Cucumis sativus: A creeping annual plant species of the CUCURBITACEAE family. It has a rough succulent, trailing stem and hairy leaves with three to five pointed lobes.Cucumis melo: A plant species of the family CUCURBITACEAE, order Violales, subclass Dilleniidae known for the melon fruits with reticulated (net) surface including cantaloupes, honeydew, casaba, and Persian melons.Cucumis: A plant genus of the family CUCURBITACEAE, order Violales, subclass Dilleniidae best known for cucumber (CUCUMIS SATIVUS) and cantaloupe (CUCUMIS MELO). Watermelon is a different genus, CITRULLUS. Bitter melon may refer to MOMORDICA or this genus.Raphanus: A plant genus of the family BRASSICACEAE known for its peppery red root.Cucurbitaceae: The gourd plant family of the order Violales, subclass Dilleniidae, class Magnoliopsida. It is sometimes placed in its own order, Cucurbitales. 'Melon' generally refers to CUCUMIS; CITRULLUS; or MOMORDICA.Crocus: A plant genus, in the IRIDACEAE family, known as a source of Saffron.Coriandrum: A plant genus of the family APIACEAE. The leaves are the source of cilantro and the seeds are the source of coriander, both of which are used in SPICES.Lawsonia Plant: A plant genus of the family LYTHRACEAE that is the source of henna and has cytotoxic activity.Peronospora: A genus of OOMYCETES in the family Peronosporaceae. Most species are obligatory parasites and many are plant pathogens.Lathyrus: A plant genus in the family FABACEAE known for LATHYRISM poisoning.Ascorbate Oxidase: An enzyme that converts ascorbic acid to dehydroascorbic acid. EC 1.10.3.3.Cucurbita: A plant genus of the family CUCURBITACEAE, order Violales, subclass Dilleniidae, which includes pumpkin, gourd and squash.Cotyledon: A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)Glutamate Synthase (NADH): A FLAVOPROTEIN enzyme for AMMONIA assimilation in BACTERIA, microorganisms and PLANTS. It catalyzes the oxidation of 2 molecules of L-GLUTAMATE to generate L-GLUTAMINE and 2-oxoglutarate in the presence of NAD+.Plant Roots: The usually underground portions of a plant that serve as support, store food, and through which water and mineral nutrients enter the plant. (From American Heritage Dictionary, 1982; Concise Dictionary of Biology, 1990)Protochlorophyllide: A photo-active pigment localized in prolamellar bodies occurring within the proplastids of dark-grown bean leaves. In the process of photoconversion, the highly fluorescent protochlorophyllide is converted to chlorophyll.Chromosomes, Plant: Complex nucleoprotein structures which contain the genomic DNA and are part of the CELL NUCLEUS of PLANTS.Plant Proteins: Proteins found in plants (flowers, herbs, shrubs, trees, etc.). The concept does not include proteins found in vegetables for which VEGETABLE PROTEINS is available.Plant Leaves: Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)Seedling: Very young plant after GERMINATION of SEEDS.Gene Expression Regulation, Plant: Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in plants.Plant Growth Regulators: Any of the hormones produced naturally in plants and active in controlling growth and other functions. There are three primary classes: auxins, cytokinins, and gibberellins.DNA, Plant: Deoxyribonucleic acid that makes up the genetic material of plants.Hypocotyl: The region of the stem beneath the stalks of the seed leaves (cotyledons) and directly above the young root of the embryo plant. It grows rapidly in seedlings showing epigeal germination and lifts the cotyledons above the soil surface. In this region (the transition zone) the arrangement of vascular bundles in the root changes to that of the stem. (From Concise Dictionary of Biology, 1990)Plants: Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.Genome, Plant: The genetic complement of a plant (PLANTS) as represented in its DNA.Genes, Plant: The functional hereditary units of PLANTS.Chlorophyll: Porphyrin derivatives containing magnesium that act to convert light energy in photosynthetic organisms.Books, Illustrated: Books containing photographs, prints, drawings, portraits, plates, diagrams, facsimiles, maps, tables, or other representations or systematic arrangement of data designed to elucidate or decorate its contents. (From The ALA Glossary of Library and Information Science, 1983, p114)Plant Diseases: Diseases of plants.Gardening: Cultivation of PLANTS; (FRUIT; VEGETABLES; MEDICINAL HERBS) on small plots of ground or in containers.Sea Cucumbers: A class of Echinodermata characterized by long, slender bodies.Cosmetics: Substances intended to be applied to the human body for cleansing, beautifying, promoting attractiveness, or altering the appearance without affecting the body's structure or functions. Included in this definition are skin creams, lotions, perfumes, lipsticks, fingernail polishes, eye and facial makeup preparations, permanent waves, hair colors, toothpastes, and deodorants, as well as any material intended for use as a component of a cosmetic product. (U.S. Food & Drug Administration Center for Food Safety & Applied Nutrition Office of Cosmetics Fact Sheet (web page) Feb 1995)Fruit: The fleshy or dry ripened ovary of a plant, enclosing the seed or seeds.Biological Science Disciplines: All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.Brassinosteroids: Plant steroids ubiquitously distributed throughout the plant kingdom. They play essential roles in modulating growth and differentiation of cells at nanomolar to micromolar concentrations.Steroids, Heterocyclic: Steroidal compounds in which one or more carbon atoms in the steroid ring system have been substituted with non-carbon atoms.Environmental Pollution: Contamination of the air, bodies of water, or land with substances that are harmful to human health and the environment.Cholestanols: Cholestanes substituted in any position with one or more hydroxy groups. They are found in feces and bile. In contrast to bile acids and salts, they are not reabsorbed.Photosynthesis: The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide using energy obtained from light rather than from the oxidation of chemical compounds. Photosynthesis comprises two separate processes: the light reactions and the dark reactions. In higher plants; GREEN ALGAE; and CYANOBACTERIA; NADPH and ATP formed by the light reactions drive the dark reactions which result in the fixation of carbon dioxide. (from Oxford Dictionary of Biochemistry and Molecular Biology, 2001)Photosystem II Protein Complex: A large multisubunit protein complex found in the THYLAKOID MEMBRANE. It uses light energy derived from LIGHT-HARVESTING PROTEIN COMPLEXES to catalyze the splitting of WATER into DIOXYGEN and of reducing equivalents of HYDROGEN.Hydrogen Sulfide: A flammable, poisonous gas with a characteristic odor of rotten eggs. It is used in the manufacture of chemicals, in metallurgy, and as an analytical reagent. (From Merck Index, 11th ed)Seeds: The encapsulated embryos of flowering plants. They are used as is or for animal feed because of the high content of concentrated nutrients like starches, proteins, and fats. Rapeseed, cottonseed, and sunflower seed are also produced for the oils (fats) they yield.Pythium: A genus of destructive root-parasitic OOMYCETES in the family Pythiaceae, order Peronosporales, commonly found in cultivated soils all over the world. Differentiation of zoospores takes place in a vesicle.Hair Color: Color of hair or fur.Software: Sequential operating programs and data which instruct the functioning of a digital computer.User-Computer Interface: The portion of an interactive computer program that issues messages to and receives commands from a user.Internet: A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.Algorithms: A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.Computer Graphics: The process of pictorial communication, between human and computers, in which the computer input and output have the form of charts, drawings, or other appropriate pictorial representation.Posters as Topic: Single or multi-sheet notices made to attract attention to events, activities, causes, goods, or services. They are for display, usually in a public place and are chiefly pictorial.ExhibitionsNobel PrizeExhibits as Topic: Discussions, descriptions or catalogs of public displays or items representative of a given subject.Museums

Thiol-dependent degradation of protoporphyrin IX by plant peroxidases. (1/376)

Protoporphyrin IX (PP) is the last porphyrin intermediate in common between heme and chlorophyll biosynthesis. This pigment normally does not accumulate in plants because its highly photodynamic nature makes it toxic. While the steps leading to heme and chlorophylls are well characterized, relatively little is known of the metabolic fate of excess PP in plants. We have discovered that plant peroxidases can rapidly degrade this pigment in the presence of thiol-containing substrates such as glutathione and cysteine. This thiol-dependent degradation of PP by horseradish peroxidase consumes oxygen and is inhibited by ascorbic acid.  (+info)

Enhancer-like properties of an RNA element that modulates Tombusvirus RNA accumulation. (2/376)

Prototypical defective interfering (DI) RNAs of the plus-strand RNA virus tomato bushy stunt virus contain four noncontiguous segments (regions I-IV) derived from the viral genome. Region I corresponds to 5'-noncoding sequence, regions II and III are derived from internal positions, and region IV represents a 3'-terminal segment. We analyzed the internally located region III in a prototypical DI RNA to understand better its role in DI RNA accumulation. Our results indicate that (1) region III is not essential for DI RNA accumulation, but molecules that lack it accumulate at significantly reduced levels ( approximately 10-fold lower), (2) region III is able to function at different positions and in opposite orientations, (3) a single copy of region III is favored over multiple copies, (4) the stimulatory effect observed on DI RNA accumulation is not due to region III-mediated RNA stabilization, (5) DI RNAs lacking region III permit the efficient accumulation of head-to-tail dimers and are less effective at suppressing helper RNA accumulation, and (6) negative-strand accumulation is also significantly depressed for DI RNAs lacking region III. Collectively, these results support a role for region III as an enhancer-like element that facilitates DI RNA replication. A scanning-type mutagenesis strategy was used to define portions of region III important for its stimulatory effect on DI RNA accumulation. Interestingly, the results revealed several differences in the requirements for activity when region III was in the forward versus the reverse orientation. In the context of the viral genome, region III was found to be essential for biological activity. This latter finding defines a critical role for this element in the reproductive cycle of the virus.  (+info)

Conversion of cucumber linoleate 13-lipoxygenase to a 9-lipoxygenating species by site-directed mutagenesis. (3/376)

Multiple lipoxygenase sequence alignments and structural modeling of the enzyme/substrate interaction of the cucumber lipid body lipoxygenase suggested histidine 608 as the primary determinant of positional specificity. Replacement of this amino acid by a less-space-filling valine altered the positional specificity of this linoleate 13-lipoxygenase in favor of 9-lipoxygenation. These alterations may be explained by the fact that H608V mutation may demask the positively charged guanidino group of R758, which, in turn, may force an inverse head-to-tail orientation of the fatty acid substrate. The R758L+H608V double mutant exhibited a strongly reduced reaction rate and a random positional specificity. Trilinolein, which lacks free carboxylic groups, was oxygenated to the corresponding (13S)-hydro(pero)xy derivatives by both the wild-type enzyme and the linoleate 9-lipoxygenating H608V mutant. These data indicate the complete conversion of a linoleate 13-lipoxygenase to a 9-lipoxygenating species by a single point mutation. It is hypothesized that H608V exchange may alter the orientation of the substrate at the active site and/or its steric configuration in such a way that a stereospecific dioxygen insertion at C-9 may exclusively take place.  (+info)

Cucumber cotyledon lipoxygenase during postgerminative growth. Its expression and action on lipid bodies. (4/376)

In cucumber (Cucumis sativus), high lipoxygenase-1 (LOX-1) activity has been detected in the soluble fraction prepared from cotyledons of germinating seeds, and the involvement of this enzyme in lipid turnover has been suggested (K. Matsui, M. Irie, T. Kajiwara, A. Hatanaka [1992] Plant Sci 85: 23-32; I. Fuessner, C. Wasternack, H. Kindl, H. Kuhn [1995] Proc Natl Acad Sci USA 92: 11849-11853). In this study we have investigated the expression of the gene lox-1, corresponding to the LOX-1 enzyme. LOX-1 expression is highly coordinated with that of a typical glyoxysomal enzyme, isocitrate lyase, during the postgerminative stage of cotyledon development. In contrast, although icl transcripts accumulated in tissue during in vitro senescence, no accumulation of lox-1 mRNA could be observed, suggesting that lox-1 plays a specialized role in fat mobilization. LOX-1 is also known to be a major lipid body protein. The partial peptide sequences of purified LOX-1 and lipid body LOX-1 entirely coincided with that deduced from the lox-1 cDNA sequence. The data strongly suggest that LOX-1 and lipid body LOX-1 are derived from a single gene and that LOX-1 can exist both in the cytosol and on the lipid bodies. We constructed an in vitro oxygenation system to address the mechanism of this dual localization and to investigate the action of LOX-1 on lipids in the lipid bodies. LOX-1 cannot act on the lipids in intact lipid bodies, although degradation of lipid body proteins, either during seedling growth or by treatment with trypsin, allows lipid bodies to become susceptible to LOX-1. We discuss the role of LOX-1 in fat mobilization and its mechanism of action.  (+info)

Both RNA rearrangement and point mutation contribute to repair of defective chimeric viral genomes to form functional hybrid viruses in plants. (5/376)

The putative movement protein gene (p27) plus 5' and 3' flanking sequences of cucumber leaf spot aureusvirus (CLSV) was inserted into an infectious cucumber necrosis tombusvirus (CNV) cDNA clone containing a deletion in the cell-to-cell movement protein gene. Approximately 5% of plants inoculated with synthetic transcripts of two such defective chimeric CNV/CLSV cDNA clones developed systemic symptoms 7-19 days postinoculation. Reverse transcription-polymerase chain reaction and sequence analysis of virus obtained from systemically infected leaves indicated that both point mutation and RNA rearrangement (deletion) contributed to the formation of movement competent CNV/CLSV hybrid viruses. The hybrid viruses were found to accumulate to high levels in infected plants, to form stable virions, and to be mechanically transmissible. In addition, a hybrid virus that lacked 50 amino acids at the carboxyl-terminal region of CLSV p27 was still capable of facilitating CNV movement. These data provide experimental evidence for the role of CLSV p27 in viral cell-to-cell movement and demonstrate that p27 can enable efficient movement of the CNV genome. Moreover, the data show that RNA rearrangements known to occur during CNV RNA replication can contribute to rapid evolution of the CNV genome.  (+info)

alpha-oxidation of fatty acids in higher plants. Identification of a pathogen-inducible oxygenase (piox) as an alpha-dioxygenase and biosynthesis of 2-hydroperoxylinolenic acid. (6/376)

A pathogen-inducible oxygenase in tobacco leaves and a homologous enzyme from Arabidopsis were recently characterized (Sanz, A., Moreno, J. I., and Castresana, C. (1998) Plant Cell 10, 1523-1537). Linolenic acid incubated at 23 degrees C with preparations containing the recombinant enzymes underwent alpha-oxidation with the formation of a chain-shortened aldehyde, i.e., 8(Z),11(Z), 14(Z)-heptadecatrienal (83%), an alpha-hydroxy acid, 2(R)-hydroxy-9(Z),12(Z),15(Z)-octadecatrienoic acid (15%), and a chain-shortened fatty acid, 8(Z),11(Z),14(Z)-heptadecatrienoic acid (2%). When incubations were performed at 0 degrees C, 2(R)-hydroperoxy-9(Z),12(Z),15(Z)-octadecatrienoic acid was obtained as the main product. An intermediary role of 2(R)-hydroperoxy-9(Z), 12(Z),15(Z)-octadecatrienoic acid in alpha-oxidation was demonstrated by re-incubation experiments, in which the hydroperoxide was converted into the same alpha-oxidation products as those formed from linolenic acid. 2(R)-Hydroperoxy-9(Z),12(Z), 15(Z)-octadecatrienoic acid was chemically unstable and had a half-life time in buffer of about 30 min at 23 degrees C. Extracts of cells expressing the recombinant oxygenases accelerated breakdown of the hydroperoxide (half-life time, about 3 min at 23 degrees C), however, this was not attributable to the recombinant enzymes since the same rate of hydroperoxide degradation was observed in the presence of control cells not expressing the enzymes. No significant discrimination between enantiomers was observed in the degradation of 2(R,S)-hydroperoxy-9(Z)-octadecenoic acid in the presence of recombinant oxygenases. A previously studied system for alpha-oxidation in cucumber was re-examined using the newly developed techniques and was found to catalyze the same conversions as those observed with the recombinant enzymes, i.e. enzymatic alpha-dioxygenation of fatty acids into 2(R)-hydroperoxides and a first order, non-stereoselective degradation of hydroperoxides into alpha-oxidation products. It was concluded that the recombinant enzymes from tobacco and Arabidopsis were both alpha-dioxygenases, and that members of this new class of enzymes catalyze the first step of alpha-oxidation in plant tissue.  (+info)

Spider mite-induced (3S)-(E)-nerolidol synthase activity in cucumber and lima bean. The first dedicated step in acyclic C11-homoterpene biosynthesis. (7/376)

Many plant species respond to herbivory with de novo production of a mixture of volatiles that attracts carnivorous enemies of the herbivores. One of the major components in the blend of volatiles produced by many different plant species in response to herbivory by insects and spider mites is the homoterpene 4,8-dimethyl-1,3(E), 7-nonatriene. One study (J. Donath, W. Boland [1995] Phytochemistry 39: 785-790) demonstrated that a number of plant species can convert the acyclic sesquiterpene alcohol (3S)-(E)-nerolidol to this homoterpene. Cucumber (Cucumis sativus L.) and lima bean (Phaseolus lunatus L.) both produce 4,8-dimethyl-1,3(E),7-nonatriene in response to herbivory. We report the presence in cucumber and lima bean of a sesquiterpene synthase catalyzing the formation of (3S)-(E)-nerolidol from farnesyl diphosphate. The enzyme is inactive in uninfested cucumber leaves, slightly active in uninfested lima bean leaves, and strongly induced by feeding of the two-spotted spider mite (Tetranychus urticae Koch) on both plant species, but not by mechanical wounding. The activities of the (3S)-(E)-nerolidol synthase correlated well with the levels of release of 4, 8-dimethyl-1,3(E),7-nonatriene from the leaves of the different treatments. Thus, (3S)-(E)-nerolidol synthase is a good candidate for a regulatory role in the release of the important signaling molecule 4,8-dimethyl-1,3(E),7-nonatriene.  (+info)

Phloem long-distance transport of CmNACP mRNA: implications for supracellular regulation in plants. (8/376)

Direct support for the concept that RNA molecules circulate throughout the plant, via the phloem, is provided through the characterisation of mRNA from phloem sap of mature pumpkin (Cucurbita maxima) leaves and stems. One of these mRNAs, CmNACP, is a member of the NAC domain gene family, some of whose members have been shown to be involved in apical meristem development. In situ RT-PCR analysis revealed the presence of CmNACP RNA in the companion cell-sieve element complex of leaf, stem and root phloem. Longitudinal and transverse sections showed continuity of transcript distribution between meristems and sieve elements of the protophloem, suggesting CmNACP mRNA transport over long distances and accumulation in vegetative, root and floral meristems. In situ hybridization studies conducted on CmNACP confirmed the results obtained using in situ RT-PCR. Phloem transport of CmNACP mRNA was proved directly by heterograft studies between pumpkin and cucumber plants, in which CmNACP transcripts were shown to accumulate in cucumber scion phloem and apical tissues. Similar experiments were conducted with 7 additional phloem-related transcripts. Collectively, these studies established the existence of a system for the delivery of specific mRNA transcripts from the body of the plant to the shoot apex. These findings provide insight into the presence of a novel mechanism likely used by higher plants to integrate developmental and physiological processes on a whole-plant basis.  (+info)

*List of Bohol flora and fauna

Cucumis sativus pipino - Cucumber; zuchinni; Cucurbita pepo radish; Raphanus repolyo - cabbage; Brassica oleracea saluyot - ... watermelon - Curcubita citrullus Linn.; also Citrullus vulgaris Schrad.; pakwan (INTRODUCED) ahos - Garlic; Allium sativum; ... Oryza sativa) baka - Philippine cow; Bos taurus Baboy ihás - baboy damó; wild boar; Sus scrofa bóngcaras - sea cow; Dugong ... bottle gourd Corindrium sativum - coriander leaf adelfa - Oleander; South sea rose; Nerium indicum Mill.; Neroum oleander ...

*Pseudomonas tomato

lachrymans attacks cucumbers (Cucumis sativus). 'Pseudomonas tomato' pv. maculicola attacks members of Brassica and Raphanus. ' ...

*Plastocyanin family of copper-binding proteins

... from Cucumis sativus (Cucumber) peelings; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from ...

*List of sequenced plant genomes

Cucumis melo L.) Huang S, Li R, Zhang1 Z; et al. (December 2009). "The genome of the cucumber, Cucumis sativus L". Nature ... 2011). "The draft genome and transcriptome of Cannabis sativa". Genome Biology. 12 (10): R102. doi:10.1186/gb-2011-12-10-r102. ... April 2002). "A draft sequence of the rice genome (Oryza sativa L. ssp. indica)". Science. 296 (5565): 79-92. Bibcode:2002Sci ... April 2002). "A draft sequence of the rice genome (Oryza sativa L. ssp. japonica)". Science. 296 (5565): 92-100. Bibcode: ...

*List of MeSH codes (B06)

... cucumis melo (wd , gwp gwe g , in it p) MeSH B06.388.100.300.188.666 --- cucumis sativus (wd , gwp gwe g , in it p) MeSH ... avena sativa (wd , gwp gwe g , in it p) MeSH B06.388.100.822.066 --- bambusa (wd , gwp gwe g , in it p) MeSH B06.388.100.822. ... oryza sativa (wd , gwp gwe g , in it p) MeSH B06.388.100.822.680 --- panicum (wd , gwp gwe g , in it p) MeSH B06.388.100.822. ... vicia sativa (wd , gwp gwe g , in it p) MeSH B06.388.100.401.984 --- wisteria (wd , gwp gwe g , in it p) MeSH B06.388.100.425 ...

*Beijing Genomics Institute

Cucumis sativus L". Nature Genetics. 41 (12): 1275-1281. doi:10.1038/ng.475. PMID 19881527. BGI Shenzhen Ranked 4th of Top 10 ...

*Tryptophol

In Cucumis sativus (cucumber), the enzymes indole-3-acetaldehyde reductase (NADH) and indole-3-acetaldehyde reductase (NADPH) ... "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol. Chem. 251 (4): 907-13. PMID ...

*Indole-3-acetaldehyde reductase (NADPH)

Brown HM, Purves WK (1976). "Isolation and characterization of indole-3-acetaldehyde reductases from Cucumis sativus". J. Biol ...

*List of cucumber varieties

"Photosensitivity of Cucumber (Cucumis sativus L.) Seedlings Exposed to Ultraviolet-B Radiation". Chilean Journal of ...

*Cucumber

Cucumis sativus flower Komkommer (Cucumis sativus 'Gele Tros') in fields Cucumber slices used for garnish Cucumber blessing ... Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55: 193. doi: ... has been applied to Cucumis anguria L., a related species of Cucumis sativus, the most common cucumber plant. Burpless ... Cucumber (Cucumis sativus) is a widely cultivated plant in the gourd family, Cucurbitaceae. It is a creeping vine that bears ...

*Melon necrotic spot virus

In particular, the hosts include watermelons (Citrullus lanatus), cucumbers (Cucumis sativus), and melons (Cucumis melo). On ... Kishi first discovered MNSV on Cucumis melo in a greenhouse setting in that year. For the next two decades, there were minor ... It is considered to be an endemic virus in greenhouses and field productions of Cucurbitaceae crops, including melon (Cucumis ... in Cucumis melo L. 'Doublon'". Euphytica. 134 (3): 319. doi:10.1023/B:EUPH.0000004969.95036.1d. Herrera-Vásquez, J. A., M. C. ...

*Inositol 3-alpha-galactosyltransferase

"Partial characterization of the galactinol forming enzyme from leaves of Cucumis sativus L". Plant Sci. Lett. 23: 25-33. doi: ...

*Nannotrigona testaceicornis

2008). "Pollination of cucumber, Cucumis sativus L. (Cucurbitales: Cucurbitaceae), by the stingless bees Scaptotrigona aff. ...

*Sedoheptulose-bisphosphatase

7-bisphosphatase from Cucumis sativus". Scientia Horticulturae. 129 (3): 414-420. doi:10.1016/j.scienta.2011.04.010. Anderson, ...

*List of sequenced plastomes

Plader W, Yukawa Y, Sugiura M, Malepszy S (2007). "The complete structure of the cucumber (Cucumis sativus L.) chloroplast ... "The Genomes of Oryza sativa: a history of duplications". PLoS Biology 3(2):e38. Epub 2005 Feb 1. Hiratsuka J, Shimada H, ... Oryza sativa) chloroplast genome: intermolecular recombination between distinct tRNA genes accounts for a major plastid DNA ...

*Trichoderma harzianum

Induction of defense responses in cucumber plants (Cucumis sativus L.) by the biocontrol agent Trichoderma harzianum. Appl. ...

*Asparagus virus 1

Diagnostic host: insusceptible host species Beta vulgaris, Cucumis sativus, Glycine max, Nicotiana tabacum, Phaseolus vulgaris ... rapa, Capsicum frutescens, Celosia cristata, Chenopodium murale, Cucumis sativus, Cucurbita pepo, Datura stramonium, Daucus ... its host range is limited and it causes only necrotic local lesions in Chenopodium quinoa and no symptoms in Cucumis sativus, ... Pisum sativum, Sesamum indicum, Solanum tuberosum, Vicia faba, Vigna unguiculata, Vigna unguiculata ssp. sesquipedalis, Zea ...

*Trans,cis-2,6-Nonadienal

Cucumis sativus) and Muskmelons (Cucumis melo) by Aroma Extract Dilution Analysis". Journal of Food Science. 55 (1): 193-195. ...

*Childbirth in Trinidad and Tobago

Cucumis sativus), garlic (Allium sativum), and tamarind leaf (Tamarindus indica) were also used to control high blood pressure ...

*List of honey plants

C.lanatus Nakai Cucumis melo L. Cucumis sativus L. Cucurbita maxima Duchesne Cucurbita pepo L. Luffa cylindrica M.Roem. ... Apium graveolens L. Daucus carota L. Pastinaca sativa L. Petroselinu sativum Hoffm. All the plants of this family are found in ... gongyloides Eruca sativa Mill. Lobularia maritima (L.) Desv. Sinapis alba L. Apuleia molaris Spruce ex Benth. Bauhinia ... Medicago sativa L. Melilotus alba Medik. Melilotus officinalis Lam. Myrocarpus frondosus M.Allemão Sweetia fruticosa var. ...

*Cucumber mosaic virus

This virus was first found in cucumbers (Cucumis sativus) showing mosaic symptoms in 1934, hence the name Cucumber mosaic. ...

*Alternanthera mosaic virus

Cucumis sativus), and black-eyed peas (Vigna unguiculata) also became systemically infected. Many of these plants showed mild ...

*Watermelon mosaic virus

... some resistance has been identified in Cucumis sativus. Cultural practices such as crop rotation have also been found to be ... and necrosis when infecting Pisum sativum (Pea) or mosaic lesions and fruit distortion in Citrullus lanatus (Watermelon). Some ...

*Anadevidia peponis

The larvae feed on Cucurbitaceae species, including Citrullus lanatus, Cucumis sativus, Cucurbita moschata, Cucurbita pepo, ...

*Apple mosaic virus

Cucumis sativus). Furthermore, ApMV is not currently thought to be seed or pollen transmitted due to limited time and space ...

*White clover mosaic virus

Cucumis sativus), squash ( Cucurbita pepo ), and tomatoes (Lycopersicon esculentum). This virus is believed to be distributed ... It is also known to infect peas (Pisum sativum), faba beans (Vicia faba), green beans (Phaseolus vulgaris), cowpea (Vigna ...
cucumber plant leaves baby cucumber plant cucumber seeds baby baby cucumber plant leaves cucumber plant leaves turning yellow brown.. new cucumber plant leaves turning white why do turn brown whats wrong with my garden university of extension,why do cucumber plant leaves turn brown yellow spots are turning how to prevent them,cucumber plant leaves drying up mosaic virus turning yellow and dying wilting,cucumber plant leaves curling up turning yellow brown the down side of downy mildew botanical garden spots,cucumber plant leaves turning yellow and dying yellowing brown spots on plants wilting,cucumber plant leaves wilting yellow brown and dying gardening new turning white bottom,young cucumber plants stock photo ac plant leaves drooping drying up turning white,why do cucumber plant leaves turn brown yellow edges wilting dying,why are the leaves on my cucumber seedlings curling up home plant turning brown yellow do turn,cucumber plant bottom leaves dying yellow brown and gardening drooping ...
Osmopriming is a technique in which the seed of different plant species is partially or fully hydrated with water or solutions with different osmotic potentials aiming to intensify physiological processes, what improves and excellerates germination. In our study cucumber seed (Cucumis sativus L.) from three different production years was osmoprimed with 300 μM solutions of two different hydrogen sulphide donors: slowly releasing donor GYY4137 and fast releasing donor NaHS. After imbibition, seed was dried and germinated on filter paper moistened with 25 mM NaCl solution or water, respectively. Main hypothesis was that H2S influences germination and vigour of cucumber seedlings germinated in the presence of salt, and that applied H2S donors (NaHS and GYY4137) will differ significantly in their effect. In treatment with NaHS the oldest seed from production year 2009/2010 had significantly lower standard germination and germination energy, while in treatment with GYY4137 differences among seed ...
XXXVI-th WILGA Symposium is the event in International Year of Light 2015 organized with UNESCO. Clic HERE for more infiormation. ...
Its name immediately makes you want to know more - exploding cucumber plant or squirting cucumber plant. So what are squirting cucumber plants? Where on earth does the volatile squirting cucumber grow? Click this article to learn more.
Lipid bodies are cellular compartments containing triacylglycerols. They are encompassed by a phospholipid monolayer and decorated with characteristic proteins. In plants, lipid bodies are synthesized during seed formation but acquire new proteins during seed germination. In germinating cucumber (Cucumis sativus) seeds, the set of newly synthesized proteins appearing in the lipid bodies at the early stage of triacylglycerol mobilization comprises a special form of lipoxygenase. We isolated the lipid body lipoxygenase and characterized fragments prepared by limited proteolysis and cleavage with cyanogen bromide. A very early expression of lipid body lipoxygenase was found by studying the rate of de novo synthesis of lipoxygenase forms during germination. This allowed a clear distinction of this enzyme from other lipoxygenase isoforms. Hence, for determining the molecular structure of lipid body lipoxygenase we analyzed a cDNA prepared from mRNA of cotyledons at day 1 of germination. From the cDNA ...
Cosmetic Analysis has rated the ingredient Cucumis Sativus. Alternative names: Cucumber Extract; Cucumber Oil; Gurke; Gurken-Extrakt | Origin: Plant-derived...
CHIQUITO, Adrielle Aparecida; GOMES JUNIOR, Francisco Guilhien and MARCOS-FILHO, Julio. Assessment of physiological potential of cucumber seeds using the software Seedling Vigor Imaging System® (SVIS®). Rev. bras. sementes [online]. 2012, vol.34, n.2, pp.255-263. ISSN 0101-3122. http://dx.doi.org/10.1590/S0101-31222012000200010.. The software Seed Vigor Imaging System (SVIS®), has been successfully used to evaluate seed physiological potential by automated analyses of scanned seedlings. In this research, the efficiency of this system was compared to other tests accepted for assessing cucumber (Cucumis sativus L.) seed vigor of distinct seed lots of Supremo and Safira cultivars. Seeds were subjected to germination, traditional and saturated salt accelerated aging, seedling emergence, seedling length and SVIS analyses (determination of vigor indices and seedling growth uniformity, lengths of primary root, hypocotyl and whole seedlings). It was also determined whether the definition of seedling ...
Changes in lipoxygenase (LOX) protein pattern and/or activity were investigated in relation to acquired resistance of cucumber (Cucumis sativus L.) leaves against two powdery mildews, Sphaerotheca fuliginea (Schlecht) Salmon and Erysiphe cichoracearum DC et Merat. Acquired resistance was established by spraying leaves with salicylic acid (SA) or 2,6-dichloroisonicotinic acid (INA) and estimated in whole plants by infested leaf area compared to control plants. SA was more effective than INA. According to Western blots, untreated cucumber leaves contained a 97 kDa LOX form, which remained unchanged for up to 48 h after pathogen inoculation. Upon treatment with SA alone for 24 h or with INA plus pathogen, an additional 95 kDa LOX form appeared which had an isoelectric point in the alkaline range. For the induction of this form, a threshold concentration of 1 mM SA was required, higher SA concentrations did not change LOX-95 expression which remained similar between 24 h and 96 h but further ...
黃瓜(Cucumis Sativus)提取物 - 表面活性劑 - 表面活性劑百科 - 表面活性劑百科(Surfactant.TOP),表面活性劑,陰離子表面活性劑,陽離子表面活性劑,非離子表面活性劑,兩性離子表面活性劑,氟表面活性劑,矽表面活性劑,純天然表面活性劑,高分子表面活性劑,生物表面活性劑,特殊表面活性劑 - 第1頁
黃瓜(Cucumis Sativus)油 - 表面活性劑 - 表面活性劑百科 - 表面活性劑百科(Surfactant.TOP),表面活性劑,陰離子表面活性劑,陽離子表面活性劑,非離子表面活性劑,兩性離子表面活性劑,氟表面活性劑,矽表面活性劑,純天然表面活性劑,高分子表面活性劑,生物表面活性劑,特殊表面活性劑 - 第1頁
EWGs Skin Deep® database gives you practical solutions to protect yourself and your family from everyday exposures to chemicals in personal care products.
EWGs Skin Deep® database gives you practical solutions to protect yourself and your family from everyday exposures to chemicals in personal care products.
Rust-colored spots on cucumber (Cucumis sativus) plants is a sure sign that these warm season vegetables are under attack by a fungal disease. If not treated, the rust spots can greatly reduce the ...
Aquaporin (AQP) proteins comprise a group of membrane intrinsic proteins (MIPs) that are responsible for transporting water and other small molecules, which is crucial for plant survival under stress conditions including salt stress. Despite the vital role of AQPs, little is known about them in cucumber (Cucumis sativus L.). In this study, we identified 39 aquaporin-encoding genes in cucumber that were separated by phylogenetic analysis into five sub-families (PIP, TIP, NIP, SIP, and XIP). Their substrate specificity was then assessed based on key amino acid residues such as the aromatic/Arginine (ar/R) selectivity filter, Frogers positions, and specificity-determining positions. The putative cis-regulatory motifs available in the promoter region of each AQP gene were analyzed and results revealed that their promoter regions contain many abiotic related cis-regulatory elements. Furthermore, analysis of previously released RNA-seq data revealed tissue- and treatment-specific expression patterns of
One respondent said: "Everyone knows tomatoes are fruit, but some of the others on the list were really tricky. I always assumed a pea was a. Fruit and Vegetable Gardening A-Z: Cucumbers train them to grow up a small fence or trellis, otherwise space each plant 3 feet apart in rows. Cucumber (Cucumis sativus) is a widely cultivated plant in the gourd family, Cucurbitaceae. It is a creeping vine that bears cucumiform fruits that are used as vegetables. . They can grow as long as 2 feet ( m). They are nearly seedless, Genome size‎: ‎ Mb.. ...
Read "24-Epibrassinolide alleviates organic pollutants-retarded root elongation by promoting redox homeostasis and secondary metabolism in Cucumis sativus L, Environmental Pollution" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Cucumbers require warm days, plenty of sunshine and cool nights for best growth. They are a fast-growing crop ready for harvest in 50 to 70 days. If bugs are eating your cucumber plants, identify ...
Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ... Some people get stomach problems when they eat cucumber skin ... – A free PowerPoint PPT presentation (displayed as a Flash slide show) on PowerShow.com - id: 1577d4-YjdhO
The first question to ask is whether the cucumber is really drying up, or if . If the cucumber leaves are yellowing, you may be giving the plants too much water, . Why Are My Cucumber Leaves Curling Up? My Japanese Red Maple Has Dried ...
Effects of Hexaconazole on Growth and Antioxidant Potential of Cucumber Seedlings under UV-B Radiation - Antioxidative enzymes;Cucumber;Hexaconazole;Photosynthetic pigments;UV-B;
The cucumber is the edible fruit of the cucumber plant Cucumis sativus. The plant has been cultivated for 3000 years and is widely cultivated today. The cucumber plant has large leaves that form a canopy over the fruit. The vine is grown on the ground or on trellises, often in greenhouses ...
Jazzer has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
Cool Cucumbers - The ancient prophet Isaiah compared his wayward countrymen to gardeners who had abandoned their cucumber gardens. Since then the lowly Cucumis Sativus has made its way into greenhouses farms gardens kitchens salads and pickle jars...
More than 40 different diseases infect cucumbers, and theyre susceptible to weeds and insect pests when growing conditions arent right. Recognise some of the common diseases help you prevent loss of fruit. Your local county extension office has information about treating plant diseases in your area.
Fruit of Cucumis sativus, a widely cultivated plant in the gourd family Cucurbitaceae, which includes squash, and in the same genus as the muskmelon. Usually eaten raw in unripe green form, as a vegetable. Majority of people describe the taste as mild, light melon-like and almost watery while a small minority think its repugnant and perfume-like. Can be used in salads, appetizers, sauces, sandwiches, cocktails, cold soups and stir fry. Has many health benefits (due to high content of minerals) and cosmetic properties (due to its cooling and cleansing effect). one medium cucumber contains 1.25 cup of water, 12% daily value of potassium, 14% of vitamin C, 9% of Magnesium, 0.4g of flavonoid Kaempferol ...
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...
there are 5 times as many tomato plants.in the gatden as there ate cucumber plants. the number of pepper plants is 7 more than the sum of the number of tomato and cucumber plants. there are 19 pepper plants in the garden. how many ...
Un ortaggio dalle proprietà diuretiche e disintossicanti se ingerito, utile contro borse e occhiaie, ma anche per contrastare le rughe in maschere di bellezza. I cetrioli sono i frutti della Cucumis sativus, una pianta erbacea appartenente alla famiglia delle Cucurbitacee (come anguria, melone, zucca, zucchine etc.) che cresce nelle zone a clima caldo-temperato. Frutto cilindrico e allungato…
Looking for cucumber mildew? Find out information about cucumber mildew. A downy mildew of cucumbers and melons caused by Peronoplasmopara cubensis . A powdery mildew of cucumbers and melons caused by Erysiphe cichoracearum Explanation of cucumber mildew
Planting six cucumber plants was, it turns out, excessive. No matter how much cucumber soup you intend to make.I have been swamped by them for weeks now. Thriving as they do in warm wet conditions the...
Cucumber Seed Oil ingredient profile and wholesale ordering. Extensive range of superior quality natural cosmeceutical/personal care ingredients.
The Plant Management Network, an online journal of the American Phytopathological Society with content appropriate for all plant health practitioners.
Summer is here and now that youve got your gardens planted, tis the season for animal pests, insects, and disease to become more visible, and more destructive - Mother Nature likes to give us all a challenge from time to time!. But never fear! Our experienced Green Thumb staff have got you covered. We are available to diagnose your lawn, vegetable, flower, tree, and shrub issues whenever we are open, and can offer easy organic and non-organic solutions for almost any plant problems.. So, if youve got a yellowing cucumber plant, a patchy lawn, holes in your rose leaves, gnarly growths on your peach tree, or something else entirely, save yourself hours of online searching and just stop by with a sample and let us take a look. We know the area, the recent weather, the plants and the local pests, and were happy to use our experience and knowledge to help!. Before you stop by, please collect a sample of the problem as follows:. ...
Cosgrove Daniel J. , Li Lian Chao , Cho Hyung-Taeg , BENNING Susanne Hoffmann , MOORE Richard C. , BLECKER Douglas Plant and cell physiology 43(12), 1436-1444, 2002-12-01 参考文献77件 被引用文献7件 ...
How to lose weight cucumber diet and not to harm health? How long does it take to achieve good results? In this article you will learn all about the diet on cucumbers and get acquainted with already made diet and reviews thinner ...
Cucumber leaf spot virus (CLSV) is a member of the Aureusvirus genus, family Tombusviridae. The auxiliary replicase of Tombusvirids has been found to localize to endoplasmic reticulum (ER), peroxisomes or mitochondria; however, localization of the auxiliary replicase of aureusviruses has not been determined. We have found that the auxiliary replicase of CLSV (p25) fused to GFP colocalizes with ER and that three predicted transmembrane domains (TMDs) at the N-terminus of p25 are sufficient for targeting, although the second and third TMDs play the most prominent roles. Confocal analysis of CLSV infected 16C plants shows that the ER becomes modified including the formation of punctae at connections between ER tubules and in association with the nucleus. Ultrastructural analysis shows that the cytoplasm contains numerous vesicles which are also found between the perinuclear ER and nuclear membrane. It is proposed that these vesicles correspond to modified ER used as sites for CLSV replication. ...
Cucumis é un xénero con 243 especies de plantas con flores pertencente á familia das Cucurbitáceas, que inclúe especies tan importantes coma o cogombro (Cucumis sativus) ou o meloeiro (Cucumis melo).. ...
In my home garden, my cucumber plant leaves are turning brown/ yellow. It seems to be spreading. What should I do? I worked so hard on...
China Fungicide Control Blight and Downy Mildew on Cucumber, Tomato. Famoxadone & Cymoxanil Wdg, Find details about China Famoxadone, Cymoxanil from Fungicide Control Blight and Downy Mildew on Cucumber, Tomato. Famoxadone & Cymoxanil Wdg - Shanghai Fuang Agrochemical Co. Ltd.
Cucumber is generally a thermophilic species; however, cultivars have been selected for higher yield during winter cultivation in unheated glasshouses in temperate regions. We tested whether photosynthesis in these varieties had greater chilling tolerance. There was no difference in the instantaneous reduction of photosynthesis at low temperature between four winter glasshouse and four summer field cultivars. After 5 d of 10°C and 100 µmol m-2 s-1 photon flux density, the four field cultivars had a sustained depression of photosynthesis after returning to clement conditions. This inhibition was associated with reduced rates of CO2 fixation and photosystem II (PSII) electron transport in the light, but not with sustained PSII photoinhibition. However, photosynthesis in the glasshouse genotypes was nearly identical to the pre-chill rates. Chill impacts on light-adapted chlorophyll fluorescence parameters, such as the quantum yield of PSII electron transport (ϕPSII), correlated well with overall ...
Calcium-dependent protein kinases (CDPKs) constitute a unique family of enzymes in plants that are characterized by a C-terminal calmodulin (CaM)-like domain. Through protein kinase assays, we have examined the levels of cucumber calcium-dependent kinase $(C_SCDPK)$ activity in various organs of cucumber seedlings and plants. The activity of $C_SCDPK$ was highest in cucumber plant leaves followed by seedling roots and hypocotyls; however, cucumber plant flowers, seedling cotyledons, and hooks had levels that were barely detectable. The $C_SCDPKs$ were immunolocalized using polyclonal antibodies that are highly specific against a part of the kinase domain of a calcium-dependent protein kinase $(C_SCDPKS)$ in the phloem sieve elements (SEs) in various organs of cucumber. In addition, this study indicates the presence of CsCDPKs in organelle-like bodies associated with the plasma membrane of sieve elements in mature stems and roots as well as in the storage bodies of immature seeds. These findings ...
Cucumber, a very important vegetable crop worldwide, is easily damaged by pests. Aphid is one of the most serious cucumber pests and frequently cause severe damage to commercially produced crops. Understanding the genetic mechanisms underlying pest resistance is important for aphid-resistant cucumber varieties breeding. In this study, two parental cucumber lines, JY30 (aphid susceptible) and EP6392 (aphid resistant), and pools of resistant and susceptible (n = 50 each) plants from 1000 F2 individuals derived from crossing JY30 with EP6392, were used to detect genomic regions associated with aphid resistance in cucumbers. The analysis was performed using specific length amplified fragment sequencing (SLAF-seq), bulked segregant analysis (BSA) and single nucleotide polymorphism index (SNP-index) methods. A main effect QTL (quantitative trait locus) of 0.31 Mb on Chr5, including 43 genes, was identified by association analysis. Sixteen of the 43 genes were identified as potentially associated with aphid
Cucumis sativus var. sikkimensis) -This year I finally was able to acquire some seeds to this rare cucumber which I had been searching for for years. This is the information given to my by the French seed saver, who I got my original seeds from: "The historic cucumber of Sikkim. Fat, large fruit can reach 15" long by 6" wide. The ripe fruit is a unique rusty red color and is good eaten cooked or raw....A nice, short, fat fruit with peculiar maroon color netting the skin. Can be eaten young or used in winter dried arrangements like ornamental gourds. To 1 kilo...... In Asia cucumbers are often stir-fried and are quite tasty. This variety is grown in the Himalayas of Sikkim and Nepal. Sir Joseph Hooker first discovered it in the eastern Himalayas in 1848. Here is part of what he wrote about it: So abundant were the fruits, that for days together I saw gnawed fruits lying by the natives paths by the thousands, and every man, woman and child seemed engaged throughout the day in devouring them. ...
Huggies One & Done Refreshing Wipes, Refill Pack, Scented, Alcohol-free, Hypoallergenic Cucumber & Green Tea at Walgreens. Get free shipping at $35 and view promotions and reviews for Huggies One & Done Refreshing Wipes, Refill Pack, Scented, Alcohol-free, Hypoallergenic Cucumber & Green Tea
Slicing cucumbers are best served fresh and raw, but they can also be sautéed, fried, or even mixed in drinks. Cucumbers contain most of their nutrients in their seeds and their skin. It is advised, from a nutritional standpoint, to eat cucumbers with both. However, cucumbers have wax coatings on their skin. Organically grown cucumbers have non-synthetic waxes where conventionally grown cucumbers may have synthetic waxes and pesticides. If you choose to eat the skin, buy organic cucumbers to eliminate the risk of synthetic wax consumption. If buying organic is not an option, then thoroughly wash each cucumber with a brush or simply remove the skin before eating.. ...
The present results indicate that aqueous and ethanolic extracts of C. sativus petal and stigma have antinociceptive activity in chemical pain tests. The stigma extracts showed activity against acute and chronic inflammation. The petal ethanolic extract showed anti-inflammatory activity in the chronic inflammatory test.. In respect to LD50 values and maximum non-fatal doses, the stigma extracts were more toxic than the petal extracts. LD50 values of aqueous and ethanolic stigma extracts have been reported as 1.6 g/kg, i.p. (1.16, 2.22) and 3.38 g/kg, i.p. (2.55, 4.52) in mice [6]. According to a toxicity classification [11], stigma and petal extracts are "relatively toxic" and "low toxic", respectively. Treatment with the C. sativus extract also significantly prolonged the life span of cisplatin-treated mice almost three-fold [12]. Toxicity studies showed that the hematological and biochemical parameters were within normal range with saffron extract [2].. As preliminary phytochemical results ...
I think I used about 12 cucumbers but you can pickle any amount, just adjust the quantity of spiced vinegar you make. The night before, peel and slice all your cucumbers and place in a large bowl. Pour over about a tablespoon of salt. Dont worry, you wont eat the salt. If you dont drawn the fluid from the cucumbers it dilutes the vinegar too much in the jars. Mix the cucumbers around with your hands, making sure the salt is well distributed, put a clean tea towel over the top of the bowl and leave it overnight. The following morning there will be a lot of fluid in the cucumber bowl. Pour it all into a colander and let the salty water go down the drain. Run clean cold water from the tap over the cucumbers to make sure all the salt is removed. Leave the cucumber in the colander for about an hour to drain ...
This photo shows my daughters favorite kind from our Sweden trip this summer - Mother Annas thinly sliced pickles (Mor Annas tunnskivad gurka). [Question to Swedes, shouldnt it be Mor Annas tunnskivadE gurka in proper Swedish?]. Gurka means cucumber, and must be from the same root word as gherkin, the English word for tiny little pickled cucumbers. The word cucumber comes from the old Latin or Greek since the genus name is Cucumis. Cucumbers are a kind of berries with a leathery skin, and are placed together with pumpkins, squashes, and melons in the Cucurbitaceae family ...
This project is related to Objective 1 of this in-house project: develop reduced salt fermentation procedures for cucumbers and cabbage that will consistently produce vegetables with firm texture and appropriate flavor. The bacteriophage ecology in commercial cucumber fermentation was studied with the aim of applying this knowledge for the selection of a starter culture for cucumber fermentation. Brine samples were collected over a 90-day period and served as the source for the isolation of approximately 700 bacterial colonies belonging to the lactic acid bacteria (LAB) and enterobacteriacea groups. While isolates served as potential hosts, the filtered brine samples were used as phage sources. A total of 57 independent phage isolates against LAB were obtained, primarily from the seventh and fourteenth days of fermentation, in which the hosts reached maximum counts (109 CFU/ml). Representative LAB phages from each sampling day were characterized by electron micrographs. The majority of the ...
Cucumbers contain sugar, vitamins, mineral salts which contribute to the improvement of albumin assimilation and digestion. In folk medicine, fresh cucumbers and juice of them are used for stomach disorders, liver and kidneys. Read about natural remedies with cucumber that make miracles with your skin.. To protect the face skin, the skin on the hands and neck, cucumbers are used in folk cosmetics.. Mask based on cucumber heals skin, makes it softer, makes pores disappear, makes the skin whiter and is recommended for tired skin and sere, with large pores and pimples.. Try this natural remedies with cucumber following the steps:. - Clean a cucumber, peel it with more meaty, and put it on your skin. From the moment you clean the cucumber used it in skin cosmetics in maximum few hours, dont have to passed too long, and not be afraid to put the shell in the refrigerator; its extraordinary properties are maintained.. - Get some cucumber juice, put it on a towel and covered up the face for several ...
Cucurbitacin B and Cucurbitacin C are the names of the compounds which cause bitterness in cucumbers. These compounds are found in all plant parts, but are concentrated in the stem end of the fruit. There is some in the blossom end, as well. Different varieties of cucumbers seem to contain more bitterness than others. You can cut off the ends to remove the bulk of the bitterness, but there will still be some under the skin of the cuke. Some people believe that if they peel a cucumber from the stem end to the blossom end, theyll remove more of the bitterness. There have been scientific studies, and the direction of peeling doesnt really make any difference in the amount of bitterness in a cucumber ...
The lettuce/bean/cucumber trio bed is actually starting to come along now. Which I know because Im spending this weekend thinning the lettuce for salads and hauling away superfluous cucumber seedlings to new Forever Homes. And by Forever, I mean until the fall when they die of their own accord. If you live in the SF Bay Area and want a cuke seedling grown all haphazard like by yours truly, let me know. I may have a few left after this weekends adoption fair. The lettuce, however, not up for grabs. We are going to start eating salad for breakfast. ...
Sedoheptulose-bisphosphatase (also sedoheptulose-1,7-bisphosphatase or SBPase) (EC 3.1.3.37) is an enzyme that catalyzes the removal of a phosphate group from sedoheptulose 1,7-bisphosphate to produce sedoheptulose 7-phosphate. SBPase is an example of a phosphatase, or, more generally, a hydrolase. This enzyme participates in the Calvin cycle. SBPase is a homodimeric protein, meaning that it is made up of two identical subunits. The size of this protein varies between species, but is about 92,000 Da (two 46,000 Da subunits) in cucumber plant leaves. The key functional domain controlling SBPase function involves a disulfide bond between two cysteine residues. Additionally, SBPase requires the presence of magnesium (Mg2+) to be functionally active. SBPase is bound to the stroma-facing side of the thylakoid membrane in the chloroplast in a plant. Some studies have suggested the SBPase may be part of a large (900 kDa) multi-enzyme complex along with a number of other photosynthetic enzymes. SBPase ...
Great tasting, attractive, and highly productive. Uniform yields of sweet, crispy, bitter-free cucumbers with small seed cavities. Avg. 9–11" long. ...
How to Make Cucumber Juice. Cucumber juice is a very healthy and versatile drink. Cucumbers have a high content of water and contain noteworthy amounts of potassium, silica, vitamin A, vitamin C, folate, and chlorophyll, among other...
Health Benefits of Cucumber - Cucumber is a vegetable which is known for its mild and pleasant watery taste. It is a highly cultivated vegetable and is...
In this chapter, students explore the history of the bitter gene in cucumbers, which was found in a genebank and traded internationally between cucumber breeders. The students then explore transcription, translation, and the DNA basis for different types of mutations. This activity uses one of the modern tools of genomics-sequences from the GenBank public database-to explore mutation of cucumber genes.. ...
Cucumbers are rich in two of the most basic elements needed for healthy digestion: water and fiber. Adding cucumbers to your juice or salad can help you meet the ideal of amount of fiber your body needs - 50 grams per 1,000 calories consumed. If you struggle with acid reflux, you should know that drinking water can help suppress acute symptoms of acid reflux by temporarily raising stomach pH; its possible that water-rich cucumbers may have a similar effect ...
See all results for Cucumber Tea Sandwiches No Null Seeded Cucumber Recipes. Find more recipes at Foodily.com - the largest recipe search site - and see the ones your friends like.
See all results for Cucumber Soup Chilled Cucumber No (southern Living) Recipes. Find more recipes at Foodily.com - the largest recipe search site - and see the ones your friends like.
When choosing cucumbers, Korean cucumbers are ideal for their soft skin and crunch, but pickling cucumbers are a good substitute. This refreshing instant kimchi is wonderful with barbecued meats and a glass of beer.
Finds sub-sequences or patterns in the sequence and highlights the matching regions. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences. More... ...
Finds sub-sequences or patterns in the sequence and highlights the matching regions. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences. More... ...
Raphanus sativus is a ANNUAL growing to 0.5 m (1ft 8in) by 0.2 m (0ft 8in) at a fast rate. It is not frost tender. It is in flower from Jun to August, and the seeds ripen from Jul to September. The flowers are hermaphrodite (have both male and female organs) and are pollinated by Bees, flies.Suitable for: light (sandy), medium (loamy) and heavy (clay) soils. Suitable pH: neutral and basic (alkaline) soils. It can grow in semi-shade (light woodland) or no shade. It prefers moist soil.
photo Daucus carota ssp. sativus Cosmic Purple - Plants Photo Gallery - A database of more than 2690 photos from all over the world.
Raphanus sativus p67 protein: a chloroplastic RNA-binding protein, member of the PPR family; amino acid sequence in first source; GenBank A5243544-6
Compared to Miniature White (which it replaced) and Boothbys Blonde, the 3–5" fruits are similar in size, with improved flavor and disease resistance. ...
Enjoy Softsoap Cucumber and Melon liquid hand soap with a delightful scent inspired by sunny summer moments: cucumbers on the vine, a garden after a morning rain, freshly cut watermelon. Awaken you senses with this deliciously refreshing clean that smells crisp, green and slightly sweet. Wash away dirt and bacteria with its gentle cleansing formula. Hand soap comes in convenient pump bottle for easy dispensing.
Cucumbers contain three different types of lignans which reduce the risk of cardiovascular disease. Try Cucumber Avocado Rolls for some added benefit!
To make a cucumber detox drink, mix 8 cups of water with a medium-sized cucumber, a lemon and around 10 mint leaves. Let the mixture steep in the refrigerator overnight before you drink it....
Cucumber nutrition one of the oldest cultivated crops. It has a lot of benefits. Know more about cucumber nutrition in this article.
Because cucumbers are mostly water, they are low in calories -- even a large cucumber contains less than 100 calories -- but they still come loaded with...
Cucumbers are known to mankind for over six thousand years. Article about calories in cucumber, useful properties of cucumberm how to choose them.
Cucumbers imported from Mexico have spread salmonella to 27 states, leaving one person dead and making 285 sick, federal health officials said Friday. The importer has recalled the cucumbers but
Cucumbers are a low-calorie member of the botanical family that includes squashes and melons. More than 97 percent water, the cuke has only trace amounts of nutrients, with the exception of a ...
Cucumbers and tomatoes - vegetables, which contain plenty of vitamins and minerals. They are not only good for the body, but also an effective tool for weight loss.
Cucumber water is much more flavorful, easier to make and a much healthier alternative to soda or juices.It helps in weight loss, Reduces Blood Pressure, Healthy skin, and boosts your bones.
So, vacation has left me and the fiance broke and we had to do a budget grocery shop. I bought myself a nice huge cucumber because it was 1.79 or so
Save time and spiralize crisp cucumber instead of chopping it for this easy, healthy vegetable side. Want to make it a meal? Just add grilled chicken, shrimp or canned chickpeas.
Youve probably been hearing a lot about cucumber water lately. The refreshing beverage that was once found almost exclusively at high-end spas is now becoming mainstream. In fact, its popping up eve...
In recent times slowly but surely we have seen a rise in the number of cucumber flavored drinks that are on the market. Its nowhere near the...
... - BellaOnline Nutrition Database - BellaOnline is committed to helping our visitors become healthy and happy. Our BellaOnline Nutrition Database will help you choose the healthiest foods for your chosen lifestyle.
... - BellaOnline Nutrition Database - BellaOnline is committed to helping our visitors become healthy and happy. Our BellaOnline Nutrition Database will help you choose the healthiest foods for your chosen lifestyle.
via: GreenMedInfo by: Sayer Ji August 4, 2012 On sweltering August days, no one wants to spend time at the stove, and sometimes the grill is even too much to bear. Some days your best kitchen tool is a blender and your most refreshing ingredient is a cooling cucumber. Although it will never be mistaken…
You know those times when you just need something salty with a nice crunch? Most peoples go-to is potato chips, but you and I both know those do next to nothing for your health. Instead, the next time youre feeling munchy, give these delicious cucumber chips a try. The thought may sound strange at first, but trust me, you wont regret making these…
Oddly enough, cucumber is not just beneficial on the face and eyes. It can be used on cellulite! Mix ground coffee with cumber juice, and some raw honey. You can apply this to cellulite and wrap it in cloth. Leave it on for 30 minutes before rinsing ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Like vitamins and minerals, water is essential for good health. It is found in every cell, organ and tissue in your body. You may find water too boring to...
In July 2013, a melon (Cucumis melo var. Saski) field in Yolo County, California, was inspected as part of a phytosanitary inspection for seed production. The leaves of the plants showed mosaic, green mottle, and blotches. When plant sap was examined using a transmission electron microscope, rigid rod-shaped particles were observed. Melon plant samples were analyzed by both CDFA and USDA APHIS PPQ laboratories and tested positive using DAS-ELISA against Cucumber green mottle mosaic virus (CGMMV) (Agdia, Elkhart, IN). To confirm the presence of CGMMV, total RNA was analyzed by RT-PCR using primers CGMMV-F5370 5′-CTAATTATTCTGTCGTGGCTGCGGATGC-3′ and CGMMV-R6390 5′-CTTGCAGAATTACTGCCCATA-3′ designed by PPQ based on 21 genomic sequences of CGMMV found worldwide. The 976-bp amplicon was sequenced (GenBank Accession No. KJ453559) and BLAST analysis showed the sequence was 95% identical to MP and CP region of CGMMV isolates reported from Russia (GQ495274, FJ848666), Spain (GQ411361), and Israel ...
The hemibiotrophic pathogen Colletotrichum orbiculare develops biotrophic hyphae inside cucumber (Cucumis sativus) cells via appressorial penetration; later, the pathogen switches to necrotrophy. C. orbiculare also expresses specific effectors at different stages. Here, we found that virulence-related effectors of C. orbiculare accumulate in a pathogen-host biotrophic interface. Fluorescence-tagged effectors accumulated in a ring-like region around the neck of the biotrophic primary hyphae. Fluorescence imaging of cellular components and transmission electron microscopy showed that the ring-like signals of the effectors localized at the pathogen-plant interface. Effector accumulation at the interface required induction of its expression during the early biotrophic phase, suggesting that transcriptional regulation may link to effector localization. We also investigated the route of effector secretion to the interface. An exocytosis-related component, the Rab GTPase SEC4, localized to the necks of ...
Examine the potential for in-field diagnostics to assist rapid detection of the virus on farms known/ suspected to be infected with ...
Colletotrichum orbiculare is a plant pathogen of melons and cucumber. Sherriff, Christine; Whelan, Mitzi J.; Arnold, Gillian M.; Lafay, Jean-Francois; Brygoo, Yves; Bailey, John A. (1994). "Ribosomal DNA Sequence Analysis Reveals New Species Groupings in the Genus Colletotrichum". Experimental Mycology. 18 (2): 121-138. doi:10.1006/emyc.1994.1014. ISSN 0147-5975. Index Fungorum USDA ARS Fungal ...
ISHS II International Symposium on Saffron Biology and Technology THE STUDY OF INCREASING ROOTS SHOOTS AND HAIRY ROOTS PRODUCTION BY DIFFERENT EXTRACTS OF SAFFRON (CROCUS SATIVUS L.) IN MUNGBEAN (VIGNA RADIATA) SEEDLINGS
Refreshing natural facial toner made with aloe, white tea and cucumber fruit extracts. Formulated to balance your skin after cleansing or for an on the go hydration boost.
Aqua (Water) (Eau), Sodium Laureth Sulfate, Cocamide MEA, Cocamidopropyl Betaine, Sodium Methyl Cocoyl Taurate, Caprylyl Glycol, Sodium Chloride, PEG-7 Glyceryl Cocoate, Glycol Stearate, Polyquaternium-7, Hydroxypropyl Guar Hydroxypropyltrimonium Chloride, Sodium Cocoyl Sarcosinate, Isostearamidopropyl Morpholine Lactate, Tetrasodium EDTA, Citric Acid, Quaternium-80, Olea Europe (Olive) Fruit Oil, Acetum (Vinegar) (Vinaigre), Propylene Glycol, Cucumis Sativus (Cucumber) Fruit Extract, Rosmarinus Officinalis (Rosemary) Leaf Extract, Menthe Piperita (Peppermint) Oil, Parfum (Fragrance), Linalool, Limonene, Benzyl Benzoate, Phenoxyethanol ...
Determining the redox potential of a system can be a useful tool in evaluating the thermodynamic changes that occur over a period of time. Currently, fermentation industries use pH measurements to assess the progress of fermentation and growth of lactic acid bacteria (LAB). Redox potential (Eh) measures the transfer of electrons within a system, rather than solely the concentration of hydrogen ions, as measured by pH. Continuous monitoring of fermentation by Eh may allow for more descriptive analysis of the metabolic process and could offer a method for the earlier prediction of spoilage by yeasts. The trends in redox potential of fermenting cucumbers were observed to evaluate the possible application of this parameter in monitoring the development of fermentation. Additionally, an evaluation of the effect of gas purging on microbial growth during the fermentation was conducted using redox potential trends as a monitoring tool. Cucumbers were packed and brined using sodium chloride, calcium ...
Rimmer Lasting Finish by Kate Moss 20 adalah lipstik pertama buatan Kate Moss yang didesain dengan warna pink keunguan yang sangat nyata dan tahan hingga 8 jam. Formulanya diperkaya dengan Black Diamonds. Lipstik ini sesuai dengan gaya dan keunikan Kate Moss yang tidak habis termakan zaman. How To Use: Aplikasikan lipstik langsung pada bibir, untuk mendapatkan hasil yang sempurna dapat menggunakan Lip Liner terlebih dahulu agar hasil lipstik lebih rapi Ingredients: Ricinus Communis (Castor) Seed Oil, Candelilla cera, Octyldodecanol, Caprylic/Capric Triglyceride, Myristyl Lactate, VP/Hexadecene Copolymer, Ozokerite, Lanolin, Castor Oil/IPDI Copolymer, Meadowfoam Estolide, Myristyl Myristate, Parfum, Silica, Benzyl Benzoate, Di-PPG-3 Myristyl Ether Adipate, Dipentaerythrityl Hexa C5-9 Acid Esters, Sorbitan sesquioleate, Tocopherol, Propylparaben, Diamond Powder, Ascorbyl Palmitate, Benzyl salicylate, Benzyl cinnamate, Linalool, Eau, Chamomilla Recutita, Cucumis Sativus, Tin oxide, Cinnamyl alcohol,
Genetic improvement of agronomic crops is necessary to cope with chilling stress. To identify the physiological factors responsible for this genotypic difference in chill-induced inhibition of photosynthesis, leaf CO2 assimilation, the electron flux in the chloroplast and the antioxidant metabolism in isolated chloroplasts were examined in two genotypes of cucumber (Cucumis sativus) plants with distinct chilling tolerance. Cucumber plants were exposed to 100 µmol m-2 s-1 at 9/7°C (day/night) for 10 d and were then returned to optimal conditions for 2 d. Chilling resulted in more significant reductions in rbcL and rbcS transcripts, ribulose-1,5-bisphosphate carboxylase-oxygenase (Rubisco) content and initial Rubisco activity, leading to higher electron flux to O2 in the chilling-sensitive genotype than in the chilling-tolerant genotype. The chilling-tolerant genotype showed lower H2O2 contents in the chloroplasts by maintaining higher H2O2-scavenging activity in the chloroplasts than in the ...
Greenhouse vegetable production is a very important and successful agricultural sector in Ontario. However, newly emerging viral or virus-like diseases have become a major limiting factor in greenhouse vegetable production. To determine the identity of the viral pathogens in the three major greenhouse vegetables in Ontario, we conducted in-depth sequencing of small RNAs isolated from virally infected plants used next-generation sequencing technology. Subsequent bioinformatics analyses revealed six viral pathogens including Bell pepper endornavirus (BPEV), Parietaria mottle virus (PMoV), Cucumber green mottle mosaic virus (CGMMV), Tobacco streak virus (TSV), Pepper mild mottle virus (PMMoV), and Pepino mosaic virus (PepMV). The full-length genome sequences of BPEV, PMoV, and CGMMV have been cloned and sequenced. Since CGMMV causes the most severe economic lossess, we further characterized CGMMV and constructed an infectious CGMMV clone for the development of an attnuated virus for the control of CGMMV.
Water, Sodium Lauroyl Sarcosinate, Acrylates/Steareth-20 Methacrylate Crosspolymer, Glycerin, Cocamidopropyl Betaine, Triethanolamine, Sodium Chloride, Hexylene Glycol, Propylene Glycol, Polyquaternium-39, Retinyl Palmitate, Tocopheryl Acetate, Butylene Glycol, Tocopherol, Vitis Vinifera?Grape?Leaf Extract, Aloe Barbadensis Leaf Extract, Chamomilla Recutita (Matricaria) Flower Extract ,Camellia Sinensis Leaf Extract, Cucumis Sativus(Cucumber) Fruit Extract, Panax Ginseng Root Extract, Avena Sativa(Oat) Kernel Extract, Saccharomyces Cerevisiae Extract, Hydrolyzed Soy Protein, Helianthus Annuus(Sunflower)Seed Oil, Honey Extract, Ethylhexylglycerin, Phenoxyethanol, Caprylyl Glycol, Fragrance. ...
Hawaiian Sol SPF 50 (6oz): Total Sunscreen; Marine and Reef Friendly Natural SolGuard SPF 50 is a biodegradable, non-toxic, blend of natural skin conditioning ingredients and natural sunscreens. Zinc Oxide provides total block and Broad Spectrum Protection. The natural ingredients, including Cucumber extracts; Organic Aloe leaf and Kukui oil assist the skins ability to hydrate and cool itself. Added, are plant extracts that are natural photo-receptors that assist screening UV rays. Wild pansy; Hibiscus and Green Coffee Bean not only are skin conditioners, but act as natural preservatives, as well. No Nano-technology is used in the processing of our natural minerals.. Active Ingredients: Natural, (Transparent) Zinc Oxide (17%). Inactive Ingredients: Organic Aloe Vera Leaf (Aloe Barbadensis Gel); Wild Pansy Extract (Viola Tricolor Extract); Green Coffee Bean extract (Coffee Arabica Bean Extract); Hibiscus (Hibiscus Rosa Sinensis Extract); Cucumber Extract (Cucumis Sativus Extract); Melon ...
Water (Aqua), Butylene Glycol, Methyl Gluceth-20, Polysorbate 20, Lavandula Angustifolia (Lavender) Oil, Althaea Officinalis Root Extract, Angelica Polymorpha Sinensis Root Extract, Arnica Montana Flower Extract, Cucumis Sativus (Cucumber) Fruit Extract, Daucus Carota Sativa (Carrot) Root Extract, Hamamelis Virginiana (Witch Hazel) Bark/Leaf/Twig Extract, Panthenol, Retinyl Palmitate, Tocopherol, Bisabolol, Propylene Glycol, Citric Acid, Sodium Citrate, Imidazolidinyl Urea, Sodium Benzoate, ...
Moisturizing formula colored from fruit and vegetable pigments for a flawless complexion. Organic white tea, acai oil, pomegranate oil, vitamins and antioxidants deliver necessary, skin beneficial nutrients for the most healthy skin. For Whom For deep medium complexions. For those who desire a moisturizing light to medium coverage foundation that also offers sun protection and a dewy finish. Directions For Use To use: Dot around face, use fingers to blend outwards really working it into the skin. Or use a brush to buff it all around face. Layer for more coverage. Ingredients Active Ingredients for Sun Protection: Titanium Dioxide, Zinc Oxide Aloe Barbadensis (Organic Aloe) Leaf Juice*, Cucumis Sativus (Cucumber) Juice, Euterpe Oleracea (Acai Berry) Fruit Oil, Punica Granatum (Pomegranate) Seed Oil, Oryza Sativa (Rice) Starch, Extracts of Prunus Persica (Peach) Fruit, Camellia Sinensis (Organic White Tea) Leaf*, Prunus Armeniaca (Apricot) Fruit, Daucus Carota Sativa (Carrot) Root, Punica Granatum ...
Water (Aqua); Salicylic Acid; SD Alcohol 40-B; Glycolic Acid; Caprylic/Capric Triglyceride; Azelaic Acid; Glycerin; Hexyl Laurate; Cetearyl Alcohol; Cetearyl Olivate; Butylene Glycol; Sorbitol; Lactic Acid; Sorbitan Olivate; PPG-12/SMDI Copolymer; Niacinamide; Cetyl Alcohol; Sodium Hyaluronate; Dicetyl Phosphate; Ceteth-10 Phosphate; Stearic Acid; Glyceryl Stearate; PEG-100 Stearate; Tocopheryl Acetate; Butyrospermum Parkii (Shea) Butter; Mangifera Indica (Mango) Seed Butter; Dimethicone; Ethyl Linoleate; Hexylresorcinol; Yeast Polysaccharides; Propylene Glycol; Symphytum Officinale Rhizome/Root Extract; Plantago Ovata Seed Extract; Glutamine; Proline; Leucine; Serine; Hedera Helix (Ivy) Leaf/Stem Extract; Cucumis Sativus (Cucumber) Fruit Extract; Sambucus Nigra Flower Extract; Arnica Montana Flower Extract; Parietaria Officinalis Extract; Phenoxyethanol; Caprylyl Glycol; Ethylhexylglycerin; Hexylene Glycol; Lavandula Angustifolia (Lavender) Oil; Imperata Cylindrica (Root) Extract; Carbomer; ...

KEGG GENOME: Cucumis sativus (cucumber)KEGG GENOME: Cucumis sativus (cucumber)

Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; ...
more infohttps://www.genome.jp/kegg-bin/show_organism?org=csv

Map of Cucumis sativus -- Discover LifeMap of Cucumis sativus -- Discover Life

... identification and distribution of Map of Cucumis sativus -- Discover Life ... Cucumis sativus @ American Museum of Natural History, Bee Specimen Record (1); Bernice P. Bishop Museum, Thematic Collection ...
more infohttp://www.discoverlife.org/mp/20m?kind=Cucumis+sativus

CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT || Skin Deep® Cosmetics Database | EWGCUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT || Skin Deep® Cosmetics Database | EWG

CUCUMIS SATIVUS (CUCUMBER) EXTRACT; CUCUMIS SATIVUS EXTRACT; CUCUMIS SATIVUS FRUIT EXTRACT; EXTRACT OF CUCUMBER; EXTRACT OF ... About CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT: Extract of the fruit of the cucumber, Cucumis sativus.. Function(s): Skin- ... Show all 447 recent products that contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT.. ...
more infohttps://www.ewg.org/skindeep/ingredient/701707/CUCUMIS_SATIVUS_%28CUCUMBER%29_FRUIT_EXTRACT/

Cucumis sativus Cucumber, Garden cucumber PFAF Plant DatabaseCucumis sativus Cucumber, Garden cucumber PFAF Plant Database

Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ... Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ...
more infohttps://pfaf.org/user/Plant.aspx?LatinName=Cucumis+sativus

Cucumis sativus  ( Jazzer Cucumber ) | Backyard GardenerCucumis sativus ( Jazzer Cucumber ) | Backyard Gardener

Jazzer has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
more infohttps://www.backyardgardener.com/plantname/cucumis-sativus-jazzer-cucumber/

CUM10 - CUM10 - Cucumis sativus (Cucumber) - CUM10 gene & proteinCUM10 - CUM10 - Cucumis sativus (Cucumber) - CUM10 gene & protein

Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... Camelina sativa (False flax) (Myagrum sativum). Brassica napus (Rape). Capsella bursa-pastoris (Shepherds purse) (Thlaspi ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
more infohttp://www.uniprot.org/uniprot/O64959

WRKY37 - WRKY protein - Cucumis sativus (Cucumber) - WRKY37 gene & proteinWRKY37 - WRKY protein - Cucumis sativus (Cucumber) - WRKY37 gene & protein

tr,E7CEX8,E7CEX8_CUCSA WRKY protein OS=Cucumis sativus OX=3659 GN=WRKY37 PE=2 SV=1 ...
more infohttps://www.uniprot.org/uniprot/E7CEX8

Photo of Cucumber (Cucumis sativus Straight Eight): crab spider - Garden.orgPhoto of Cucumber (Cucumis sativus 'Straight Eight'): crab spider - Garden.org

Thread by robertduval14: forgot to put this in the photo description...but a close look at the lower left petal will reveal a small and well camouflaged c...
more infohttps://garden.org/thread/view/15712/crab-spider/

Cucumis sativus | definition of Cucumis sativus by Medical dictionaryCucumis sativus | definition of Cucumis sativus by Medical dictionary

Cucumis sativus explanation free. What is Cucumis sativus? Meaning of Cucumis sativus medical term. What does Cucumis sativus ... Looking for online definition of Cucumis sativus in the Medical Dictionary? ... Cucumis sativus. Also found in: Dictionary, Thesaurus, Encyclopedia, Wikipedia.. Related to Cucumis sativus: Tribulus ... Cucumis sativus , definition of Cucumis sativus by Medical dictionary https://medical-dictionary.thefreedictionary.com/Cucumis+ ...
more infohttps://medical-dictionary.thefreedictionary.com/Cucumis+sativus

PPT - Cucumber Cucumis sativus PowerPoint presentation | free to view  - id: 1577d4-YjdhOPPT - Cucumber Cucumis sativus PowerPoint presentation | free to view - id: 1577d4-YjdhO

Cucumis sativus) - Cucumber (Cucumis sativus) Introduction Both cucumbers and melons are members of the same genus: Cucumis ... Cucumber Cucumis sativus. 1. Cucumber (Cucumis sativus)*Introduction *Both cucumbers and melons are members of the same genus ... Cucumis Sativus L. - Cucumis Sativus L. Nick Lorenz May 1, 2006 Phylogeny Interesting Facts Cucumbers originated in India where ... Cucumber Cucumis sativus. Description:. Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ...
more infohttp://www.powershow.com/view/1577d4-YjdhO/Cucumber_Cucumis_sativus_powerpoint_ppt_presentation

PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L.)PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L.)

Knowing the extent and structure of genetic variation in germplasm collections is essential for the conservation and utilization of biodiversity in cultivated plants. Cucumber is the fourth most important vegetable crop worldwide and is a model system for other Cucurbitaceae, a family that also includes melon, watermelon, pumpkin and squash. Previous isozyme studies revealed a low genetic diversity in cucumber, but detailed insights into the crops genetic structure and diversity are largely missing. We have fingerprinted 3,342 accessions from the Chinese, Dutch and U.S. cucumber collections with 23 highly polymorphic Simple Sequence Repeat (SSR) markers evenly distributed in the genome. The data reveal three distinct populations, largely corresponding to three geographic regions. Population 1 corresponds to germplasm from China, except for the unique semi-wild landraces found in Xishuangbanna in Southwest China and East Asia; population 2 to Europe, America, and Central and West Asia; and population 3
more infohttp://journals.plos.org/plosone/article/email?id=10.1371/journal.pone.0046919

Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.).  -...Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.). -...

Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.).. ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/19847386?dopt=Abstract

Identification and transcriptional analysis of dehydrin gene family in cucumber ( Cucumis sativus) | Springer for Research &...Identification and transcriptional analysis of dehydrin gene family in cucumber ( Cucumis sativus) | Springer for Research &...

Huang S, Li R, Zhang Z, Li L, Gu X, Fan W et al (2009) The genome of the cucumber, Cucumis sativus L. Nat Genet 41:1275-1281 ... Zhou Y, Hu L, Jiang L, Liu H, Liu S (2017b) Molecular cloning and characterization of an ASR gene from Cucumis sativus. Plant ... Cucumis sativus), enhances tolerance to heat and cold in Escherichia coli. AMB Express 7:182CrossRefPubMedPubMedCentralGoogle ... Identification and transcriptional analysis of dehydrin gene family in cucumber (Cucumis sativus). ...
more infohttps://rd.springer.com/article/10.1007%2Fs11738-018-2715-7

The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls  - ePrints SotonThe role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls - ePrints Soton

Morrell, Clare Katrina (1987) The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls. University of ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ... The role of calcium in auxin-induced cell elongation of Cucumis sativus hypocotyls ...
more infohttps://eprints.soton.ac.uk/393998/

Frontiers | Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress |...Frontiers | Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress |...

Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Here, we functionally characterized the cucumber (Cucumis sativus) nitric oxide synthase-associated gene, NITRIC OXIDE ... Cucumber (Cucumis sativus L.) Nitric Oxide Synthase Associated Gene1 (CsNOA1) Plays a Role in Chilling Stress. Xingwang Liu1,2† ... Citation: Liu X, Liu B, Xue S, Cai Y, Qi W, Jian C, Xu S, Wang T and Ren H (2016) Cucumber (Cucumis sativus L.) Nitric Oxide ...
more infohttps://www.frontiersin.org/articles/10.3389/fpls.2016.01652/full

Frontiers | The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis...Frontiers | The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis...

... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization ... Liu, L. (2008). Inheritance Analysis and QTL Mapping of Powdery Mildew Resistance in Cucumber (Cucumis sativus L.). Doctors ... The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus ...
more infohttps://www.frontiersin.org/articles/10.3389/fpls.2018.00544/full

24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress | Springer for...24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress | Springer for...

Cucumis sativus L. 24-Epibrassinolide Root Cell wall Lignin Ca(NO3)2 stress ... 24-Epibrassinolide-induced alterations in the root cell walls of Cucumis sativus L. under Ca(NO3)2 stress. ...
more infohttps://rd.springer.com/article/10.1007/s00709-017-1187-8

Photosynthetic pigments content, δ-aminolevulinic acid dehydratase and acid phosphatase activities and mineral nutrients...Photosynthetic pigments content, δ-aminolevulinic acid dehydratase and acid phosphatase activities and mineral nutrients...

Pot experiments were conducted on cucumber (Cucumis sativus L.) plants in the green house of the National Research Center. ... EFFECTS OF SALICYLIC ACID ON SEEDLING GROWTH AND NITROGEN METABOLISM IN CUCUMBER (CUCUMIS SATIVUS L.). Singh, Pramod Kumar; ... Subplastidic preparations from cotyledons of cucumber (Cucumis sativus L.) were tested for their ability to synthesize ... Cucumis sativus L.) exposed to NaCl stress. Salt stress reduced net photosynthetic rates (P), actual photochemical efficiency ...
more infohttp://connection.ebscohost.com/c/articles/49581768/photosynthetic-pigments-content-aminolevulinic-acid-dehydratase-acid-phosphatase-activities-mineral-nutrients-concentration-cadmium-exposed-cucumis-sativus-l

Water/ethanol extract of Cucumis sativus L. fruit attenuates lipopolysaccharide-induced inflammatory response in endothelial...Water/ethanol extract of Cucumis sativus L. fruit attenuates lipopolysaccharide-induced inflammatory response in endothelial...

Effect of Cucumis sativus L. extract (CSE) on LPS induced HO-1 expression. a Expression of HO-1 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS induced TLR4 expression. a Expression of TLR4 mRNA in pAECs treated with LPS ... Effect of Cucumis sativus L. extract (CSE) on LPS-induced pAECs toxicity. a Representative images of pAECs morphology under LPS ... Effect of Cucumis sativus L. extract on LPS-induced angiogenesis. pAECs were cultured on a extracellular matrix with LPS (10 μg ...
more infohttps://bmccomplementalternmed.biomedcentral.com/articles/10.1186/s12906-018-2254-1

24-Epibrassinolide alleviates organic pollutants-retarded root elongation by promoting redox homeostasis and secondary...24-Epibrassinolide alleviates organic pollutants-retarded root elongation by promoting redox homeostasis and secondary...

... organic pollutants-retarded root elongation by promoting redox homeostasis and secondary metabolism in Cucumis sativus L, ... Induction of systemic stress tolerance by brassinosteroid in Cucumis sativus. Xia, X.J.; Zhou, Y.H.; Ding, J.; Shi, K.; Asami, ... Effects of aqueous root extracts and hydrophobic root exudates of cucumber (Cucumis sativus L.) on nuclei DNA content and ... Selective trans-cinnamic acid uptake impairs [Ca2+](cyt) homeostasis and growth in Cucumis sativus L ...
more infohttps://www.deepdyve.com/lp/elsevier/24-epibrassinolide-alleviates-organic-pollutants-retarded-root-lbVazgz7W8

Transcriptomic analysis of short-fruit 1 (sf1) reveals new insights into the variation of fruit-related traits in Cucumis...Transcriptomic analysis of short-fruit 1 (sf1) reveals new insights into the variation of fruit-related traits in Cucumis...

... reveals new insights into the variation of fruit-related traits in Cucumis sativus, Scientific Reports" on DeepDyve, the ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), Chinese long 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14) inbred line CNS2 (WT, North China type), ZG (North European type), Chinese long 9930 ( ... Cucumber (Cucumis sativus L., 2n = 14), a member of the family Cucurbitaceae, is one of the most economically important ...
more infohttps://www.deepdyve.com/lp/springer_journal/transcriptomic-analysis-of-short-fruit-1-sf1-reveals-new-insights-into-tjXTYCaMx7

Cucumis sativus - ICGCucumis sativus - ICG

Cucumber, Cucumis sativus L. is one of the most important cultivated vegetable crops, ranking 4th in quantity of world ... Retrieved from "http://192.168.118.79:9052/index.php?title=Cucumis_sativus&oldid=8844" ...
more infohttp://icg.big.ac.cn/index.php/Cucumis_sativus

कण्टकीफलं - Cucumis sativusकण्टकीफलं - Cucumis sativus

Botanical name - Cucumis sativus. Description - Annual climber; stem scabrous; tendrils simple; leaves alternate, petiolate, ...
more infohttps://indianmedicinalplants.info/herbs/index.php/sanskrit-names-of-medicinal-plants/44-2012-02-24-07-34-36/273-cucumis-sativus
  • The main purpose of the present research was, in a well-defined in vitro model of endothelial cells, to investigate whether a water/ethanol extract of Cucumis sativus L. (CSE) fruit can attenuate the damaging effect of pro-inflammatory lipopolysaccharide (LPS). (biomedcentral.com)
  • Moreover, the in vitro angiogenesis induced by inflammatory LPS was prevented by the presence of Cucunis sativus L. extract, at any doses tested. (biomedcentral.com)
  • Our results have clearly demonstrated that Cucumis sativus L. extract has attenuated lipopolysaccharide-induced inflammatory response in endothelial cells. (biomedcentral.com)
  • Transcriptomic analysis reveals the roles of microtubule-related genes and transcription factors in fruit length regulation in cucumber (Cucumis sativus L. (deepdyve.com)
  • 4) Protective mechanisms of Cucumis sativus in diabetes-related models of oxidative stress and carbonyl stress. (brettelliott.com)
  • Hypocotyl explants have been used to achieve regenerated plants in several species including Capsicum (Gunay and Rao, 1978), Peganum harmala (Ehsanpour and Saadat, 2002), and Cucumis sativus (Andr'yskova et al. (thefreedictionary.com)