A creeping annual plant species of the CUCURBITACEAE family. It has a rough succulent, trailing stem and hairy leaves with three to five pointed lobes.
A plant species of the family CUCURBITACEAE, order Violales, subclass Dilleniidae known for the melon fruits with reticulated (net) surface including cantaloupes, honeydew, casaba, and Persian melons.
A plant genus of the family CUCURBITACEAE, order Violales, subclass Dilleniidae best known for cucumber (CUCUMIS SATIVUS) and cantaloupe (CUCUMIS MELO). Watermelon is a different genus, CITRULLUS. Bitter melon may refer to MOMORDICA or this genus.
A plant genus of the family BRASSICACEAE known for its peppery red root.
The gourd plant family of the order Violales, subclass Dilleniidae, class Magnoliopsida. It is sometimes placed in its own order, Cucurbitales. 'Melon' generally refers to CUCUMIS; CITRULLUS; or MOMORDICA.
A plant genus, in the IRIDACEAE family, known as a source of Saffron.
A plant genus of the family APIACEAE. The leaves are the source of cilantro and the seeds are the source of coriander, both of which are used in SPICES.
A plant genus of the family LYTHRACEAE that is the source of henna and has cytotoxic activity.
A genus of OOMYCETES in the family Peronosporaceae. Most species are obligatory parasites and many are plant pathogens.
A plant genus in the family FABACEAE known for LATHYRISM poisoning.
An enzyme that converts ascorbic acid to dehydroascorbic acid. EC 1.10.3.3.
A plant genus of the family CUCURBITACEAE, order Violales, subclass Dilleniidae, which includes pumpkin, gourd and squash.
A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)
A FLAVOPROTEIN enzyme for AMMONIA assimilation in BACTERIA, microorganisms and PLANTS. It catalyzes the oxidation of 2 molecules of L-GLUTAMATE to generate L-GLUTAMINE and 2-oxoglutarate in the presence of NAD+.
The usually underground portions of a plant that serve as support, store food, and through which water and mineral nutrients enter the plant. (From American Heritage Dictionary, 1982; Concise Dictionary of Biology, 1990)
A photo-active pigment localized in prolamellar bodies occurring within the proplastids of dark-grown bean leaves. In the process of photoconversion, the highly fluorescent protochlorophyllide is converted to chlorophyll.
Complex nucleoprotein structures which contain the genomic DNA and are part of the CELL NUCLEUS of PLANTS.
Proteins found in plants (flowers, herbs, shrubs, trees, etc.). The concept does not include proteins found in vegetables for which VEGETABLE PROTEINS is available.
Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)
Very young plant after GERMINATION of SEEDS.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in plants.
Any of the hormones produced naturally in plants and active in controlling growth and other functions. There are three primary classes: auxins, cytokinins, and gibberellins.
Deoxyribonucleic acid that makes up the genetic material of plants.
The region of the stem beneath the stalks of the seed leaves (cotyledons) and directly above the young root of the embryo plant. It grows rapidly in seedlings showing epigeal germination and lifts the cotyledons above the soil surface. In this region (the transition zone) the arrangement of vascular bundles in the root changes to that of the stem. (From Concise Dictionary of Biology, 1990)
Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.
The genetic complement of a plant (PLANTS) as represented in its DNA.
The functional hereditary units of PLANTS.
Porphyrin derivatives containing magnesium that act to convert light energy in photosynthetic organisms.
Books containing photographs, prints, drawings, portraits, plates, diagrams, facsimiles, maps, tables, or other representations or systematic arrangement of data designed to elucidate or decorate its contents. (From The ALA Glossary of Library and Information Science, 1983, p114)
Diseases of plants.
The fleshy or dry ripened ovary of a plant, enclosing the seed or seeds.
Use of written, printed, or graphic materials upon or accompanying a product or its container or wrapper. It includes purpose, effect, description, directions, hazards, warnings, and other relevant information.
A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.
A class of Echinodermata characterized by long, slender bodies.
Cultivation of PLANTS; (FRUIT; VEGETABLES; MEDICINAL HERBS) on small plots of ground or in containers.
The ability to detect chemicals through gustatory receptors in the mouth, including those on the TONGUE; the PALATE; the PHARYNX; and the EPIGLOTTIS.
A plant genus of the family RANUNCULACEAE that contains alpha-hederin, a triterpene saponin in the seeds, and is the source of black seed oil.
Surgical removal of an obstructing clot or foreign material from a blood vessel at the point of its formation. Removal of a clot arising from a distant site is called EMBOLECTOMY.
All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.
Auditory and visual instructional materials.
A self-learning technique, usually online, involving interaction of the student with programmed instructional materials.
Plant steroids ubiquitously distributed throughout the plant kingdom. They play essential roles in modulating growth and differentiation of cells at nanomolar to micromolar concentrations.
Steroidal compounds in which one or more carbon atoms in the steroid ring system have been substituted with non-carbon atoms.
Contamination of the air, bodies of water, or land with substances that are harmful to human health and the environment.
Cholestanes substituted in any position with one or more hydroxy groups. They are found in feces and bile. In contrast to bile acids and salts, they are not reabsorbed.
Ribosome inactivating proteins consisting of only the toxic A subunit, which is a polypeptide of around 30 kDa.
A plant genus of the family PHYTOLACCACEAE, order Caryophyllales.
A class of enzymes involved in the hydrolysis of the N-glycosidic bond of nitrogen-linked sugars.
A plant species of the family PHYTOLACCACEAE. The root has been used in traditional medicine and contains POKEWEED MITOGENS, triterpene glycosides, and antiviral protein.
The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide using energy obtained from light rather than from the oxidation of chemical compounds. Photosynthesis comprises two separate processes: the light reactions and the dark reactions. In higher plants; GREEN ALGAE; and CYANOBACTERIA; NADPH and ATP formed by the light reactions drive the dark reactions which result in the fixation of carbon dioxide. (from Oxford Dictionary of Biochemistry and Molecular Biology, 2001)
A large multisubunit protein complex found in the THYLAKOID MEMBRANE. It uses light energy derived from LIGHT-HARVESTING PROTEIN COMPLEXES to catalyze the splitting of WATER into DIOXYGEN and of reducing equivalents of HYDROGEN.

Thiol-dependent degradation of protoporphyrin IX by plant peroxidases. (1/376)

Protoporphyrin IX (PP) is the last porphyrin intermediate in common between heme and chlorophyll biosynthesis. This pigment normally does not accumulate in plants because its highly photodynamic nature makes it toxic. While the steps leading to heme and chlorophylls are well characterized, relatively little is known of the metabolic fate of excess PP in plants. We have discovered that plant peroxidases can rapidly degrade this pigment in the presence of thiol-containing substrates such as glutathione and cysteine. This thiol-dependent degradation of PP by horseradish peroxidase consumes oxygen and is inhibited by ascorbic acid.  (+info)

Enhancer-like properties of an RNA element that modulates Tombusvirus RNA accumulation. (2/376)

Prototypical defective interfering (DI) RNAs of the plus-strand RNA virus tomato bushy stunt virus contain four noncontiguous segments (regions I-IV) derived from the viral genome. Region I corresponds to 5'-noncoding sequence, regions II and III are derived from internal positions, and region IV represents a 3'-terminal segment. We analyzed the internally located region III in a prototypical DI RNA to understand better its role in DI RNA accumulation. Our results indicate that (1) region III is not essential for DI RNA accumulation, but molecules that lack it accumulate at significantly reduced levels ( approximately 10-fold lower), (2) region III is able to function at different positions and in opposite orientations, (3) a single copy of region III is favored over multiple copies, (4) the stimulatory effect observed on DI RNA accumulation is not due to region III-mediated RNA stabilization, (5) DI RNAs lacking region III permit the efficient accumulation of head-to-tail dimers and are less effective at suppressing helper RNA accumulation, and (6) negative-strand accumulation is also significantly depressed for DI RNAs lacking region III. Collectively, these results support a role for region III as an enhancer-like element that facilitates DI RNA replication. A scanning-type mutagenesis strategy was used to define portions of region III important for its stimulatory effect on DI RNA accumulation. Interestingly, the results revealed several differences in the requirements for activity when region III was in the forward versus the reverse orientation. In the context of the viral genome, region III was found to be essential for biological activity. This latter finding defines a critical role for this element in the reproductive cycle of the virus.  (+info)

Conversion of cucumber linoleate 13-lipoxygenase to a 9-lipoxygenating species by site-directed mutagenesis. (3/376)

Multiple lipoxygenase sequence alignments and structural modeling of the enzyme/substrate interaction of the cucumber lipid body lipoxygenase suggested histidine 608 as the primary determinant of positional specificity. Replacement of this amino acid by a less-space-filling valine altered the positional specificity of this linoleate 13-lipoxygenase in favor of 9-lipoxygenation. These alterations may be explained by the fact that H608V mutation may demask the positively charged guanidino group of R758, which, in turn, may force an inverse head-to-tail orientation of the fatty acid substrate. The R758L+H608V double mutant exhibited a strongly reduced reaction rate and a random positional specificity. Trilinolein, which lacks free carboxylic groups, was oxygenated to the corresponding (13S)-hydro(pero)xy derivatives by both the wild-type enzyme and the linoleate 9-lipoxygenating H608V mutant. These data indicate the complete conversion of a linoleate 13-lipoxygenase to a 9-lipoxygenating species by a single point mutation. It is hypothesized that H608V exchange may alter the orientation of the substrate at the active site and/or its steric configuration in such a way that a stereospecific dioxygen insertion at C-9 may exclusively take place.  (+info)

Cucumber cotyledon lipoxygenase during postgerminative growth. Its expression and action on lipid bodies. (4/376)

In cucumber (Cucumis sativus), high lipoxygenase-1 (LOX-1) activity has been detected in the soluble fraction prepared from cotyledons of germinating seeds, and the involvement of this enzyme in lipid turnover has been suggested (K. Matsui, M. Irie, T. Kajiwara, A. Hatanaka [1992] Plant Sci 85: 23-32; I. Fuessner, C. Wasternack, H. Kindl, H. Kuhn [1995] Proc Natl Acad Sci USA 92: 11849-11853). In this study we have investigated the expression of the gene lox-1, corresponding to the LOX-1 enzyme. LOX-1 expression is highly coordinated with that of a typical glyoxysomal enzyme, isocitrate lyase, during the postgerminative stage of cotyledon development. In contrast, although icl transcripts accumulated in tissue during in vitro senescence, no accumulation of lox-1 mRNA could be observed, suggesting that lox-1 plays a specialized role in fat mobilization. LOX-1 is also known to be a major lipid body protein. The partial peptide sequences of purified LOX-1 and lipid body LOX-1 entirely coincided with that deduced from the lox-1 cDNA sequence. The data strongly suggest that LOX-1 and lipid body LOX-1 are derived from a single gene and that LOX-1 can exist both in the cytosol and on the lipid bodies. We constructed an in vitro oxygenation system to address the mechanism of this dual localization and to investigate the action of LOX-1 on lipids in the lipid bodies. LOX-1 cannot act on the lipids in intact lipid bodies, although degradation of lipid body proteins, either during seedling growth or by treatment with trypsin, allows lipid bodies to become susceptible to LOX-1. We discuss the role of LOX-1 in fat mobilization and its mechanism of action.  (+info)

Both RNA rearrangement and point mutation contribute to repair of defective chimeric viral genomes to form functional hybrid viruses in plants. (5/376)

The putative movement protein gene (p27) plus 5' and 3' flanking sequences of cucumber leaf spot aureusvirus (CLSV) was inserted into an infectious cucumber necrosis tombusvirus (CNV) cDNA clone containing a deletion in the cell-to-cell movement protein gene. Approximately 5% of plants inoculated with synthetic transcripts of two such defective chimeric CNV/CLSV cDNA clones developed systemic symptoms 7-19 days postinoculation. Reverse transcription-polymerase chain reaction and sequence analysis of virus obtained from systemically infected leaves indicated that both point mutation and RNA rearrangement (deletion) contributed to the formation of movement competent CNV/CLSV hybrid viruses. The hybrid viruses were found to accumulate to high levels in infected plants, to form stable virions, and to be mechanically transmissible. In addition, a hybrid virus that lacked 50 amino acids at the carboxyl-terminal region of CLSV p27 was still capable of facilitating CNV movement. These data provide experimental evidence for the role of CLSV p27 in viral cell-to-cell movement and demonstrate that p27 can enable efficient movement of the CNV genome. Moreover, the data show that RNA rearrangements known to occur during CNV RNA replication can contribute to rapid evolution of the CNV genome.  (+info)

alpha-oxidation of fatty acids in higher plants. Identification of a pathogen-inducible oxygenase (piox) as an alpha-dioxygenase and biosynthesis of 2-hydroperoxylinolenic acid. (6/376)

A pathogen-inducible oxygenase in tobacco leaves and a homologous enzyme from Arabidopsis were recently characterized (Sanz, A., Moreno, J. I., and Castresana, C. (1998) Plant Cell 10, 1523-1537). Linolenic acid incubated at 23 degrees C with preparations containing the recombinant enzymes underwent alpha-oxidation with the formation of a chain-shortened aldehyde, i.e., 8(Z),11(Z), 14(Z)-heptadecatrienal (83%), an alpha-hydroxy acid, 2(R)-hydroxy-9(Z),12(Z),15(Z)-octadecatrienoic acid (15%), and a chain-shortened fatty acid, 8(Z),11(Z),14(Z)-heptadecatrienoic acid (2%). When incubations were performed at 0 degrees C, 2(R)-hydroperoxy-9(Z),12(Z),15(Z)-octadecatrienoic acid was obtained as the main product. An intermediary role of 2(R)-hydroperoxy-9(Z), 12(Z),15(Z)-octadecatrienoic acid in alpha-oxidation was demonstrated by re-incubation experiments, in which the hydroperoxide was converted into the same alpha-oxidation products as those formed from linolenic acid. 2(R)-Hydroperoxy-9(Z),12(Z), 15(Z)-octadecatrienoic acid was chemically unstable and had a half-life time in buffer of about 30 min at 23 degrees C. Extracts of cells expressing the recombinant oxygenases accelerated breakdown of the hydroperoxide (half-life time, about 3 min at 23 degrees C), however, this was not attributable to the recombinant enzymes since the same rate of hydroperoxide degradation was observed in the presence of control cells not expressing the enzymes. No significant discrimination between enantiomers was observed in the degradation of 2(R,S)-hydroperoxy-9(Z)-octadecenoic acid in the presence of recombinant oxygenases. A previously studied system for alpha-oxidation in cucumber was re-examined using the newly developed techniques and was found to catalyze the same conversions as those observed with the recombinant enzymes, i.e. enzymatic alpha-dioxygenation of fatty acids into 2(R)-hydroperoxides and a first order, non-stereoselective degradation of hydroperoxides into alpha-oxidation products. It was concluded that the recombinant enzymes from tobacco and Arabidopsis were both alpha-dioxygenases, and that members of this new class of enzymes catalyze the first step of alpha-oxidation in plant tissue.  (+info)

Spider mite-induced (3S)-(E)-nerolidol synthase activity in cucumber and lima bean. The first dedicated step in acyclic C11-homoterpene biosynthesis. (7/376)

Many plant species respond to herbivory with de novo production of a mixture of volatiles that attracts carnivorous enemies of the herbivores. One of the major components in the blend of volatiles produced by many different plant species in response to herbivory by insects and spider mites is the homoterpene 4,8-dimethyl-1,3(E), 7-nonatriene. One study (J. Donath, W. Boland [1995] Phytochemistry 39: 785-790) demonstrated that a number of plant species can convert the acyclic sesquiterpene alcohol (3S)-(E)-nerolidol to this homoterpene. Cucumber (Cucumis sativus L.) and lima bean (Phaseolus lunatus L.) both produce 4,8-dimethyl-1,3(E),7-nonatriene in response to herbivory. We report the presence in cucumber and lima bean of a sesquiterpene synthase catalyzing the formation of (3S)-(E)-nerolidol from farnesyl diphosphate. The enzyme is inactive in uninfested cucumber leaves, slightly active in uninfested lima bean leaves, and strongly induced by feeding of the two-spotted spider mite (Tetranychus urticae Koch) on both plant species, but not by mechanical wounding. The activities of the (3S)-(E)-nerolidol synthase correlated well with the levels of release of 4, 8-dimethyl-1,3(E),7-nonatriene from the leaves of the different treatments. Thus, (3S)-(E)-nerolidol synthase is a good candidate for a regulatory role in the release of the important signaling molecule 4,8-dimethyl-1,3(E),7-nonatriene.  (+info)

Phloem long-distance transport of CmNACP mRNA: implications for supracellular regulation in plants. (8/376)

Direct support for the concept that RNA molecules circulate throughout the plant, via the phloem, is provided through the characterisation of mRNA from phloem sap of mature pumpkin (Cucurbita maxima) leaves and stems. One of these mRNAs, CmNACP, is a member of the NAC domain gene family, some of whose members have been shown to be involved in apical meristem development. In situ RT-PCR analysis revealed the presence of CmNACP RNA in the companion cell-sieve element complex of leaf, stem and root phloem. Longitudinal and transverse sections showed continuity of transcript distribution between meristems and sieve elements of the protophloem, suggesting CmNACP mRNA transport over long distances and accumulation in vegetative, root and floral meristems. In situ hybridization studies conducted on CmNACP confirmed the results obtained using in situ RT-PCR. Phloem transport of CmNACP mRNA was proved directly by heterograft studies between pumpkin and cucumber plants, in which CmNACP transcripts were shown to accumulate in cucumber scion phloem and apical tissues. Similar experiments were conducted with 7 additional phloem-related transcripts. Collectively, these studies established the existence of a system for the delivery of specific mRNA transcripts from the body of the plant to the shoot apex. These findings provide insight into the presence of a novel mechanism likely used by higher plants to integrate developmental and physiological processes on a whole-plant basis.  (+info)

cucumber plant leaves baby cucumber plant cucumber seeds baby baby cucumber plant leaves cucumber plant leaves turning yellow brown.. new cucumber plant leaves turning white why do turn brown whats wrong with my garden university of extension,why do cucumber plant leaves turn brown yellow spots are turning how to prevent them,cucumber plant leaves drying up mosaic virus turning yellow and dying wilting,cucumber plant leaves curling up turning yellow brown the down side of downy mildew botanical garden spots,cucumber plant leaves turning yellow and dying yellowing brown spots on plants wilting,cucumber plant leaves wilting yellow brown and dying gardening new turning white bottom,young cucumber plants stock photo ac plant leaves drooping drying up turning white,why do cucumber plant leaves turn brown yellow edges wilting dying,why are the leaves on my cucumber seedlings curling up home plant turning brown yellow do turn,cucumber plant bottom leaves dying yellow brown and gardening drooping ...
Osmopriming is a technique in which the seed of different plant species is partially or fully hydrated with water or solutions with different osmotic potentials aiming to intensify physiological processes, what improves and excellerates germination. In our study cucumber seed (Cucumis sativus L.) from three different production years was osmoprimed with 300 μM solutions of two different hydrogen sulphide donors: slowly releasing donor GYY4137 and fast releasing donor NaHS. After imbibition, seed was dried and germinated on filter paper moistened with 25 mM NaCl solution or water, respectively. Main hypothesis was that H2S influences germination and vigour of cucumber seedlings germinated in the presence of salt, and that applied H2S donors (NaHS and GYY4137) will differ significantly in their effect. In treatment with NaHS the oldest seed from production year 2009/2010 had significantly lower standard germination and germination energy, while in treatment with GYY4137 differences among seed ...
An experiment was carried out in the plastic house of Horticulture Department/college of Agriculture/ Duhok University on Cucumber plants during 2009 growing season to determine the effect of bread yeast and seaweed extracts Alga 600 and sea force 2 on growth, yield and its component on Cucumber C.V. shadi. The results showed that spraying bread yeast or seaweed extract resulted in positive significant difference in shoot characteristics and in all yield traits as compared to untreated treatment. The interaction between yeast and seaweed extract was significantly enhanced all detected traits. Since cucumber plant received 6 g.l-1 bread yeast and sprayed with a mixture of 0.33ml.l-1 Alga 600 +2.5 ml.l-1 Sea force 2 were characterized by the highest values of all shoot and yield characteristics.
TY - JOUR. T1 - Expression characteristics of CS-ACS1, CS-ACS2 and CS-ACS3, three members of the 1-aminocyclopropane-1-carboxylate synthase gene family in cucumber (Cucumis sativus L.) fruit under carbon dioxide stress. AU - Mathooko, Francis M.. AU - Mwaniki, Mercy W.. AU - Nakatsuka, Akira. AU - Shiomi, Shinjiro. AU - Kubo, Yasutaka. AU - Inaba, Akitsugu. AU - Nakamura, Reinosuke. N1 - Funding Information: This work was supported by a Grant-in-Aid (no. 97127) to Dr. F.M. Mathooko from the Japan Society for the Promotion of Science (JSPS). Dr. F.M. Mathooko and Ms. M.W. Mwaniki are grateful to JSPS for a Postdoctoral Fellowship and Japan International Cooperation Agency for a Technical Training Scholarship, respectively. Copyright: Copyright 2017 Elsevier B.V., All rights reserved.. PY - 1999. Y1 - 1999. N2 - We investigated the expression pattern of three 1-aminocyclopropane-1-carboxylate (ACC) synthase genes, CS-ACS1, CS-ACS2 and CS-ACS3 in cucumber (Cucumis sativus L.) fruit under CO2 ...
XXXVI-th WILGA Symposium is the event in International Year of Light 2015 organized with UNESCO. Clic HERE for more infiormation. ...
Its name immediately makes you want to know more - exploding cucumber plant or squirting cucumber plant. So what are squirting cucumber plants? Where on earth does the volatile squirting cucumber grow? Click this article to learn more.
Cucumis Sativus Fruit Extract. Cucumis sativus (cucumber) fruit extract functions as an antioxidant, anti-inflammatory agent, and skin-conditioning agent in cosmetics and personal care products.. Antioxidants is naturally found in cucumber fruit extract, ascorbic acid, beta carotene and caffeic acid. Cucumbers also contain antioxidant flavonoids, such as quercetin, apigenin, luteolin, and kaempferol, which provide additional benefits. A 2011 study published in the Archives of Dermatological Research determined that the ascorbic acid found in cucumber exhibited significant free radical scavenging activity. The researchers concluded that cucumber fruit extract warrants consideration for its potential used as an anti-wrinkle ingredient in cosmetic formulations.. Antioxidants limit oxidative damage caused by free radicals. Free radicals are dangerous because they are highly reactive and will try to become more stable by ripping electrons off all nearby molecules. This is problematic because free ...
Lipid bodies are cellular compartments containing triacylglycerols. They are encompassed by a phospholipid monolayer and decorated with characteristic proteins. In plants, lipid bodies are synthesized during seed formation but acquire new proteins during seed germination. In germinating cucumber (Cucumis sativus) seeds, the set of newly synthesized proteins appearing in the lipid bodies at the early stage of triacylglycerol mobilization comprises a special form of lipoxygenase. We isolated the lipid body lipoxygenase and characterized fragments prepared by limited proteolysis and cleavage with cyanogen bromide. A very early expression of lipid body lipoxygenase was found by studying the rate of de novo synthesis of lipoxygenase forms during germination. This allowed a clear distinction of this enzyme from other lipoxygenase isoforms. Hence, for determining the molecular structure of lipid body lipoxygenase we analyzed a cDNA prepared from mRNA of cotyledons at day 1 of germination. From the cDNA ...
Cosmetic Analysis has rated the ingredient Cucumis Sativus. Alternative names: Cucumber Extract; Cucumber Oil; Gurke; Gurken-Extrakt | Origin: Plant-derived...
CHIQUITO, Adrielle Aparecida; GOMES JUNIOR, Francisco Guilhien and MARCOS-FILHO, Julio. Assessment of physiological potential of cucumber seeds using the software Seedling Vigor Imaging System® (SVIS®). Rev. bras. sementes [online]. 2012, vol.34, n.2, pp.255-263. ISSN 0101-3122. http://dx.doi.org/10.1590/S0101-31222012000200010.. The software Seed Vigor Imaging System (SVIS®), has been successfully used to evaluate seed physiological potential by automated analyses of scanned seedlings. In this research, the efficiency of this system was compared to other tests accepted for assessing cucumber (Cucumis sativus L.) seed vigor of distinct seed lots of Supremo and Safira cultivars. Seeds were subjected to germination, traditional and saturated salt accelerated aging, seedling emergence, seedling length and SVIS analyses (determination of vigor indices and seedling growth uniformity, lengths of primary root, hypocotyl and whole seedlings). It was also determined whether the definition of seedling ...
Changes in lipoxygenase (LOX) protein pattern and/or activity were investigated in relation to acquired resistance of cucumber (Cucumis sativus L.) leaves against two powdery mildews, Sphaerotheca fuliginea (Schlecht) Salmon and Erysiphe cichoracearum DC et Merat. Acquired resistance was established by spraying leaves with salicylic acid (SA) or 2,6-dichloroisonicotinic acid (INA) and estimated in whole plants by infested leaf area compared to control plants. SA was more effective than INA. According to Western blots, untreated cucumber leaves contained a 97 kDa LOX form, which remained unchanged for up to 48 h after pathogen inoculation. Upon treatment with SA alone for 24 h or with INA plus pathogen, an additional 95 kDa LOX form appeared which had an isoelectric point in the alkaline range. For the induction of this form, a threshold concentration of 1 mM SA was required, higher SA concentrations did not change LOX-95 expression which remained similar between 24 h and 96 h but further ...
Changes in lipoxygenase (LOX) protein pattern and/or activity were investigated in relation to acquired resistance of cucumber (Cucumis sativus L.) leaves against two powdery mildews, Sphaerotheca fuliginea (Schlecht) Salmon and Erysiphe cichoracearum DC et Merat. Acquired resistance was established by spraying leaves with salicylic acid (SA) or 2,6-dichloroisonicotinic acid (INA) and estimated in whole plants by infested leaf area compared to control plants. SA was more effective than INA. According to Western blots, untreated cucumber leaves contained a 97 kDa LOX form, which remained unchanged for up to 48 h after pathogen inoculation. Upon treatment with SA alone for 24 h or with INA plus pathogen, an additional 95 kDa LOX form appeared which had an isoelectric point in the alkaline range. For the induction of this form, a threshold concentration of 1 mM SA was required, higher SA concentrations did not change LOX-95 expression which remained similar between 24 h and 96 h but further ...
黃瓜(Cucumis Sativus)提取物 - 表面活性劑 - 表面活性劑百科 - 表面活性劑百科(Surfactant.TOP),表面活性劑,陰離子表面活性劑,陽離子表面活性劑,非離子表面活性劑,兩性離子表面活性劑,氟表面活性劑,矽表面活性劑,純天然表面活性劑,高分子表面活性劑,生物表面活性劑,特殊表面活性劑 - 第1頁
黃瓜(Cucumis Sativus)油 - 表面活性劑 - 表面活性劑百科 - 表面活性劑百科(Surfactant.TOP),表面活性劑,陰離子表面活性劑,陽離子表面活性劑,非離子表面活性劑,兩性離子表面活性劑,氟表面活性劑,矽表面活性劑,純天然表面活性劑,高分子表面活性劑,生物表面活性劑,特殊表面活性劑 - 第1頁
BACKGROUND AND AIMS: Chilling results in a significant decrease in Rubisco content and increased generation of reactive oxygen species (ROS) in cucumber (Cucumis sativus), a chilling-sensitive species. The role of roots in the regulation of the tolerance is unknown. Here, cucumber plants grafted onto figleaf gourd (Cucurbita ficifolia), a chilling-tolerant species were used to study the role of roots in the regulation of shoot functioning and the associated root-to-shoot communication.. METHODS: Gas exchange and chlorophyll fluorescence were measured using an infrared gas analyser combined with a pulse amplitude fluorimeter during chilling at 14 degrees C or 7 degrees C and subsequent recovery. At the same time, Rubisco content and activity and ROS generation were spectrophotometrically assayed. Abscisic acid and cytokinin concentrations in xylem sap were also determined by enzyme-linked immunosorbent assay.. KEY RESULTS AND CONCLUSIONS: Grafted plants showed a significantly higher ...
The study examines the effect of acclimation on carbon and nitrogen metabolism in cucumber leaves subjected to moderate and severe NaCl stress. The levels of glucose, sucrose, NADH/NAD+-GDH, AspAT, AlaAT, NADP+-ICDH, G6PDH and 6GPDH activity were determined after 24 and 72 hour periods of salt stress in acclimated and non-acclimated plants. Although both groups of plants showed high Glc and Suc accumulation, they differed with regard to the range and time of accumulation. Acclimation to salinity decreased the activities of NADP+-ICDH and deaminating NAD+-GDH compared to controls; however, these enzymes, together with the other examined parameters, showed elevated values in the stressed plants. The acclimated plants showed higher G6PDH activity than the non-acclimated plants, whereas both groups demonstrated similar 6PGDH activity. The high activities of NADH-GDH, AlaAT and AspAT observed in the examined plants could be attributed to a high demand for glutamate. The observed changes may be required for
Semantic Scholar extracted view of Non-destructive measurement of cucumber leaf chlorophyll content by NIR spectroscopy based on simulated annealing algorithm by Jiyong Shi et al.
if your cucumber leaves turning yellow, we have a perfect guide for your problem.we will help you to find the main issue and guide you what steps you can take
EWGs Skin Deep® database gives you practical solutions to protect yourself and your family from everyday exposures to chemicals in personal care products.
EWGs Skin Deep® database gives you practical solutions to protect yourself and your family from everyday exposures to chemicals in personal care products.
Fingerprint Dive into the research topics of Pectic polysaccharide breakdown of cell walls in cucumber roots grown with calcium starvation. Together they form a unique fingerprint. ...
Rust-colored spots on cucumber (Cucumis sativus) plants is a sure sign that these warm season vegetables are under attack by a fungal disease. If not treated, the rust spots can greatly reduce the ...
Aquaporin (AQP) proteins comprise a group of membrane intrinsic proteins (MIPs) that are responsible for transporting water and other small molecules, which is crucial for plant survival under stress conditions including salt stress. Despite the vital role of AQPs, little is known about them in cucumber (Cucumis sativus L.). In this study, we identified 39 aquaporin-encoding genes in cucumber that were separated by phylogenetic analysis into five sub-families (PIP, TIP, NIP, SIP, and XIP). Their substrate specificity was then assessed based on key amino acid residues such as the aromatic/Arginine (ar/R) selectivity filter, Frogers positions, and specificity-determining positions. The putative cis-regulatory motifs available in the promoter region of each AQP gene were analyzed and results revealed that their promoter regions contain many abiotic related cis-regulatory elements. Furthermore, analysis of previously released RNA-seq data revealed tissue- and treatment-specific expression patterns of
Arabinogalactan proteins (AGPs) and pectins were detected in the floral buds of cucumber (Cucumis sativus L.) during its sex determination using the following monoclonal antibodies: MAC 207 (recognizes AGP epitopes); JIM 8 (recognizes a subset of AGP epitopes); and JIM 5 and JIM 7 (epitopes of pectins esterified to various degrees). In the stem apex meristem (SAM) of the cucumber, epitopes of MAC 207, JIM 7, and JIM 5 were localized in the cells from second to third peripheral layers when the sex organ primodium began to differentiate; epitopes of MAC 207 and JIM 5 were also detected in the ragged edge cells. A very dense labeling signal with MAC 207 was observed in the carpel and pistil primodium. The AGP epitopes recognized by JIM 8 were localized in the anther of the male flower and the anther-like portion of the stagnant stamen of the female flower. This suggests that the AGPs and pectins in the SAM of the cucumber are closely associated with the differentiation of the SAM, from meristematic ...
One respondent said: Everyone knows tomatoes are fruit, but some of the others on the list were really tricky. I always assumed a pea was a. Fruit and Vegetable Gardening A-Z: Cucumbers train them to grow up a small fence or trellis, otherwise space each plant 3 feet apart in rows. Cucumber (Cucumis sativus) is a widely cultivated plant in the gourd family, Cucurbitaceae. It is a creeping vine that bears cucumiform fruits that are used as vegetables. . They can grow as long as 2 feet ( m). They are nearly seedless, Genome size‎: ‎ Mb.. ...
Stable-isotope-labelled (2H6, 18O) 3-hydroxy-3-phenylpropanoic acid, a putative intermediate in the biosynthesis of benzoic acid (BA) and salicylic acid (SA) from cinnamic acid, has been synthesized and administered to cucumber (Cucumis sativus L.) and Nicotiana attenuata (Torrey). Analysis of the p …
Study Background: Raw cucumber (Cucumis sativus) fruit juice contains substances of health benefits. Na, K, urea, and creatinine are indices of nephrotoxicity. Overdose of amoxicillin, an antibiotic, could cause hemolysis and nephrotoxicity. Aim and Objective: This work was therefore designed to evaluate plasma Na, K, urea, and creatinine in rabbits given amoxicillin overdose supplemented with cucumber (C. sativus) fruit juice. Materials and Methods: Fifteen rabbits of the same sex weighing 0.9-1.4 kg divided into three groups of five rabbits each were used for the study. Group A - Five control rabbits; Group B - Five rabbits given 30 mg/kg BW subcutaneous injection of amoxicillin every 24 h for 7 days which was followed by 30 mL raw cucumber fruit juice supplementation for 14 days; Group C - Five rabbits given 30 mg/kg BW subcutaneous injection of amoxicillin every 24 h and raw cucumber fruit juice supplementation for 14 days simultaneously. Plasma K (mmol/L), creatinine (mg/dL), and urea ...
At the beginning of the XXI century, the perspectives of the plant biochemistry and physiology are directed to examine the capability of plant cells and tissue culture for vegetative propagation. The method of in vitro cultivation of plant cell and tissue cultures is use for vegetative propagation (micropropagation) of plants. The vegetative propagation of the plants in in vitro conditions enables to abbreviate the process of selection, enhance the genetic stability of plants and improve the production of healthy plants free of viruses. In this paper the results from the experimental work from the capacity of in vitro morphogenesis and micropropagation of some agricultural species are presented (Capsicum annuum L., Lycopersicon esculentum Mill., Cucumis sativus L.), The results were obtains form different initial explants cultivated in vitro on different hormonal medias, and were done at the Laboratory of biotechnology at the Department of plant biotechnology, genetic and selection, Goce Delcev ...
Read 24-Epibrassinolide alleviates organic pollutants-retarded root elongation by promoting redox homeostasis and secondary metabolism in Cucumis sativus L, Environmental Pollution on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Anjoo Kamboj*, Ankita Rana, Ripanjot Kaur, Upendra K Jain. Application and Analysis of the Folin Ciocalteu Method for the Determination of the Total Phenolic Content from extracts of Cucumis sativus L. Journal of Pharmacy Research. 2015; 9(5): 323-329. (Impact Factor 2.89 ...
Results: All the evaluations were performed in triplicates and results were noted down. It was observed that aqueous extract of C. sativus fruits showed a maximum DPPH radical scavenging activity (p,0.0001), half-maximal inhibitory concentration (IC50) at a concentration of 122.67 μg/ml. The ethyl acetate fraction of C. sativus fruits exhibited maximum hyaluronidase (p,0.0001), MMP-1/collagenase (p,0.04), and tyrosinase (p,0.04) inhibitory activity, IC50 at a concentration of 59.54, 45.79, and 24.46 μg/ml, respectively. The elastase (p,0.0001) inhibitory activity by n-butanol fraction of C. sativus fruits extract was maximum, IC50 at a concentration of 52.76 μg/ml. ...
MARKETMORE SEEDS (CUCUMBER) - Plant World Seeds. A very reliable English heirloom outdoor ridge variety of cucumber with good resistance to cucumber Mosaic Virus and mildew, which also tolerate dry conditions, making them easy to grow. They produce rich, prickly, emerald green cylindrical fruits with a high, continuous yield.
Cucumbers require warm days, plenty of sunshine and cool nights for best growth. They are a fast-growing crop ready for harvest in 50 to 70 days. If bugs are eating your cucumber plants, identify ...
Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ... Some people get stomach problems when they eat cucumber skin ... – A free PowerPoint PPT presentation (displayed as a Flash slide show) on PowerShow.com - id: 1577d4-YjdhO
The first question to ask is whether the cucumber is really drying up, or if . If the cucumber leaves are yellowing, you may be giving the plants too much water, . Why Are My Cucumber Leaves Curling Up? My Japanese Red Maple Has Dried ...
Effects of Hexaconazole on Growth and Antioxidant Potential of Cucumber Seedlings under UV-B Radiation - Antioxidative enzymes;Cucumber;Hexaconazole;Photosynthetic pigments;UV-B;
The cucumber is the edible fruit of the cucumber plant Cucumis sativus. The plant has been cultivated for 3000 years and is widely cultivated today. The cucumber plant has large leaves that form a canopy over the fruit. The vine is grown on the ground or on trellises, often in greenhouses ...
Jazzer has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
Propamocarb (PM) is one of the main pesticides used for controlling cucumber downy mildew. However, due to its volatility and internal absorption, PM can easily form pesticide residues on cucumber fruits that seriously endanger human health and pollute the environment. The breeding of new cucumber varieties with a low abundance of PM residues via genetic methods constitutes an effective strategy for reducing pesticide residues and improving cucumber safety and quality. To help elucidate the molecular mechanism resulting in a low PM residue abundance in cucumber, we used the cucumber cultivar D0351 (which has the lowest PM residue content) as the test material and identified genes related to low PM residue abundance through high-throughput tag-sequencing (Tag-Seq). CsMAPEG was constitutively expressed and showed both varietal and organizational differences. This gene was strongly expressed in D0351. The expression levels of CsMAPEG in different cucumber tissues under PM stress were as follows: fruit
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Mustika Ratu Oxigenated Spray merupakan spray penyegar wajah dengan kandungan green tea di dalamnya sehingga membuat kulit terasa sejuk dan segar. Dapat digunakan sebelum memakai pelembab wajah, makeup, atau kapanpun saat kulit wajah membutuhkan. How To Use : Semprotkan pada seluruh wajah dan leher sebelum menggunakan pelembab. Makeup, atau kapanpun kulit wajah membutuhkan lalu tepuk-tepuk perlahan untuk dapat diserap kulit lebih baik. Suitable For : Semua jenis kulit. Ingredients : Aqua, Alcoho, Bisabolol, Cucumis Sativus (Cucumber) Fruit Extract, Polysorbate 80, Propylene Glycol, Camelia Oleifera Leaf Extract, Sodium Methylparaben, EDTA, Fragrance, Hydrolyzed Collagen, Mannitol, Yeast Extract, Phenoxyethanol, Hydrogenated Lexiethin, Sodium PCA, Methylparaben, Ethylparaben, Glycogen, Hyaluronic Acid, Magnesium Ascorbyl Phospate, Sodium Sulfate, CI 19140, CI 42090.
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
I planted some cucumber seeds in egg cartons and then repotted the best of them twice in coconut coir pots, first a 3 and then a 4 pot. Some of the seedlings had stopped growing and had to be trashed. Three of the plants, though, have done quite well, and another one is doing okay. I have planted the three thriving plants in a 25-gallon fabric raised bed. The problem is that when I repotted the plants I left them in their smaller pots and just plopped them in the bigger pot and put soil around them. The idea was not to disturb the roots. But I found when I disposed of one of the trashed plants that the egg carton had not decomposed and that the root ball had become bound inside the small egg carton. Im afraid the three plants in the 25-gallon container are all root-bound. But they are planted now and Im not sure if theres anything I can do to help them that will not disturb the roots and make a bad problem worse. I thought about using a small-gauge wire to poke holes around where the egg ...
The scientific name of cucumber is cucumis sativus. Like pumpkin, watermelon and squash, cucumber belongs to the family of cucurbitaceous.
Cool Cucumbers - The ancient prophet Isaiah compared his wayward countrymen to gardeners who had abandoned their cucumber gardens. Since then the lowly Cucumis Sativus has made its way into greenhouses farms gardens kitchens salads and pickle jars...
What Makes a Cucumber Turn Yellow?. Cucumbers (Cucumis sativus) need warm weather and consistent moisture to produce. They can be successfully grown in U.S. Department of Agriculture plant hardiness zones 4 to 11 and require a consistent soil temperature of at least 65 degrees Fahrenheit to germinate properly. Yellow ...
More than 40 different diseases infect cucumbers, and theyre susceptible to weeds and insect pests when growing conditions arent right. Recognise some of the common diseases help you prevent loss of fruit. Your local county extension office has information about treating plant diseases in your area.
Fruit of Cucumis sativus, a widely cultivated plant in the gourd family Cucurbitaceae, which includes squash, and in the same genus as the muskmelon. Usually eaten raw in unripe green form, as a vegetable. Majority of people describe the taste as mild, light melon-like and almost watery while a small minority think its repugnant and perfume-like. Can be used in salads, appetizers, sauces, sandwiches, cocktails, cold soups and stir fry. Has many health benefits (due to high content of minerals) and cosmetic properties (due to its cooling and cleansing effect). one medium cucumber contains 1.25 cup of water, 12% daily value of potassium, 14% of vitamin C, 9% of Magnesium, 0.4g of flavonoid Kaempferol ...
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...
Cucumber leaf spot virus (CLSV) is a member of the Aureusvirus genus, family Tombusviridae. The auxiliary replicase of Tombusvirids has been found to localize to endoplasmic reticulum (ER), peroxisomes or mitochondria; however, localization of the auxiliary replicase of aureusviruses has not been determined. We have found that the auxiliary replicase of CLSV (p25) fused to GFP colocalizes with ER and that three predicted transmembrane domains (TMDs) at the N-terminus of p25 are sufficient for targeting, although the second and third TMDs play the most prominent roles. Confocal analysis of CLSV infected 16C plants shows that the ER becomes modified including the formation of punctae at connections between ER tubules and in association with the nucleus. Ultrastructural analysis shows that the cytoplasm contains numerous vesicles which are also found between the perinuclear ER and nuclear membrane. It is proposed that these vesicles correspond to modified ER used as sites for CLSV replication. ...
Cucumis é un xénero con 243 especies de plantas con flores pertencente á familia das Cucurbitáceas, que inclúe especies tan importantes coma o cogombro (Cucumis sativus) ou o meloeiro (Cucumis melo).. ...
In my home garden, my cucumber plant leaves are turning brown/ yellow. It seems to be spreading. What should I do? I worked so hard on...
China Fungicide Control Blight and Downy Mildew on Cucumber, Tomato. Famoxadone & Cymoxanil Wdg, Find details about China Famoxadone, Cymoxanil from Fungicide Control Blight and Downy Mildew on Cucumber, Tomato. Famoxadone & Cymoxanil Wdg - Shanghai Fuang Agrochemical Co. Ltd.
Cucumber is generally a thermophilic species; however, cultivars have been selected for higher yield during winter cultivation in unheated glasshouses in temperate regions. We tested whether photosynthesis in these varieties had greater chilling tolerance. There was no difference in the instantaneous reduction of photosynthesis at low temperature between four winter glasshouse and four summer field cultivars. After 5 d of 10°C and 100 µmol m-2 s-1 photon flux density, the four field cultivars had a sustained depression of photosynthesis after returning to clement conditions. This inhibition was associated with reduced rates of CO2 fixation and photosystem II (PSII) electron transport in the light, but not with sustained PSII photoinhibition. However, photosynthesis in the glasshouse genotypes was nearly identical to the pre-chill rates. Chill impacts on light-adapted chlorophyll fluorescence parameters, such as the quantum yield of PSII electron transport (ϕPSII), correlated well with overall ...
The interaction of the product of H2O2 and (PhSe)2 with delta-aminolevulinate dehydratase (delta-ALA-D) from mammals and plants was investigated. (PhSe)2 inhibited rat hepatic delta-ALA-D with an IC50 of 10 æM but not the enzyme from cucumber leaves. The reaction of (PhSe)2 with H2O2 for 1 h increased the inhibitory potency of the original compound and the IC50 for animal delta-ALA-D inhibition was decreased from 10 to 2 æM. delta-ALA-D from cucumber leaves was also inhibited by the products of reaction of (PhSe)2 with H2O2 with an IC50 of 4 æM. The major product of reaction of (PhSe)2 with H2O2 was identified as seleninic acid and produced an intermediate with a lambdamax at 265 nm after reaction with t-BuSH. These results suggest that the interaction of (PhSe)2 with mammal delta-ALA-D requires the presence of cysteinyl residues in close proximity. Two cysteine residues in spatial proximity have been recently described for the mammalian enzyme. Analysis of the primary structure of plant ...
Calcium-dependent protein kinases (CDPKs) constitute a unique family of enzymes in plants that are characterized by a C-terminal calmodulin (CaM)-like domain. Through protein kinase assays, we have examined the levels of cucumber calcium-dependent kinase $(C_SCDPK)$ activity in various organs of cucumber seedlings and plants. The activity of $C_SCDPK$ was highest in cucumber plant leaves followed by seedling roots and hypocotyls; however, cucumber plant flowers, seedling cotyledons, and hooks had levels that were barely detectable. The $C_SCDPKs$ were immunolocalized using polyclonal antibodies that are highly specific against a part of the kinase domain of a calcium-dependent protein kinase $(C_SCDPKS)$ in the phloem sieve elements (SEs) in various organs of cucumber. In addition, this study indicates the presence of CsCDPKs in organelle-like bodies associated with the plasma membrane of sieve elements in mature stems and roots as well as in the storage bodies of immature seeds. These findings ...
Beauty boosting skincare, sunscreen and makeup all in one! This medium coverage formula from Suntegrity gives skin a flawless, smooth, more youthful appearance. Formulated without oils or silicones, this vitamin and peptide rich technology, visibly reduces the signs of aging while non-nano zinc oxide and melanin provide Broad Spectrum SPF 30 and blue light protection to help prevent any future damage. Active Ingredient: Zinc-Oxide 20% (non-nano) nactive Ingredients: Aloe Barbadensis (Organic Aloe Vera) Leaf Juice, Capric Caprylic Triglycerides (Coconut Oil Extract), Water (Aqua), Sorbitan Stearate (Plant Derived), Glyceryl Stearate (Plant Derived), Polyglyceryl-4 Isostearate (Plant Derived), Hexyl Laurate (Plant Derived), Simmondsia Chinensis (Organic Jojoba) Seed Oil, Cetyl Dimethicone (Mineral Derived), Magnesium Sulfate (Epsom Salt), Helianthus Annuus (Organic Sunflower) Seed Oil, Cucumis Sativus (Organic Cucumber) Fruit Extract, Astaxanthin (Algae Source), Hyaluronic Acid (Plant Derived), Chlorella
Cucumber, a very important vegetable crop worldwide, is easily damaged by pests. Aphid is one of the most serious cucumber pests and frequently cause severe damage to commercially produced crops. Understanding the genetic mechanisms underlying pest resistance is important for aphid-resistant cucumber varieties breeding. In this study, two parental cucumber lines, JY30 (aphid susceptible) and EP6392 (aphid resistant), and pools of resistant and susceptible (n = 50 each) plants from 1000 F2 individuals derived from crossing JY30 with EP6392, were used to detect genomic regions associated with aphid resistance in cucumbers. The analysis was performed using specific length amplified fragment sequencing (SLAF-seq), bulked segregant analysis (BSA) and single nucleotide polymorphism index (SNP-index) methods. A main effect QTL (quantitative trait locus) of 0.31 Mb on Chr5, including 43 genes, was identified by association analysis. Sixteen of the 43 genes were identified as potentially associated with aphid
Instantly Vivid is an anti-aging serum. The company has been in business since early 2018. The headquarters are located in Greensboro, North Carolina. The serum includes special ingredients to ensure long-lasting results. It will target wrinkles and fine lines, allowing you to get a younger and more vibrant look.. Instantly Vivid targets areas of your face that have wrinkles, dark spots, fine lines, and aging spots. The serum includes natural ingredients to ensure that the cream is safe to put on your skin. The core ingredients are Linden Tree Leaf Extract, Cucumber Fruit Extract, Aloe Vera Gel, and Ginseng. Linden Tree Leaf Extract is a conditioning agent that helps hydrate the skin and fight free radicals. Cucumber Fruit Extract is rich in vitamins and minerals, thus helping all skin types remain hydrated. Aloe Vera Gel is packed with antioxidants like beta carotene, Vitamin C, and Vitamin E. It has been used to treat acne and other skin elements. This serum helps to firm the skin. Ginseng is ...
Raphanus sativus. How much does a packet plant: 18-24 foot single row electricity shows germination on second day of sowing. The key to getting radish seeds to sprout is the temperature. How to Grow Radishes (Raphanus sativus) Leave a Comment. Germination: 5-7 days. Seed Sowing Depth: 1/2 deep. Methods Our Purple Plum radishes (Raphanus sativus) were planted in the Michigan State University Teaching Greenhouse, and harvested four weeks later. Raphanus sativus L. Show All Show Tabs cultivated radish General Information; Symbol: RASA2 Group: Dicot Family: Brassicaceae Duration: Annual Biennial: Growth Habit: Forb/herb: Native Status: AK I CAN I GL I HI I L48 I PB I PR I: Fact Sheet. Hypothesis: Since radish seeds need sunlight to grow, they will need sunlight to germinate. How to Grow Radishes (Raphanus sativus) Radishes are quick and easy to grow, and are a tasty addition to salads and roasted vegetable plates. https://gardeningtips.in/radish-seed-germination-time-temperature-procedure ...
Cucumis sativus var. sikkimensis) -This year I finally was able to acquire some seeds to this rare cucumber which I had been searching for for years. This is the information given to my by the French seed saver, who I got my original seeds from: The historic cucumber of Sikkim. Fat, large fruit can reach 15 long by 6 wide. The ripe fruit is a unique rusty red color and is good eaten cooked or raw....A nice, short, fat fruit with peculiar maroon color netting the skin. Can be eaten young or used in winter dried arrangements like ornamental gourds. To 1 kilo...... In Asia cucumbers are often stir-fried and are quite tasty. This variety is grown in the Himalayas of Sikkim and Nepal. Sir Joseph Hooker first discovered it in the eastern Himalayas in 1848. Here is part of what he wrote about it: So abundant were the fruits, that for days together I saw gnawed fruits lying by the natives paths by the thousands, and every man, woman and child seemed engaged throughout the day in devouring them. ...
Huggies One & Done Refreshing Wipes, Refill Pack, Scented, Alcohol-free, Hypoallergenic Cucumber & Green Tea at Walgreens. Get free shipping at $35 and view promotions and reviews for Huggies One & Done Refreshing Wipes, Refill Pack, Scented, Alcohol-free, Hypoallergenic Cucumber & Green Tea
Download Free Full-Text of an article EFFECT OF PARTICLE SIZE DISTRIBUTION OF PERLITE AND ITS MIXTURE WITH ORGANIC SUBSTRATES ON CUCUMBER IN HYDROPONICS SYSTEM
Your plants look great, loaded with healthy leaves and flowers, but there is still no fruit. This is a common complaint I hear from gardeners growing squash, cucumbers, and other vine crops.. Start by taking a closer look at the flowers. The first set of flowers produced is all male flowers. The next set of flowers is a mix of male and female. Look for the miniature fruit at the base of the female flower. Now the male flowers have something to pollinate so the fruit can develop. So be patient you will soon have plenty to harvest.. Next year you may want to try some of the newer plant introductions that have been bred to produce more female flowers earlier in the season. The Diva cucumber (new for 2002), produces all female flowers and does not need to be pollinated. The cucumbers are tasty and lack the annoying large seeds.. A bit more information: Once your plants start producing you can further increase productivity with proper harvesting. Pick scallopini summer squash when it is 3 in ...
Slicing cucumbers are best served fresh and raw, but they can also be sautéed, fried, or even mixed in drinks. Cucumbers contain most of their nutrients in their seeds and their skin. It is advised, from a nutritional standpoint, to eat cucumbers with both. However, cucumbers have wax coatings on their skin. Organically grown cucumbers have non-synthetic waxes where conventionally grown cucumbers may have synthetic waxes and pesticides. If you choose to eat the skin, buy organic cucumbers to eliminate the risk of synthetic wax consumption. If buying organic is not an option, then thoroughly wash each cucumber with a brush or simply remove the skin before eating.. ...
Chicago Pickling Cucumber (Cucumis sativus) This old heirloom was originally bred for the market growers of the Chicago region. It was later released in 1888 and became the mainstay of pickling cukes for generations of home gardeners and canners. Finishes into a real nice pickling cuke but also great if harvested young
Sign Up For 15% Off. 12x $ 276. At least the other products were legit and useful. Posted in Within a few days of use I noticed a decrease in dark circles, and the skin around my eyes appeared much more hydrated and plump. Kx Active Concentrates Ceramides + Omegas Serum 5.0 out of 5 stars 3 ratings. Required fields are marked *. This palette is something I will use a lot and I am so happy that I got a chance to discover it! Skip to main content.sg. Whatever the reason, Kate Sommerville Kx Active Concentrates Ceramides + Omega Serum can help. Oz. IS KATE SOMERVILLE WORTH IT? For skin thats stressed or sensitized, this lightweight, hydrating serum works to alleviate dryness and tightness while calming irritation. Kate Somerville Kx Active Concentrates Serum, Ceramides + Omegas, 1 Fl Oz: Amazon.ca: Luxury Beauty Aqua/Water/Eau, Glycerin, Hydrolyzed Yeast Protein, Butylene Glycol, Propanediol, Cucumis Sativus (Cucumber) Seed Oil, Ectoin, Hydroxyectoin, Ceramide NP, Ceramide AP, Ceramide EOP, ...
In all steps, the best time to treat your plants with insecticide is in the early evening as this is when the cucumber beetles will be most active. Larvae of both species are small (3/8 in) and creamy white colored. Cucumber beetles are nasty little pests that attack cucumbers and related plants (squash, melons, pumpkins) throughout the growing season. The first generation of adults emerges in mid-June to early July, precisely as many direct-seeded cucurbits emerge. However, early populations are generally the most damaging. Cucumber Beetle populations tend to peak a week after the first beetles appear in the field. Eggs of both species are pale orange-yellow and are laid in groups. When temperatures pick up again in the early spring, they emerge and will quickly seek … Use caution if beneficial insects have been released or pollinators are present. Scouting Notes Organic insect soap will work Ok on cucumber beetles but due to … They have distinct black spots or lengthwise stripes on their ...
The present results indicate that aqueous and ethanolic extracts of C. sativus petal and stigma have antinociceptive activity in chemical pain tests. The stigma extracts showed activity against acute and chronic inflammation. The petal ethanolic extract showed anti-inflammatory activity in the chronic inflammatory test.. In respect to LD50 values and maximum non-fatal doses, the stigma extracts were more toxic than the petal extracts. LD50 values of aqueous and ethanolic stigma extracts have been reported as 1.6 g/kg, i.p. (1.16, 2.22) and 3.38 g/kg, i.p. (2.55, 4.52) in mice [6]. According to a toxicity classification [11], stigma and petal extracts are relatively toxic and low toxic, respectively. Treatment with the C. sativus extract also significantly prolonged the life span of cisplatin-treated mice almost three-fold [12]. Toxicity studies showed that the hematological and biochemical parameters were within normal range with saffron extract [2].. As preliminary phytochemical results ...
I think I used about 12 cucumbers but you can pickle any amount, just adjust the quantity of spiced vinegar you make. The night before, peel and slice all your cucumbers and place in a large bowl. Pour over about a tablespoon of salt. Dont worry, you wont eat the salt. If you dont drawn the fluid from the cucumbers it dilutes the vinegar too much in the jars. Mix the cucumbers around with your hands, making sure the salt is well distributed, put a clean tea towel over the top of the bowl and leave it overnight. The following morning there will be a lot of fluid in the cucumber bowl. Pour it all into a colander and let the salty water go down the drain. Run clean cold water from the tap over the cucumbers to make sure all the salt is removed. Leave the cucumber in the colander for about an hour to drain ...
This photo shows my daughters favorite kind from our Sweden trip this summer - Mother Annas thinly sliced pickles (Mor Annas tunnskivad gurka). [Question to Swedes, shouldnt it be Mor Annas tunnskivadE gurka in proper Swedish?]. Gurka means cucumber, and must be from the same root word as gherkin, the English word for tiny little pickled cucumbers. The word cucumber comes from the old Latin or Greek since the genus name is Cucumis. Cucumbers are a kind of berries with a leathery skin, and are placed together with pumpkins, squashes, and melons in the Cucurbitaceae family ...
This project is related to Objective 1 of this in-house project: develop reduced salt fermentation procedures for cucumbers and cabbage that will consistently produce vegetables with firm texture and appropriate flavor. The bacteriophage ecology in commercial cucumber fermentation was studied with the aim of applying this knowledge for the selection of a starter culture for cucumber fermentation. Brine samples were collected over a 90-day period and served as the source for the isolation of approximately 700 bacterial colonies belonging to the lactic acid bacteria (LAB) and enterobacteriacea groups. While isolates served as potential hosts, the filtered brine samples were used as phage sources. A total of 57 independent phage isolates against LAB were obtained, primarily from the seventh and fourteenth days of fermentation, in which the hosts reached maximum counts (109 CFU/ml). Representative LAB phages from each sampling day were characterized by electron micrographs. The majority of the ...
Cucumbers contain sugar, vitamins, mineral salts which contribute to the improvement of albumin assimilation and digestion. In folk medicine, fresh cucumbers and juice of them are used for stomach disorders, liver and kidneys. Read about natural remedies with cucumber that make miracles with your skin.. To protect the face skin, the skin on the hands and neck, cucumbers are used in folk cosmetics.. Mask based on cucumber heals skin, makes it softer, makes pores disappear, makes the skin whiter and is recommended for tired skin and sere, with large pores and pimples.. Try this natural remedies with cucumber following the steps:. - Clean a cucumber, peel it with more meaty, and put it on your skin. From the moment you clean the cucumber used it in skin cosmetics in maximum few hours, dont have to passed too long, and not be afraid to put the shell in the refrigerator; its extraordinary properties are maintained.. - Get some cucumber juice, put it on a towel and covered up the face for several ...
Poniente offers an upgrade from Tyria with added resistance to cucumber mosaic virus (CMV) and cucumber vein yellowing virus (CVYV). Bitter-free, 12–13" ...
The ADC Adstation 5660E 3.5V Wall Extension Module includes a 3.5V handle, and an included bracket makes it easy to attach to a wall or ADC wallboard system
Cucurbitacin B and Cucurbitacin C are the names of the compounds which cause bitterness in cucumbers. These compounds are found in all plant parts, but are concentrated in the stem end of the fruit. There is some in the blossom end, as well. Different varieties of cucumbers seem to contain more bitterness than others. You can cut off the ends to remove the bulk of the bitterness, but there will still be some under the skin of the cuke. Some people believe that if they peel a cucumber from the stem end to the blossom end, theyll remove more of the bitterness. There have been scientific studies, and the direction of peeling doesnt really make any difference in the amount of bitterness in a cucumber ...
Hello,. It is time to harvest all of your radishes, turnips and spinach. As these are spring vegetables, they do not enjoy the hot weather, and will not grow well.. Where possible, we planted these spring vegetables in the space dedicated to a plant that needs a lot of space to grow. Please find your zucchini, melon, squash and cucumber plants, and make sure they have enough room. This means that when you remove your radishes and turnips, you are leaving space open for the larger summer vegetables. If other plants are too close to them, they will stay small and wont produce well.. Radish and turnip sometimes do not form nice round roots. Even so, the greens are delicious sautéed in garlic and butter, and are packed with nutrients and vitamins.. Your kale, broccoli and cabbage leaves are probably huge and overshadowing other vegetables. You should cut off any leaves at the base that are passing over their allotted space. These leaves are delicious steamed or shredded raw in salad.. Harvest ...
The lettuce/bean/cucumber trio bed is actually starting to come along now. Which I know because Im spending this weekend thinning the lettuce for salads and hauling away superfluous cucumber seedlings to new Forever Homes. And by Forever, I mean until the fall when they die of their own accord. If you live in the SF Bay Area and want a cuke seedling grown all haphazard like by yours truly, let me know. I may have a few left after this weekends adoption fair. The lettuce, however, not up for grabs. We are going to start eating salad for breakfast. ...
Sedoheptulose-bisphosphatase (also sedoheptulose-1,7-bisphosphatase or SBPase) (EC 3.1.3.37) is an enzyme that catalyzes the removal of a phosphate group from sedoheptulose 1,7-bisphosphate to produce sedoheptulose 7-phosphate. SBPase is an example of a phosphatase, or, more generally, a hydrolase. This enzyme participates in the Calvin cycle. SBPase is a homodimeric protein, meaning that it is made up of two identical subunits. The size of this protein varies between species, but is about 92,000 Da (two 46,000 Da subunits) in cucumber plant leaves. The key functional domain controlling SBPase function involves a disulfide bond between two cysteine residues. Additionally, SBPase requires the presence of magnesium (Mg2+) to be functionally active. SBPase is bound to the stroma-facing side of the thylakoid membrane in the chloroplast in a plant. Some studies have suggested the SBPase may be part of a large (900 kDa) multi-enzyme complex along with a number of other photosynthetic enzymes. SBPase ...
Great tasting, attractive, and highly productive. Uniform yields of sweet, crispy, bitter-free cucumbers with small seed cavities. Avg. 9–11" long. ...
How to Make Cucumber Juice. Cucumber juice is a very healthy and versatile drink. Cucumbers have a high content of water and contain noteworthy amounts of potassium, silica, vitamin A, vitamin C, folate, and chlorophyll, among other...
Health Benefits of Cucumber - Cucumber is a vegetable which is known for its mild and pleasant watery taste. It is a highly cultivated vegetable and is...
In this chapter, students explore the history of the bitter gene in cucumbers, which was found in a genebank and traded internationally between cucumber breeders. The students then explore transcription, translation, and the DNA basis for different types of mutations. This activity uses one of the modern tools of genomics-sequences from the GenBank public database-to explore mutation of cucumber genes.. ...
Cucumbers are rich in two of the most basic elements needed for healthy digestion: water and fiber. Adding cucumbers to your juice or salad can help you meet the ideal of amount of fiber your body needs - 50 grams per 1,000 calories consumed. If you struggle with acid reflux, you should know that drinking water can help suppress acute symptoms of acid reflux by temporarily raising stomach pH; its possible that water-rich cucumbers may have a similar effect ...
See all results for Cucumber Tea Sandwiches No Null Seeded Cucumber Recipes. Find more recipes at Foodily.com - the largest recipe search site - and see the ones your friends like.
See all results for Cucumber Soup Chilled Cucumber No (southern Living) Recipes. Find more recipes at Foodily.com - the largest recipe search site - and see the ones your friends like.
When choosing cucumbers, Korean cucumbers are ideal for their soft skin and crunch, but pickling cucumbers are a good substitute. This refreshing instant kimchi is wonderful with barbecued meats and a glass of beer.
Finds sub-sequences or patterns in the sequence and highlights the matching regions. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences. More... ...
Finds sub-sequences or patterns in the sequence and highlights the matching regions. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences. More... ...
Raphanus sativus is a ANNUAL growing to 0.5 m (1ft 8in) by 0.2 m (0ft 8in) at a fast rate. It is not frost tender. It is in flower from Jun to August, and the seeds ripen from Jul to September. The flowers are hermaphrodite (have both male and female organs) and are pollinated by Bees, flies.Suitable for: light (sandy), medium (loamy) and heavy (clay) soils. Suitable pH: neutral and basic (alkaline) soils. It can grow in semi-shade (light woodland) or no shade. It prefers moist soil.
photo Daucus carota ssp. sativus Cosmic Purple - Plants Photo Gallery - A database of more than 2690 photos from all over the world.
Raphanus sativus p67 protein: a chloroplastic RNA-binding protein, member of the PPR family; amino acid sequence in first source; GenBank A5243544-6
Cucumber (Cucumis sativus cv. Orient Express): damping off of seedlings. Azaleas (Rhodoendron Kurume hybrid cv. Hershey's Red ...
Cucumis sativus pipino - Cucumber; zuchinni; Cucurbita pepo radish; Raphanus repolyo - cabbage; Brassica oleracea saluyot - ... watermelon - Curcubita citrullus Linn.; also Citrullus vulgaris Schrad.; pakwan (INTRODUCED) ahos - Garlic; Allium sativum; ... Oryza sativa) baka - Philippine cow; Bos taurus Baboy ihás - baboy damó; wild boar; Sus scrofa bóngcaras - sea cow; Dugong ... bottle gourd Corindrium sativum - coriander leaf adelfa - Oleander; South sea rose; Nerium indicum Mill.; Neroum oleander ...
lachrymans attacks cucumbers (Cucumis sativus). 'Pseudomonas tomato' pv. maculicola attacks members of Brassica and Raphanus. ' ...
Cucumis melo) 24 [39] Rice. (Oryza sativa) 24 [21] Silverleaf nightshade. (Solanum elaeagnifolium) 24 [40] ... Raphanus sativus) 18 [21] Carrot. (Daucus carota) 18 The genus Daucus includes around 25 species. D. carota has nine chromosome ... Allium sativum) 16 [26] Itch mite. (Sarcoptes scabiei) 17/18 According to the observation of embryonic cells of egg, chromosome ... Medicago sativa) 32 Cultivated alfalfa is tetraploid, with 2n=4x=32. Wild relatives have 2n=16.[21]:165 [21] ...
... from Cucumis sativus (Cucumber) peelings; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from ...
December 2009). "The genome of the cucumber, Cucumis sativus L". Nature Genetics. 41 (12): 1275-81. doi:10.1038/ng.475. PMID ... Bell L, Chadwick M, Puranik M, Tudor R, Methven L, Kennedy S, Wagstaff C (2020). "The Eruca sativa Genome and Transcriptome: A ... July 2012). "The genome of melon (Cucumis melo L.)". Proceedings of the National Academy of Sciences of the United States of ... April 2002). "A draft sequence of the rice genome (Oryza sativa L. ssp. indica)". Science. 296 (5565): 79-92. Bibcode:2002Sci ...
The genome of the cucumber, (Cucumis sativus), was one of the plant genomes that used the NGS Illumina reads in combination ... December 2009). "The genome of the cucumber, Cucumis sativus L". Nature Genetics. 41 (12): 1275-81. doi:10.1038/ng.475. PMID ... To sequence and assemble the genome of Oryza Sativa (japonica), the same strategy was used. For Oryza Sativa a total of 3,401 ... April 2002). "A draft sequence of the rice genome (Oryza sativa L. ssp. japonica)". Science. 296 (5565): 92-100. Bibcode: ...
Cucumis sativus L". Nature Genetics. 41 (12): 1275-1281. doi:10.1038/ng.475. PMID 19881527. S2CID 10711523. "Honors and Awards ...
... C, from Cucumis sativus (Cucumber) [1]:11. Cucurbitacin D[edit]. Cucurbitacin D ... Cucurbitacin A found in some species of Cucumis [1]:1 *Pentanorcucurbitacin A, or 22-hydroxy-23,24,25,26,27-pentanorcucurbit-5- ...
Cucumis sativus flower An Indian yellow cucumber Komkommer (Cucumis sativus 'Gele Tros') A varietal grown by the Hmong people ... A tendril emerges from cucumber vines to facilitate climbing Flower of Cucumis sativus Pollen grains of Cucumis sativus A ... Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55: 193-195. doi: ... Cucumber (Cucumis sativus) is a widely-cultivated creeping vine plant in the Cucurbitaceae gourd family that bears cucumiform ...
In Cucumis sativus (cucumber), the enzymes indole-3-acetaldehyde reductase (NADH) and indole-3-acetaldehyde reductase (NADPH) ... "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol. Chem. 251 (4): 907-13. PMID ...
Brown HM, Purves WK (1976). "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol ...
"Photosensitivity of Cucumber (Cucumis sativus L.) Seedlings Exposed to Ultraviolet-B Radiation". Chilean Journal of ...
Copyright 2015 Elsevier B.V. All rights reserved Trollblad, Verånika (2016). Odling av Cucumis Sativus L. med aska från träd ... Hemmaodlat, Malmö, Sweden Sánchez, Henrique (2016). Wood ash as a nutrient supplement for Cucumis Sativus in an anthroponics ... ISSN 1064-3389 Sánchez, Henrique (2015). Lactuca sativa production in an anthroponics system. Hemmaodlat, Malmö, Sweden Pradhan ...
Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55: 193. doi: ... has been applied to Cucumis anguria L., a related species of Cucumis sativus, the most common cucumber plant.[14] ... The cucumber (Cucumis sativus), or less formally cuke, is a widely cultivated plant in the gourd family, Cucurbitaceae. It is a ... This is not the same species as the common cucumber (Cucumis sativus) although it is closely related. Armenian cucumbers have ...
In particular, the hosts include watermelons (Citrullus lanatus), cucumbers (Cucumis sativus), and melons (Cucumis melo). On ... Kishi first discovered MNSV on Cucumis melo in a greenhouse setting in that year. For the next two decades, there were minor ... It is considered to be an endemic virus in greenhouses and field productions of Cucurbitaceae crops, including melon (Cucumis ... in Cucumis melo L. 'Doublon'". Euphytica. 134 (3): 319. doi:10.1023/B:EUPH.0000004969.95036.1d. S2CID 41736537. Herrera-Vásquez ...
"Partial characterization of the galactinol forming enzyme from leaves of Cucumis sativus L". Plant Sci. Lett. 23: 25-33. doi: ...
2008). "Pollination of cucumber, Cucumis sativus L. (Cucurbitales: Cucurbitaceae), by the stingless bees Scaptotrigona aff. ...
7-bisphosphatase from Cucumis sativus". Scientia Horticulturae. 129 (3): 414-420. doi:10.1016/j.scienta.2011.04.010. Anderson ...
Plader W, Yukawa Y, Sugiura M, Malepszy S (2007). "The complete structure of the cucumber (Cucumis sativus L.) chloroplast ... February 2005). "The Genomes of Oryza sativa: a history of duplications". PLOS Biology. 3 (2): e38. doi:10.1371/journal.pbio. ... Oryza sativa) chloroplast genome: intermolecular recombination between distinct tRNA genes accounts for a major plastid DNA ...
Induction of defense responses in cucumber plants (Cucumis sativus L.) by the biocontrol agent Trichoderma harzianum. Appl. ...
Cucumis sativus L.) (PhD thesis). University of Edinburgh. hdl:1842/14071. OCLC 606083438. EThOS uk.bl.ethos.652440. Hill, S. A ... Cucumis sativus L.) Cotyledons during Early Seedling Growth". Plant Physiology. 99 (1): 60-66. doi:10.1104/pp.99.1.60. ISSN ... of Edinburgh where he was awarded a PhD in 1990 for research on the regulation on mitochondrial function in Cucumis sativus L. ...
Cucumis sativus)". Environmental and Experimental Botany. 57 (1-2): 106-115. doi:10.1016/j.envexpbot.2005.05.004. Andersson, ...
Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55 (1): 193-195. ...
Schaefer H, Kocyan A, Renner SS (2007). "Phylogenetics of Cucumis (Cucurbitaceae): Cucumber (C. sativus) belongs in an Asian/ ... and others Cucumis - cucumber (C. sativus), various melon Momordica - bitter melon Luffa - the common name is also luffa, ... f. 1867 (3 spp.) Cucumis L. (65 spp.) Dactyliandra Hook.f. (2 spp.) Diplocyclos (Endl.) T.Post & Kuntze (4 spp.) Indomelothria ...
Cucumis sativus), garlic (Allium sativum), and tamarind leaf (Tamarindus indica) were also used to control high blood pressure ...
Cucumis sativus L.). ed.ac.uk (PhD thesis). University of Edinburgh. hdl:1842/14071. OCLC 606083438. EThOS uk.bl.ethos.652440. ...
C.lanatus Nakai Cucumis melo L. Cucumis sativus L. Cucurbita maxima Duchesne Cucurbita pepo L. Luffa cylindrica M.Roem. ... gongylodes Eruca sativa Mill. Lobularia maritima (L.) Desv. Sinapis alba L. Apuleia molaris Spruce ex Benth. Bauhinia forficata ... Medicago sativa L. Melilotus alba Medik. Melilotus officinalis Lam. Myrocarpus frondosus M.Allemão Sweetia fruticosa var. ... Apium graveolens L. Daucus carota L. Pastinaca sativa L. Petroselinum crispum Hoffm. All the plants of this family are found in ...
This virus was first found in cucumbers (Cucumis sativus) showing mosaic symptoms in 1934, hence the name Cucumber mosaic. ...
Cucumis sativus), and black-eyed peas (Vigna unguiculata) also became systemically infected. Many of these plants showed mild ...
Gindor (qawin, petêx) (Cucumis melo). *Dolmik, kundir (Cucurbita). *Cehik (xiyar, arûf) (Cucurbita sativus) ...
Kod krastavca Cucumis sativus, enzimi indole-3-acetaldehid-reduktaza (NADH) I indol-3-acetaldehid-reduktaza (NADPH) koriste ... Brown HM, Purves WK (1976). "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol ...
Cucumis sativus. Mula. Radish. Raphanus sativus. Gajor. Carrot. Daucus carota. Bilahee. Tomato. Solanum lycopersicum. ...
Growth and morphological responses to different UV wavebands in cucumber (Cucumis sativum) and other dicotyledonous seedlings. ...
2006). "Effect of aluminum on δ-aminolevulinic acid dehydratase (ALA-D) and the development of cucumber (Cucumis sativus)". ...
Schaefer H, Kocyan A, Renner SS (2007). „Phylogenetics of Cucumis (Cucurbitaceae): Cucumber (C. sativus) belongs in an Asian/ ...
O chigheummao (cucumis sativus) o l'è unn-a verdùa da famiggia de cucurbitacee. ...
Cucumis sativus মূলা Radish Raphanus sativus গাজৰ Carrot Daucus carota বিলাহী Tomato Solanum lycopersicum ...
Cucumis sativus (cogombro). Véxase tamén[editar , editar a fonte]. Ligazóns externas[editar , editar a fonte]. Wikispecies ... Cucumis sativus) ou o meloeiro (Cucumis melo). ... Cucumis é un xénero con 243 especies de plantas con flores ... Traído desde "https://gl.wikipedia.org/w/index.php?title=Cucumis&oldid=4271483" ...
Melo sativus Sageret. *Melo vulgaris Moench ex Cogn.. *Melo zard Pangalo. *Melo × ambiguua Pangalo ... Cucumis melo, also known as melon,[2][3] is a species of Cucumis that has been developed into many cultivated varieties. The ... Wikimedia Commons has media related to: Cucumis melo (category). *Cucumis melo L. - Purdue University, Center for New Crops & ... "Cucumis melo". Germplasm Resources Information Network (GRIN). Agricultural Research Service (ARS), United States Department of ...
Cucumis sativus)". Environmental and Experimental Botany. 57 (1-2): 106-115. doi:10.1016/j.envexpbot.2005.05.004.. ...
ਖੀਰਾ (Eng: Cucumber, Cucumis sativus) ਭੌਤਿਕ ਪਰਵਾਰ ਵਿੱਚ ਇੱਕ ਵਿਆਪਕ ਕਾਸ਼ਤ ਵਾਲੇ ਪੌਦਾ ਹੈ, ਕੁਕਰੀਬੀਟਾਸੀਏ ਇਹ ਇੱਕ ਰੀਂਗਣ ਵਾਲੀ ਵੇਲ ਹੈ ਜੋ ...
Cucumis sativus), squash ( Cucurbita pepo ), and tomatoes (Lycopersicon esculentum). This virus is believed to be distributed ... It is also known to infect peas (Pisum sativum), faba beans (Vicia faba), green beans (Phaseolus vulgaris), cowpea (Vigna ...
The genome of the mitochondrion of the cucumber (Cucumis sativus) consists of three circular chromosomes (lengths 1556, 84 and ...
"Entity Display : Pisum sativum". Archive.is. Archived from the original on 2012-07-14. Retrieved 2018-02-28.CS1 maint: bot: ... "Cucumis prophetarum - Useful Tropical Plants". tropical.theferns.info. Retrieved 5 March 2021. John H. Wiersema (2005-02-22). " ... "Entity Display : Raphanus sativus Bailey". Ecoport.org. Retrieved 2018-02-28. "GRIN #1015". npgsweb.ars-grin.gov. "Entity ... "Entity Display : Pastinaca sativa". Ecoport.org. Retrieved 2018-02-28. "Entity Display : Paulownia tomentosa". Ecoport.org. ...
rapa Capsicum frutescens Celosia cristata Chenopodium murale Cucumis sativus Cucurbita pepo Datura stramonium Daucus carota ... its host range is limited and it causes only necrotic local lesions in Chenopodium quinoa and no symptoms in Cucumis sativus, ... Nicotiana glutinosa Nicotiana sylvestris Nicotiana tabacum Ocimum basilicum Petunia x hybrida Phaseolus vulgaris Pisum sativum ... Dianthus caryophyllus Glycine max, Gomphrena globosa Lactuca sativa Lilium elegans Lycopersicon esculentum Nicotiana ...
The Armenian cucumber, Cucumis melo var. flexuosus, is a type of long, slender fruit which tastes like a cucumber and looks ... It is actually a variety of muskmelon (C. melo), a species closely related to the cucumber (C. sativus). It is also known as ... Cucumis chate", which is today included in the Armenian variety. It is said by Hasselquist to be the "queen of cucumbers, ... The Cucumis melo subspecies Chate was the most frequently encountered cucurbit in ancient Mediterranean images and texts, and ...
multicava (Naturalised) Cucurbitaceae Cucumis anguria (Naturalised) Diplocyclos palmatus subsp. affinis Sicyos australis ... Vicia sativa subsp. nigra (Naturalised) Vicia tetrasperma (Naturalised) Vigna marina Frankeniaceae Frankenia pulverulenta ( ... Avena sativa (Naturalised) Axonopus fissifolius (Naturalised) Bothriochloa macra (Naturalised) Briza maxima (Naturalised) Briza ... Coriandrum sativum (Naturalised) Daucus glochidiatus (Naturalised) Foeniculum vulgare (Naturalised) Petroselinum crispum ( ...
Cucumis sativus L.) in a plastic tunnel". PLoS ONE. 8 (4): 1-7. Bibcode:2013PLoSO...862173X. doi:10.1371/journal.pone.0062173. ... Cucumis sativus L.)". Archives of Phytopathology and Plant Protection. 47 (9): 1112-1119. doi:10.1080/03235408.2013.830809. ... El-Darier, Salama M.; Zein El-Dien, Marwa H. (2011). "Biological activity of Medicago sativa L. (alfalfa) residues on ... Morris, Michael C.; Li, Frank Y. (2000). "Coriander (Coriandrum sativum) "companion plants" can attract hoverflies, and may ...
It has also been discovered that, in cucumber (Cucumis sativus L.), PEPCK levels are increased by multiple effects that are ...
Clymenia platypoda Clymenia polyandra Corynocarpus cribbianus Cryptocarya aromatica Cucumis sativus (cucumber) Dillenia ... Barley (Hordeum vulgare/sativum, descended from the wild H. spontaneum) Einkorn (Triticum monococcum, descended from the wild T ... Pisum sativum) Carrots Leeks Lettuce Onions Parsley Radishes Almond Linseed (Linum usitatissimum) Asafoetida Mustard Fig (Ficus ... Oryza sativa (rice) Alocasia macrorrhizos (giant taro) Alpinia galanga (lengkuas) Alpinia vanoverberghii (akbab) Amomum acre ( ...
... esculenta Conium maculatum Coriandrum sativum Cornus mas Crataegus azarolus Crithmum maritimum Crocus sativus Cucumis sativus ... majorana Origanum vulgare Osmunda regalis P Paeonia officinalis Pastinaca sativa Petroselinum crispum Petroselinum sativum ...
Cucumis Sativus leaves & flowers, Memecylon edule, Tridax procumbens, Trachyspermum ammi, Katla, Teku Flowers, etc., which ...
The coloration of the seeds are a caramel brown when dry which can be compared to that of the European cucumber, C. sativus, ... the occurrence of Cucumis dipsaceus in India was reported. The source of Cucumis dipsaceus is unknown; probably the seeds might ... CUCUMIS_DIPSACEUS_EHRENB_EX_SPACH_IN_INDIA/links/551cdb600cf2909047bcaf27.pdf "Cucumis Dipsaceus: Info From PIER (PIER Species ... Cucumis dipsaceus is an annual climbing herb that can be found in different habitats. C. dipsaceus grows in tropical and arid ...
CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT, CUCUMIS SATIVUS (CUCUMBER) INFUSION, CUCUMIS SATIVUS EXTRACT, CUCUMIS SATIVUS FRUIT ... Cucumis sativus.. CUCUMBER EXTRACT, CUCUMBER FRUIT EXTRACT, CUCUMBER INFUSION, CUCUMBER, EXT., CUCUMIS SATIVUS (CUCUMBER) ... CUCUMIS SATIVUS INFUSION, EXTRACT OF CUCUMBER, and EXTRACT OF CUCUMIS SATIVUS ... CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT. Click here for all products containing this ingredient ...
CUCUMIS SATIVUS (CUCUMBER) EXTRACT; CUCUMIS SATIVUS EXTRACT; CUCUMIS SATIVUS FRUIT EXTRACT; EXTRACT OF CUCUMBER; EXTRACT OF ... About CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT: Extract of the fruit of the cucumber, Cucumis sativus.. Function(s): Skin- ... Show all 447 recent products that contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT.. ...
... identification and distribution of Map of Cucumis sativus -- Discover Life ... Cucumis sativus @ American Museum of Natural History, Bee Specimen Record (1); Bernice P. Bishop Museum, Thematic Collection ...
Cucumis sativus) General Lee supplied by member gardeners in the PlantFiles database at Daves Garden. ...
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; ...
Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ... Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ...
Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... Camelina sativa (False flax) (Myagrum sativum). Brassica napus (Rape). Capsella bursa-pastoris (Shepherds purse) (Thlaspi ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
Thread by robertduval14: forgot to put this in the photo description...but a close look at the lower left petal will reveal a small and well camouflaged c...
tr,E7CEX8,E7CEX8_CUCSA WRKY protein OS=Cucumis sativus OX=3659 GN=WRKY37 PE=2 SV=1 ...
ASM journals are the most prominent publications in the field, delivering up-to-date and authoritative coverage of both basic and clinical microbiology.. About ASM , Contact Us , Press Room. ASM is a member of. ...
Jazzer has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.).. ...
Cápal, P., Ondřej, V. Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.). In Vitro Cell.Dev.Biol.- ... Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.). *Petr Cápal1,2. & ... Navrátilová B, Luhová L, Petřivalský M (2008) Effect of UV-C irradiation on mesophyll protoplasts of Cucumis sativus. Plant ... Ondřej V, Navrátilová B, Lebeda A (2009b) The heterochromatin as a marker for protoplast differentiation of Cucumis sativus. ...
Home » Proteomic characterization of iron deficiency responses in Cucumis sativus L. roots ...
Title Production of Table Cucumber (Cucumis sativa) on Two Trellis Systems in North Florida ... Production of Table Cucumber (Cucumis sativa) on Two Trellis Systems in North Florida ...
Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress. Xingwang Liu1,2† ... Citation: Liu X, Liu B, Xue S, Cai Y, Qi W, Jian C, Xu S, Wang T and Ren H (2016) Cucumber (Cucumis sativus L.) Nitric Oxide ...
Cucumis sativus) - Cucumber (Cucumis sativus) Introduction Both cucumbers and melons are members of the same genus: Cucumis ... Cucumber Cucumis sativus. 1. Cucumber (Cucumis sativus)*Introduction *Both cucumbers and melons are members of the same genus ... Cucumis Sativus L. - Cucumis Sativus L. Nick Lorenz May 1, 2006 Phylogeny Interesting Facts Cucumbers originated in India where ... Cucumber Cucumis sativus. Description:. Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ...
Cucumis sativus explanation free. What is Cucumis sativus? Meaning of Cucumis sativus medical term. What does Cucumis sativus ... Looking for online definition of Cucumis sativus in the Medical Dictionary? ... Cucumis sativus. Also found in: Dictionary, Thesaurus, Encyclopedia, Wikipedia.. Related to Cucumis sativus: Tribulus ... Cucumis sativus , definition of Cucumis sativus by Medical dictionary https://medical-dictionary.thefreedictionary.com/Cucumis+ ...
Ranjan, P., Pandey, A., Munshi, A.D. et al. Orange-fleshed cucumber (Cucumis sativus var. sativus L.) germplasm from North-East ... Orange-fleshed cucumber (Cucumis sativus var. sativus L.) germplasm from North-East India: agro-morphological, biochemical and ... Qi C, Yuan Z, Li Y (1983) A new type of cucumber-Cucumis sativus L. var. xishuangbannanesis [sic]. Acta Hortic Sin 10:259-264 ... Lv J, Qi J, Shi Q, Shen D, Zhang S, Shao G et al (2012) Genetic diversity and population structure of cucumber (Cucumis sativus ...
... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... Liu, L. (2008). Inheritance Analysis and QTL Mapping of Powdery Mildew Resistance in Cucumber (Cucumis sativus L.). Doctors ... The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus ...
Morrell, Clare Katrina (1987) The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls. University of ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ...
Knowing the extent and structure of genetic variation in germplasm collections is essential for the conservation and utilization of biodiversity in cultivated plants. Cucumber is the fourth most important vegetable crop worldwide and is a model system for other Cucurbitaceae, a family that also includes melon, watermelon, pumpkin and squash. Previous isozyme studies revealed a low genetic diversity in cucumber, but detailed insights into the crops genetic structure and diversity are largely missing. We have fingerprinted 3,342 accessions from the Chinese, Dutch and U.S. cucumber collections with 23 highly polymorphic Simple Sequence Repeat (SSR) markers evenly distributed in the genome. The data reveal three distinct populations, largely corresponding to three geographic regions. Population 1 corresponds to germplasm from China, except for the unique semi-wild landraces found in Xishuangbanna in Southwest China and East Asia; population 2 to Europe, America, and Central and West Asia; and population 3
Pot experiments were conducted on cucumber (Cucumis sativus L.) plants in the green house of the National Research Center. ... EFFECTS OF SALICYLIC ACID ON SEEDLING GROWTH AND NITROGEN METABOLISM IN CUCUMBER (CUCUMIS SATIVUS L.). Singh, Pramod Kumar; ... Subplastidic preparations from cotyledons of cucumber (Cucumis sativus L.) were tested for their ability to synthesize ... Cucumis sativus L.) exposed to NaCl stress. Salt stress reduced net photosynthetic rates (P), actual photochemical efficiency ...
Cucumis sativus L. 24-Epibrassinolide Root Cell wall Lignin Ca(NO3)2 stress ... 24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress. ...
Effect of Cucumis sativus L. extract (CSE) on LPS induced HO-1 expression. a Expression of HO-1 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS induced TLR4 expression. a Expression of TLR4 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS-induced pAECs toxicity. a Representative images of pAECs morphology under LPS ... Effect of Cucumis sativus L. extract on LPS-induced angiogenesis. pAECs were cultured on a extracellular matrix with LPS (10 μg ...
... organic pollutants-retarded root elongation by promoting redox homeostasis and secondary metabolism in Cucumis sativus L, ... Induction of systemic stress tolerance by brassinosteroid in Cucumis sativus. Xia, X.J.; Zhou, Y.H.; Ding, J.; Shi, K.; Asami, ... Effects of aqueous root extracts and hydrophobic root exudates of cucumber (Cucumis sativus L.) on nuclei DNA content and ... Selective trans-cinnamic acid uptake impairs [Ca2+](cyt) homeostasis and growth in Cucumis sativus L ...
... reveals new insights into the variation of fruit-related traits in Cucumis sativus, Scientific Reports" on DeepDyve, the ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), Chinese long 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), Chinese long 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14), a member of the family Cucurbitaceae, is one of the most economically important ...
Testing of disease-resistance of pokeweed antiviral protein gene (PacPAP) in transgenic cucumber (Cucumis sativus) * B Cao ... Keywords: Pokeweed antiviral protein gene, genetic transformation, Cucumis sativus Abstract. Transformation of pokeweed ...
Age dependent alterations in photosystem II acceptor side in Cucumis sativus cotyledonary leaf thylakoids: Analysis of binding ... We monitored the protein, chlorophyll and electron transport activities in Cucumis sativus cv Poinsette cotyledonary leaves and ...
Cucumber is generally a thermophilic species; however, cultivars have been selected for higher yield during winter cultivation in unheated glasshouses in temperate regions. We tested whether photosynthesis in these varieties had greater chilling tolerance. There was no difference in the instantaneous reduction of photosynthesis at low temperature between four winter glasshouse and four summer field cultivars. After 5 d of 10°C and 100 µmol m-2 s-1 photon flux density, the four field cultivars had a sustained depression of photosynthesis after returning to clement conditions. This inhibition was associated with reduced rates of CO2 fixation and photosystem II (PSII) electron transport in the light, but not with sustained PSII photoinhibition. However, photosynthesis in the glasshouse genotypes was nearly identical to the pre-chill rates. Chill impacts on light-adapted chlorophyll fluorescence parameters, such as the quantum yield of PSII electron transport (ϕPSII), correlated well with overall ...
  • Cucumber plant is a spicies of Cucumis Sativus, belongs to the family Cucurbitaceae and native to Western Asia. (blogspot.com)
  • It is considered to be an endemic virus in greenhouses and field productions of Cucurbitaceae crops, including melon (Cucumis melo), cucumber (Cucumbis sativus), and watermelon (Citrullus lanatus). (wikipedia.org)
  • Comparison of inoculation methods with Didymella bryoniae on Cucumis sativus cucumbers, stem and fruit rot. (thefreedictionary.com)
  • Cucumbers ( Cucumis sativus ) are especially sensitive to the type of downy mildew (Pseudoperonospora cubensis) that affects other cucurbits, including melons, pumpkins and squash. (thefreedictionary.com)
  • Royalty free images: picking mini cucumbers Cucumis sativus Author: Benjamin RedeleitDate: 2005-07-31 Maximum available size: 18 Mpix. (tradebit.com)
  • Online Buy Huang Gua Zi 黄瓜子 Cucumber Seed Cucumis Sativus L. Pickling Cucumbers Direct From China Herb Market Supplier. (999tcm.shop)
  • This bulk herb Huang Gua Zi 黄瓜子 Cucumber Seed Cucumis Sativus L. Pickling Cucumbers i s of premium quality. (999tcm.shop)
  • Description : Name: Marketmore 76 Cucumber Scientific Name: Cucumis Sativus Color: Dark Green With Yellow Flowers Plant Seeds: Outdoors After Frost / Indoors Weeks Before Last Frost Harvest: 65 Days Plant Height: 18 - 24" Plant Spacing: Hills Of 2-3 Plants Per Hill Spaced 36-48" Apart Light Requirements: Sun Soil & Water Preferences: Average Quantity: 200 Seeds Other: These Are The Big Ole Cucumbers You Have Been Dreaming Of! (artfire.com)
  • In particular, the hosts include watermelons (Citrullus lanatus), cucumbers (Cucumis sativus), and melons (Cucumis melo). (wikipedia.org)
  • Henan I, Tlili I, R'him T, Ali AB, Jebari H (2016) Carotenoid content and antioxidant activity of local varieties of muskmelon ( Cucumis melo L.) grown in Tunisia. (springer.com)
  • Effects of grafting on physiological characteristics of melon (Cucumis melo) seedlings under copper stress. (ebscohost.com)
  • The effects of grafting on physiological characters of melon (Cucumis melo) seedlings under copper stress were investigated with Pumpkin Jingxinzhen No.3 as stock and oriental melon IVF09 as scion. (ebscohost.com)
  • Honey Dew Melon 'Dulce Nectar' (Cucumis melo var. (davesgarden.com)
  • radicis - cucumerinum Vakalounakis (Forc) is the causal agent of root and stem rot in cucurbits resulting in severe damage, particularly in greenhouse cucumber ( Cucumis sativus ) and muskmelon ( C . melo ). (nature.com)
  • The reference is to the chate cucumber ( Cucumis melo , var. (encyclopedia.com)
  • Cucumis melo agrestis - (Naudin. (pfaf.org)
  • Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). (pfaf.org)
  • The main purpose of the present research was, in a well-defined in vitro model of endothelial cells, to investigate whether a water/ethanol extract of Cucumis sativus L. (CSE) fruit can attenuate the damaging effect of pro-inflammatory lipopolysaccharide (LPS). (biomedcentral.com)
  • Moreover, the in vitro angiogenesis induced by inflammatory LPS was prevented by the presence of Cucunis sativus L. extract, at any doses tested. (biomedcentral.com)
  • Our results have clearly demonstrated that Cucumis sativus L. extract has attenuated lipopolysaccharide-induced inflammatory response in endothelial cells. (biomedcentral.com)
  • Non-sensitizing plant extract (also known by its Latin name of Cucumis sativus). (cosdna.com)
  • 0.0001) inhibitory activity by n-butanol fraction of C. sativus fruits extract was maximum, IC50 at a concentration of 52.76 μg/ml. (innovareacademics.in)
  • In conclusion, the consumption of C. sativus seed extract with daily dose of 500 mg results in desirable effects on serum lipid profile in adult hyperlipidemic patients. (ac.ir)
  • Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L. (nih.gov)
  • Here, we functionally characterized the cucumber ( Cucumis sativus L .) nitric oxide synthase-associated gene, NITRIC OXIDE ASSOCIATED 1 ( CsNOA1 ). (frontiersin.org)
  • Cucumber beetle resistance and mite susceptibility controlled by the bitter gene in Cucumis sativus L. (thefreedictionary.com)
  • Altunoglu YC, Baloglu P, Yer EN, Pekol S, Baloglu MC (2016) Identification and expression analysis of LEA gene family members in cucumber genome. (springer.com)
  • Molecular cloning and expression analysis of the ethylene insensitive3 (EIN3) gene in cucumber (Cucumis sativus). (qxmd.com)
  • cDNA cloning and characterization of a gibberellin-responsive gene in hypocotyls of Cucumis sativus L. (elsevier.com)
  • Fingerprint Dive into the research topics of 'cDNA cloning and characterization of a gibberellin-responsive gene in hypocotyls of Cucumis sativus L.'. Together they form a unique fingerprint. (elsevier.com)
  • The influence of plant growth regulators on callus induction from hypocotyls of cucumber (Cucumis sativus L. (thefreedictionary.com)
  • Cucumber hypocotyls (Cucumis sativus L. (elsevier.com)
  • Ondrej V, Navratilova B, Lebeda A (2002) Influence of GA 3 on the zygotic embryogenesis of Cucumis species in vitro . (springer.com)
  • Hypocotyl explants have been used to achieve regenerated plants in several species including Capsicum (Gunay and Rao, 1978), Peganum harmala (Ehsanpour and Saadat, 2002), and Cucumis sativus (Andr'yskova et al. (thefreedictionary.com)
  • sativus, the carrot, a plant species. (wikipedia.org)
  • 8 Foot Sativa, a New Zealand-based metal band Sativa (Jhené Aiko song) Sativanorte and Sativasur, towns/municipalities in the Colombian department of Boyacá Sativum (disambiguation) Sativus (disambiguation) Allen J. Coombes The A to Z of Plant Names: A Quick Reference Guide to 4000 Garden Plants, p. 59, at Google Books The major species of Cannabis are sativa, indica, and ruderalis. (wikipedia.org)
  • Peroxidase activity (POD) and catalase (CAT) in seeds (2, 12 and 24 hours) and seedlings (168 hours) of Cucumis sativus L. (thefreedictionary.com)
  • We investigated the effects of exogenous spermidine (Spd) on growth, photosynthesis and expression of the Calvin cycle-related genes in cucumber seedlings ( Cucumis sativus L.) exposed to NaCl stress. (ebscohost.com)
  • Effect of seed pretreatment by magnetic field on the sensitivity of cucumber ( Cucumis sativus ) seedlings to ultraviolet-B radiation. (thefreedictionary.com)
  • Cucumis sativus (cucumber), Raphanus sativus radicula (radish) and Eruca vesicaria sativa (rocket salad). (thefreedictionary.com)
  • Changes in Growth, Biochemical Constituents, and Antioxidant Potentials in Radish ( Raphanus sativus L.) under Cobalt Stress. (ebscohost.com)
  • The effects of cobalt (Co) stress on seedling vigor, photosynthetic pigment content, biochemical constituents, mineral status, and the activity of antioxidant enzymes in Raphanus sativus L. were studied. (ebscohost.com)
  • A full-length cDNA encoding transketolase (TK, designated as CsTK) was isolated from cucumber leaves (Cucumis sativa L. cv 'Jinyou 3') by RT-PCR and RACE. (qxmd.com)
  • Malinowski R, Filipecky M, Tagashira N, Wisniewska A, Gaj P, Plader W, Malepsy S (2004) Xyloglucan endotransglucosylase/hydrolase genes in cucumber ( Cucumis sativus )-differential expression during somatic embryogenesis. (springer.com)
  • Somatic embryogenesis and plant regeneration from cell suspension cultures of Cucumis sativus L. (thefreedictionary.com)
  • To improve somatic embryogenesis of Cucumis sativus , two types of explants (cotyledons and stem sections) were cultured on Murashige and Skoog (MS) media supplemented with 2,4-D (2.0 mg·L -1 ) + kinetin (0.5 mg·L -1 ). (ashs.org)
  • Embryogenesis and Plant Regeneration from Cotyledon Protoplast Culture of Cucumber ( Cucumis sativus L. (naver.com)
  • Transcriptomic analysis reveals the roles of microtubule-related genes and transcription factors in fruit length regulation in cucumber (Cucumis sativus L. (deepdyve.com)
  • Brassinosteroids promote photosynthesis and growth by enhancing activation of Rubisco and expression of photosynthetic genes in Cucumis sativus. (qxmd.com)
  • Effects of light quality on CO2 assimilation, chlorophyll-fluorescence quenching, expression of Calvin cycle genes and carbohydrate accumulation in Cucumis sativus. (qxmd.com)
  • Chen JF, Zhang SL, Zhang XG (1994) The Xishuangbanna gourd ( Cucumis sativus var. (springer.com)
  • In host range studies, Cucumber ( Cucumis sativus L.), Ash gourd (Benincasa hispida Thumb. (thefreedictionary.com)
  • Cuevas HE, Song H, Staub JE, Simon PW (2010) Inheritance of beta-carotene-associated flesh color in cucumber ( Cucumis sativus L.) fruit. (springer.com)
  • In the present study, we have investigated the mechanism through which carbon dioxide induces ethylene biosynthesis in cucumber ( Cucumis sativus L.) fruit. (oup.com)
  • The present study was designed to screen the anti-aging and anti-wrinkle potential of Cucumis sativus fruit through in vitro estimation of antioxidant, anti-hyaluronidase, anti-elastase, anti-collagenase/anti-matrix metalloproteinase (MMP)-1, and anti-tyrosinase activity. (innovareacademics.in)
  • In the study of the lyophilized juice of Cucumis sativus fruit (CSLJ) and its antioxidant , anti-hyaluronidase, and anti-elastase activity found that Content of ascorbic acid was calculated with respect to the standard compound and it was found to be 3.5 ± 0.23% w/w. (blogspot.com)
  • CSLJ is the rich source of ascorbic acid and this study thereby rationalizes the use of C. sativus as potential anti-wrinkle agent in cosmetic products, according to " Cucumis sativus fruit-potential antioxidant , anti-hyaluronidase, and anti-elastase agen t" by Nema NK, Maity N, Sarkar B, Mukherjee PK. (blogspot.com)
  • Antioxidant and anti-aging assays of Oryza sativa extracts, vanillin and coumaric acid. (innovareacademics.in)
  • Examples Examples of crops incorporating this word and its variations into their Latin name include: Allium sativum, garlic. (wikipedia.org)
  • 3) Evaluation of the Effects of Cucumis sativus Seed Extracts on Serum Lipids in Adult Hyperlipidemic Patients: A Randomized Double-Blind Placebo-Controlled Clinical Trial. (brettelliott.com)
  • In the research of six plant parts (leaves, stems, roots, whole fruits, calyxes, and fruits without calyxes) of Cucumis sativus and theirs inhibitory effects on melanogenesis found that the depigmenting mechanism of extracts from leaves and stems of C. SATIVUS involves the expression of tyrosinase. (blogspot.com)
  • Percentage, germination speed index (GSI) and average time of germination (AGT) of Cucumis sativus L. (thefreedictionary.com)
  • Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). (pfaf.org)
  • Aydemir I (2009) Determination of genetic diversity in cucumber ( Cucumis sativus L.) germplasms. (springer.com)
  • Bisht IS, Bhat KV, Tanwar SPS, Bhandari DC, Joshi K, Sharma AK (2004) Distribution and genetic diversity of Cucumis sativus var. (springer.com)
  • Horejsi T, Staub JE (1999) Genetic variation in cucumber ( Cucumis sativus L.) as assessed by random amplified poly-morphic DNA. (springer.com)
  • PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L. (plos.org)
  • Genetic Diversity and Population Structure of Cucumber ( Cucumis sativus L. (plos.org)
  • We monitored the protein, chlorophyll and electron transport activities in Cucumis sativus cv Poinsette cotyledonary leaves and observed that by 20th day, there was a 50%, 41 % and 30-33% decline in the chlorophyll, protein and photosystem II activity respectively when compared to 6th day cotyledonary leaves taken as control. (niscair.res.in)
  • Molecular mapping reveals structural rearrangements and quantitative trait loci underlying traits with local adaptation in semi-wild Xishuangbanna cucumber (Cucumis sativus L. var. (deepdyve.com)
  • Expression and epigenetic profile of protoplast cultures ( Cucumis sativus L. (springer.com)
  • Gajdová J, Navrátilová B, Smolná J, Lebeda A (2007) Factors affecting protoplast isolation and cultivation of Cucumis spp. (springer.com)
  • Ondřej V, Navrátilová B, Lebeda A (2009b) The heterochromatin as a marker for protoplast differentiation of Cucumis sativus . (springer.com)
  • Increasing Resistance to Oxidative Damage in Cucumber (Cucumis sutivus L.) Plants by Exogenous Application of Salicylic Acid and Paclobutrazol. (ebscohost.com)
  • Pot experiments were conducted on cucumber (Cucumis sativus L.) plants in the green house of the National Research Center. (ebscohost.com)
  • To view Cucumis plants offered near you, enter your postcode or log in . (greenplantswap.co.uk)
  • Cannabidiol is one of the components of the Cannabis sativa and Cannabis indica plants. (paulaschoice.com)
  • Eruca sativa, the rocket or arugula, a leaf vegetable. (wikipedia.org)
  • Kinetin improves photosynthetic and antioxidant responses of Nigella sativa to counteract salt stress. (ebscohost.com)
  • The present study involves analysis of growth, photosynthesis, oxidant (HO) accumulation, and antioxidant enzyme activities in Nigella sativa L. as affected by foliar kinetin (KIN) application during salt stress. (ebscohost.com)
  • The genome of the cucumber, Cucumis sativus L. (genome.jp)
  • Thirteen (Three gynoecious and ten monoecious) germplasm lines of cucumber ( Cucumber sativus L.) were characterized by sodium dodecyl sulphate polyacrylamide vertical slab gel electrophoresis (SDS-PAGE). (ijcmas.com)
  • Stable-isotope-labelled (2H6, 18O) 3-hydroxy-3-phenylpropanoic acid, a putative intermediate in the biosynthesis of benzoic acid (BA) and salicylic acid (SA) from cinnamic acid, has been synthesized and administered to cucumber (Cucumis sativus L.) and Nicotiana attenuata (Torrey). (nih.gov)
  • Chryseobacterium cucumeris sp. (elsevier.com)
  • Fingerprint Dive into the research topics of 'Chryseobacterium cucumeris sp. (elsevier.com)