (genome.jp)
Germplasm1
- Thirteen (Three gynoecious and ten monoecious) germplasm lines of cucumber ( Cucumber sativus L.) were characterized by sodium dodecyl sulphate polyacrylamide vertical slab gel electrophoresis (SDS-PAGE). (ijcmas.com)
Antioxidant enzyme1
- Senescence delay and change of antioxidant enzyme levels in Cucumis sativus L. (thefreedictionary.com)
Nicotiana1
- Stable-isotope-labelled (2H6, 18O) 3-hydroxy-3-phenylpropanoic acid, a putative intermediate in the biosynthesis of benzoic acid (BA) and salicylic acid (SA) from cinnamic acid, has been synthesized and administered to cucumber (Cucumis sativus L.) and Nicotiana attenuata (Torrey). (nih.gov)
Chryseobacterium2
- Chryseobacterium cucumeris sp. (elsevier.com)
- Fingerprint Dive into the research topics of 'Chryseobacterium cucumeris sp. (elsevier.com)
Cannabis1
- Cannabis sativa, one of three forms of cannabis. (wikipedia.org)