A plant species of the family CUCURBITACEAE, order Violales, subclass Dilleniidae known for the melon fruits with reticulated (net) surface including cantaloupes, honeydew, casaba, and Persian melons.
A plant genus of the family CUCURBITACEAE, order Violales, subclass Dilleniidae best known for cucumber (CUCUMIS SATIVUS) and cantaloupe (CUCUMIS MELO). Watermelon is a different genus, CITRULLUS. Bitter melon may refer to MOMORDICA or this genus.
A creeping annual plant species of the CUCURBITACEAE family. It has a rough succulent, trailing stem and hairy leaves with three to five pointed lobes.
The gourd plant family of the order Violales, subclass Dilleniidae, class Magnoliopsida. It is sometimes placed in its own order, Cucurbitales. 'Melon' generally refers to CUCUMIS; CITRULLUS; or MOMORDICA.
Books containing photographs, prints, drawings, portraits, plates, diagrams, facsimiles, maps, tables, or other representations or systematic arrangement of data designed to elucidate or decorate its contents. (From The ALA Glossary of Library and Information Science, 1983, p114)
A plant genus of the family CUCURBITACEAE known for the edible fruit.
A plant genus of the family CUCURBITACEAE, order Violales, subclass Dilleniidae, which includes pumpkin, gourd and squash.
A genus of OOMYCETES in the family Peronosporaceae. Most species are obligatory parasites and many are plant pathogens.
A plant genus of the family APIACEAE. The leaves are the source of cilantro and the seeds are the source of coriander, both of which are used in SPICES.
Time period from 1401 through 1500 of the common era.
A plant genus of the family LYTHRACEAE that is the source of henna and has cytotoxic activity.
An enzyme that converts ascorbic acid to dehydroascorbic acid. EC 1.10.3.3.
The period of history from the year 500 through 1450 of the common era.
A part of the embryo in a seed plant. The number of cotyledons is an important feature in classifying plants. In seeds without an endosperm, they store food which is used in germination. In some plants, they emerge above the soil surface and become the first photosynthetic leaves. (From Concise Dictionary of Biology, 1990)
An ancient civilization, known as early as 2000 B.C. The Persian Empire was founded by Cyrus the Great (550-529 B.C.) and for 200 years, from 550 to 331 B.C., the Persians ruled the ancient world from India to Egypt. The territory west of India was called Persis by the Greeks who later called the entire empire Persia. In 331 B.C. the Persian wars against the Greeks ended disastrously under the counterattacks by Alexander the Great. The name Persia in modern times for the modern country was changed to Iran in 1935. (From Webster's New Geographical Dictionary, 1988, p546 & Asimov, Words on the Map, 1962, p176)
A photo-active pigment localized in prolamellar bodies occurring within the proplastids of dark-grown bean leaves. In the process of photoconversion, the highly fluorescent protochlorophyllide is converted to chlorophyll.
The usually underground portions of a plant that serve as support, store food, and through which water and mineral nutrients enter the plant. (From American Heritage Dictionary, 1982; Concise Dictionary of Biology, 1990)
A genus (formerly part of Rhus genus) of shrubs, vines, or trees that yields a highly allergenic oleoresin which causes a severe contact dermatitis (DERMATITIS, TOXICODENDRON). The most toxic species are Toxicodendron vernix (poison sumac), T. diversilobum (poison oak), and T. radicans (poison ivy). T. vernicifera yields a useful varnish from which certain enzymes (laccases) are obtained.
A FLAVOPROTEIN enzyme for AMMONIA assimilation in BACTERIA, microorganisms and PLANTS. It catalyzes the oxidation of 2 molecules of L-GLUTAMATE to generate L-GLUTAMINE and 2-oxoglutarate in the presence of NAD+.
The fleshy or dry ripened ovary of a plant, enclosing the seed or seeds.
Proteins found in plants (flowers, herbs, shrubs, trees, etc.). The concept does not include proteins found in vegetables for which VEGETABLE PROTEINS is available.
Complex nucleoprotein structures which contain the genomic DNA and are part of the CELL NUCLEUS of PLANTS.
The genetic complement of a plant (PLANTS) as represented in its DNA.
Cultivated plants or agricultural produce such as grain, vegetables, or fruit. (From American Heritage Dictionary, 1982)
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in plants.
The capacity of an organism to defend itself against pathological processes or the agents of those processes. This most often involves innate immunity whereby the organism responds to pathogens in a generic way. The term disease resistance is used most frequently when referring to plants.
Derivatives of ethylene, a simple organic gas of biological origin with many industrial and biological use.
Expanded structures, usually green, of vascular plants, characteristically consisting of a bladelike expansion attached to a stem, and functioning as the principal organ of photosynthesis and transpiration. (American Heritage Dictionary, 2d ed)
Deoxyribonucleic acid that makes up the genetic material of plants.
Diseases of plants.
The functional hereditary units of PLANTS.
The transfer of POLLEN grains (male gametes) to the plant ovule (female gamete).
Deoxyribonucleic acid that makes up the genetic material of CHLOROPLASTS.
Multicellular, eukaryotic life forms of kingdom Plantae (sensu lato), comprising the VIRIDIPLANTAE; RHODOPHYTA; and GLAUCOPHYTA; all of which acquired chloroplasts by direct endosymbiosis of CYANOBACTERIA. They are characterized by a mainly photosynthetic mode of nutrition; essentially unlimited growth at localized regions of cell divisions (MERISTEMS); cellulose within cells providing rigidity; the absence of organs of locomotion; absence of nervous and sensory systems; and an alternation of haploid and diploid generations.
Any of the hormones produced naturally in plants and active in controlling growth and other functions. There are three primary classes: auxins, cytokinins, and gibberellins.
The relationships of groups of organisms as reflected by their genetic makeup.
Very young plant after GERMINATION of SEEDS.
The reproductive organs of plants.
Methods of creating machines and devices.
The smallest continent and an independent country, comprising six states and two territories. Its capital is Canberra.
A plant genus of the family CUCURBITACEAE known for the fruit which is the source of the luffa sponge and the seeds which contain luffin.
Use of written, printed, or graphic materials upon or accompanying a product or its container or wrapper. It includes purpose, effect, description, directions, hazards, warnings, and other relevant information.
A plant genus of the family BRASSICACEAE known for its peppery red root.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.
A class of Echinodermata characterized by long, slender bodies.
Cultivation of PLANTS; (FRUIT; VEGETABLES; MEDICINAL HERBS) on small plots of ground or in containers.
The ability to detect chemicals through gustatory receptors in the mouth, including those on the TONGUE; the PALATE; the PHARYNX; and the EPIGLOTTIS.
A plant genus of the family Caricaceae, order Violales, subclass Dilleniidae, class Magnoliopsida. It is the source of edible fruit and PAPAIN.
A large genus of plant viruses of the family POTYVIRIDAE which infect mainly plants of the Solanaceae. Transmission is primarily by aphids in a non-persistent manner. The type species is potato virus Y.
Physiological functions characteristic of plants.

TGTCACA motif is a novel cis-regulatory enhancer element involved in fruit-specific expression of the cucumisin gene. (1/31)

Cucumisin, a subtilisin-like serine protease, is expressed at high levels in the fruit of melon (Cucumis melo L.) and accumulates in the juice. We investigated roles of the promoter regions and DNA-protein interactions in fruit-specific expression of the cucumisin gene. In transient expression analysis, a chimeric gene construct containing a 1.2-kb cucumisin promoter fused to a beta-glucuronidase (GUS) reporter gene was expressed in fruit tissues at high levels, but the promoter activities in leaves and stems were very low. Deletion analysis indicated that a positive regulatory region is located between nucleotides -234 and -214 relative to the transcriptional initiation site. Gain-of-function experiments revealed that this 20-bp sequence conferred fruit specificity and contained a regulatory enhancer. Gel mobility shift experiments demonstrated the presence of fruit nuclear factors that interact with the cucumisin promoter. A typical G-box (GACACGTGTC) present in the 20-bp sequence did not bind fruit protein, but two possible cis-elements, an I-box-like sequence (AGATATGATAAAA) and an odd base palindromic TGTCACA motif, were identified in the promoter region between positions -254 and -215. The I-box-like sequence bound more tightly to fruit nuclear protein than the TGTCACA motif. The I-box-like sequence functions as a negative regulatory element, and the TGTCACA motif is a novel enhancer element necessary for fruit-specific expression of the cucumisin gene. Specific nucleotides responsible for the binding of fruit nuclear protein in these two elements were also determined.  (+info)

Role of ethylene in the biosynthetic pathway of aliphatic ester aroma volatiles in Charentais Cantaloupe melons. (2/31)

Compared to other melon types, Cantaloupe Charentais melons are highly aromatic with a major contribution to the aroma being made by aliphatic and branched esters. Using a transgenic line in which the synthesis of the plant hormone ethylene has been considerably lowered by antisense ACC oxidase mRNA (AS), the aliphatic ester pathway steps at which ethylene exerts its regulatory role were found. The data show that the production of aliphatic esters such as hexyl and butyl acetate was blocked in AS fruit and could be reversed by ethylene. Using fruit discs incubated in the presence of various precursors, the steps at which ester formation was inhibited in AS fruit was shown to be the reduction of fatty acids and aldehydes, the last step of acetyl transfer to alcohols being unaffected. However, treating AS fruit with the ethylene antagonist 1-methylcyclopropene resulted in about 50% inhibition of acetyl transfer activity, indicating that this portion of activity was ethylene-dependent and this was supported by the low residual ethylene concentration of AS fruit discs (around 2 microl l(-1)). In conclusion, the reduction of fatty acids and aldehydes appears essentially to be ethylene-dependent, whilst the last step of alcohol acetylation has ethylene-dependent and ethylene-independent components, probably corresponding to differentially regulated alcohol acetyltransferases.  (+info)

Detection of ethylene receptor protein Cm-ERS1 during fruit development in melon (Cucumis melo L.). (3/31)

Antibodies against melon ethylene receptor, Cm- ERS1 was prepared. Cm-ERS1 protein formed a disulphide-linked homodimer and it was present in microsomal membranes but not in soluble fractions. Cm-ERS1 protein was present at high levels in melon fruit during early developmental stages. This transition pattern was also observed in another melon cultivar.  (+info)

Molecular and biochemical characteristics of a gene encoding an alcohol acyl-transferase involved in the generation of aroma volatile esters during melon ripening. (4/31)

Two genes (CM-AAT1 and CM-AAT2) with strong sequence homology (87% identity at the protein level) putatively involved in the formation of aroma volatile esters have been isolated from Charentais melon fruit. They belong to a large and highly divergent family of multifunctional plant acyl-transferases and show at most 21% identity to the only other fruit acyl-transferase characterized so far in strawberry. RT-PCR studies indicated that both genes were specifically expressed in fruit at increasing rates in the early and mid phases of ripening. Expression was severely reduced in ethylene-suppressed antisense ACC oxidase (AS) fruit and in wild-type (WT) fruit treated with the ethylene antagonist 1-MCP. Cloning of the two genes in yeast revealed that the CM-AAT1 protein exhibited alcohol acyl-transferase activity while no such activity could be detected for CM-AAT2 despite the strong homology between the two sequences. CM-AAT1 was capable of producing esters from a wide range of combinations of alcohols and acyl-CoAs. The higher the carbon chain of aliphatic alcohols, the higher the activity. Branched alcohols were esterified at differential rates depending on the position of the methyl group and the nature of the acyl donor. Phenyl and benzoyl alcohols were also good substrates, but activity varied with the position and size of the aromatic residue. The cis/trans configuration influenced activity either positively (2-hexenol) or negatively (3-hexenol). Because ripening melons evolve the whole range of esters generated by the recombinant CM-AAT1 protein, we conclude that CM-AAT1 plays a major role in aroma volatiles formation in the melon.  (+info)

Isolation and identification of a phosphate deficiency-induced C-glycosylflavonoid that stimulates arbuscular mycorrhiza formation in melon roots. (5/31)

Melon (Cucumis melo) roots were inoculated with or without the arbuscular mycorrhizal (AM) fungus Glomus caledonium under low phosphate conditions. High-performance liquid chromatography analysis of the secondary metabolites in butanol extracts from roots revealed that the level of one compound in noninoculated roots showed a significant increase from 30 days postinoculation. No accumulation was observed in mycorrhizal roots and high-phosphate-supplemented roots, indicating that the accumulation of the compound was caused by a phosphate deficiency. The compound was isolated by column chromatography and identified by spectroscopic methods to be a C-glycosylflavone, isovitexin 2''-O-beta-glucoside. The effect of the compound on mycorrhizal colonization in melon roots was examined under low (0.05 mM) and high (2 mM) phosphate conditions. The degree of mycorrhizal colonization in control roots grown under high phosphate conditions (8.8%) was much lower than when grown under low phosphate conditions (22%). The treatment of roots with the compound at concentrations of 20 and 50 microM increased root colonization under both low and high phosphate conditions. In particular, the degrees of mycorrhizal colonization in treated roots grown under high phosphate conditions (25 and 22% at 20 and 50 microM, respectively) were comparable to that in untreated control roots grown under low phosphate conditions (22%). These findings suggest that the phosphate deficiency-induced C-glycosylflavonoid is involved in the regulation of AM fungal colonization in melon roots.  (+info)

Plant colonization by the vascular wilt fungus Fusarium oxysporum requires FOW1, a gene encoding a mitochondrial protein. (6/31)

The soil-borne fungus Fusarium oxysporum causes vascular wilts of a wide variety of plant species by directly penetrating roots and colonizing the vascular tissue. The pathogenicity mutant B60 of the melon wilt pathogen F. oxysporum f. sp. melonis was isolated previously by restriction enzyme-mediated DNA integration mutagenesis. Molecular analysis of B60 identified the affected gene, designated FOW1, which encodes a protein with strong similarity to mitochondrial carrier proteins of yeast. Although the FOW1 insertional mutant and gene-targeted mutants showed normal growth and conidiation in culture, they showed markedly reduced virulence as a result of a defect in the ability to colonize the plant tissue. Mitochondrial import of Fow1 was verified using strains expressing the Fow1-green fluorescent protein fusion proteins. The FOW1-targeted mutants of the tomato wilt pathogen F. oxysporum f. sp. lycopersici also showed reduced virulence. These data strongly suggest that FOW1 encodes a mitochondrial carrier protein that is required specifically for colonization in the plant tissue by F. oxysporum.  (+info)

Diversity of the superfamily of phloem lectins (phloem protein 2) in angiosperms. (7/31)

Phloem protein 2 (PP2) is one of the most abundant and enigmatic proteins in the phloem sap. Although thought to be associated with structural P-protein, PP2 is translocated in the assimilate stream where its lectin activity or RNA-binding properties can exert effects over long distances. Analyzing the diversity of these proteins in vascular plants led to the identification of PP2-like genes in species from 17 angiosperm and gymnosperm genera. This wide distribution of PP2 genes in the plant kingdom indicates that they are ancient and common in vascular plants. Their presence in cereals and gymnosperms, both of which lack structural P-protein, also supports a wider role for these proteins. Within this superfamily, PP2 proteins have considerable size polymorphism. This is attributable to variability in the length of the amino terminus that extends from a highly conserved domain. The conserved PP2 domain was identified in the proteins encoded by six genes from several cucurbits, celery (Apium graveolens), and Arabidopsis that are specifically expressed in the sieve element-companion cell complex. The acquisition of additional modular domains in the amino-terminal extensions of other PP2-like proteins could reflect divergence from its phloem function.  (+info)

Ozone increases root respiration but decreases leaf CO2 assimilation in cotton and melon. (8/31)

It is well established that exposure of plant foliage to tropospheric ozone (O3) inhibits photosynthetic gas exchange in leaves and the translocation of current photosynthate to sink tissues. It is less clear what impact O3-reduced source strength has on the physiological responses of sink tissue such as fine roots. The responses were investigated of carbon acquisition in leaves and carbon utilization in the respiration of fine roots, following chronic (weeks) and acute (hours) exposures to O3 in open top chambers. Previous reports indicate increased, decreased, and unchanged rates of root respiration following exposure to O3. A decline in source activity is confirmed, but an increase in sink respiration is reported in fine roots of Pima cotton (cv. S-6) and muskmelon (cv. Ambrosia hybrid). Leaf source strength and root sink activity changed in opposing directions, thus there was no positive correlation that might indicate direct substrate control of root function. Additional linkages between shoot and root following exposure to O3 may be involved.  (+info)

Proteinase inhibitors are ubiquitous proteins that block the active center or interact allosterically with proteinases and are involved in plant physiological processes and defense responses to biotic and abiotic stresses. The CmSPI gene identified from Cucumis metuliferus encodes a serine type PI (8 kDa) that belongs to potato I type family. To evaluate the effect of silencing CmSPI gene on Papaya ringspot virus resistance, RNA interference (RNAi) with an inter-space hairpin RNA (ihpRNA) construct was introduced into a PRSV-resistant C. metuliferus line. CmSPI was down-regulated in CmSPI RNAi transgenic lines in which synchronously PRSV symptoms were evident at 21 day post inoculation. Alternatively, heterogeneous expression of CmSPI in Nicotiana benthamiana was also conducted and showed that CmSPI can provide resistance to Potato virus Y, another member of Potyvirus, in transgenic N. benthamiana lines. This study demonstrated that CmSPI plays an important role in resistant function against potyviruses
Corky root rot (CRR) is an escalating plant disease of tomato (Solanum esculentum), caused by a soil-borne fungus, Pyrenochaeta lycopersici. During the last two decades there have almost been no progress in the understanding of the molecular mechanisms promoting infection and plant susceptibility. As there are no CRR-resistant lines of cultivated tomato on the market and no other known means for plant protection, a deeper molecular knowledge about the infection process is urgently needed. We have therefore outlined an efficient strategy to search for corky root rot-resistance genes in wild tomato. In addition, we are investigating the genetic determinants for infection and virulence of the fungal pathogen, P. lycopersici. In this review we summarize the quite limited molecular knowledge about the pathogen and the disease, and discuss the possibilities to overcome previous technical obstacles in this new era of molecular biology.. ...
Interpretive Summary: The whitefly-transmitted viruses Squash vein yellowing virus (SqVYV), Cucurbit leaf crumple virus (CuLCrV) and Cucurbit yellow stunitng disorder (CYSDV), and to a lesser extent, the aphid transmitted virus Papay ringspot virus type W (PRSV-W) have had serious impact on watermelon production in west-central and southwest Florida in recent years. To determine virus distribution within plants, we collected 80 entire plants randomly, 20 each on four different dates, from a commercial watermelon field showing symptoms of SqVYV, CuLCrV and PRSV-W, and possibly CYSDV. This was followed by a smaller sampling of five plants in a different commercial planting. Results showed that the distribution of SqVYV in vines decreased proportionately with distance from the crown compared to CuLCrV which tended to be more evenly distributed throughout the plant. The distribution of PRSV-W resembled that of SqVYV, but with a slightly greater probability of detection at the tip of the vine. ...
Interpretive Summary: Technical Abstract: The whitefly-transmitted viruses Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV) have had serious impact on watermelon production in west-central and southwest Florida in recent years. We collected plants randomly from a commercial watermelon field in southwest Florida showing symptoms of SqVYV and CuLCrV and cut cross sections from each vine on every plant from the crown to the vine tip. The cross sections were blotted onto nitrocellulose membranes and nucleic acid hybridization was used to test for the presence of SqVYV and CuLCrV. Results showed that SqVYV and CuLCrV were present in the field in approximately 38% and 45% of the plants collected in the field, respectively. In plants diagnosed with SqVYV, the presence of SqVYV in vine tissue decreased proportionately with increasing distance from the crown. In contrast, the growing tip was the single best tissue for detection of CuLCrV in plants diagnosed with CuLCrV. The ...
Cucurbit leaf crumple virus, which decimated snap beans and squash last fall, has been verified from squash in South Georgia (the week of Aug. 1).
DESCRIPTION (provided by applicant): Viral infections cause widespread death and disease in the human population. The long-range goal of our program is to define the cellular and molecular mechanisms involved in the generation of an efficient protective antiviral immune response. An antiviral immune response is comprised of innate and adaptive components. In the absence of an effective innate antiviral response the efficacy of the subsequent adaptive response is blunted. A major component of the innate inflammatory immune response is the release of bioactive arachidonic acids metabolites mediators, including leukotrienes. Leukotrienes can mediate both the local inflammatory response that can slow virus replication, and the migration of antigen presenting cells that are vital for the initiation of a productive adaptive antiviral response. Knowledge of the processes involved in successful generation of a protective antiviral immune response is incomplete with an understanding of the role of ...
Conquistadors brought new human diseases like smallpox and cholera when they invaded North and South America. They also brought infections to local agriculture. Bacterial wilt is a disease that can infect Curcurbita plants, like pumpkins, squash, and gourds. It also infects plants in the genus Cucumis, things like cucumber and muskmelon. Caused by the bacteria Erwinia tracheiphila, infected plants wilt, turn yellow and brown around the edges, and die off. The disease progresses down the vine until an entire crop could be lost. It is only transmitted from bites of the leaf beetle (the bacteria survives winter by living in the beetles guts). Economic losses from bacterial wilt numbers in the millions of dollars.. E. tracheiphila is an unusual bacteria: its range is today limited to the Midwestern and eastern portions of North America, even though susceptible plants are distributed all over the world. When they analyzed the genetic diversity of the Erwinia bacteria, in search of an explanation for ...
Grafting is widely used in horticulture for a variety of reasons. In fruit trees like apple, dwarfing rootstock are used to control the size and vigor of the tree. With field grown vegetables, grafting is used to increase resistance to soil-borne diseases. Increasingly greenhouse tomato growers are using grafting to both decrease susceptibility to root diseases and to increase fruit production through increased plant vigor.. Grafting involves splicing the fruit-producing shoot (called the scion) of a desirable cultivar onto the disease resistant rootstock from of another cultivar. For instance, if you generally grow the cultivar Trust for fruit production, you would graft the top part of a Trust seedling onto the root-portion of a more vigorous or more disease resistant cultivar. The two cultivars most widely used for rootstock in the greenhouse are Maxifort and Beaufort. Both cultivars offer enhanced disease resistance to Pyrenochaeta lycopersici (Corky Root), most common species of ...
Innospec is a global specialty chemicals company focused on bringing innovative new technologies to market combined with a fast and responsive service.
Stephen M. J. Pollo, Abigail A. Adebusuy, Timothy J. Straub, Julia M. Foght, Olga Zhaxybayeva, Camilla L. Nesbo (2017) Genomic insights and temperature-dependent transcriptional responses of Kosmotoga olearia, a deep-biosphere bacterium that can grow from 20C to 79C, Extremophiles, in press; preprint is available at https://doi.org/10.1101/060053. Straub TJ and Zhaxybayeva O (2017) A null model for microbial diversification, Proc Natl Acad Sci U S A. 2017, 114: E5414-E5423. [PubMed]. Lori R. Shapiro, Erin D. Scully, Timothy J. Straub, Jihye Park, Andrew G. Stephenson, Gwyn Beattie, Mark Gleason, Roberto Kolter, Miguel C. Coelho, Consuelo M. DeMoraes, Mark C. Mescher, and Olga Zhaxybayeva (2016) Horizontal Gene Acquisitions, Mobile Element Proliferation, and Genome Decay in the Host-Restricted Plant Pathogen Erwinia tracheiphila, Genome Biol Evol., 8:649-664.. Pollo SM, Zhaxybayeva O, Nesbo CL (2015) Insights into thermoadaptation and the evolution of mesophily from the bacterial phylum ...
When a motor vehicle speeds up and slows down, you may feel your body pull back and jolt forward. In physics, this is known as an impulse, or a change in your momentum when acted upon by a force (i.e. accelerating or braking) over an interval of time. This is why when you slam your foot on the brakes, you feel a harder jolt as opposed to when you gradually decrease your speed.. A large impulse acting on your body can cause extreme bodily harm and even death. Brakes, airbags, and vehicular crumple zones all work to slow down the force of impact on your body, thereby increasing your safety in an automobile. However, the side doors of many cars are not equipped with the same level of protection offered by the front and rear end crumple zones. This is why side-impact accidents are so fatal: car doors lack the same extent and coverage of crumple protection needed to slow down the force of a car t-boning your passenger door. As with most accidents, the severity and extent of damage to both your car ...
Interferons (IFNs) are involved in a multitude of immune interactions during viral infections and play a major role in both the induction and regulation of innate and adaptive antiviral mechanisms. During infection, host-virus interactions signal downstream molecules such as transcription factors such as IFN regulatory factor-3 (IRF3) which can act to stimulate transcription of IFN-a/b genes. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. IRF7 play a major role in the innate immune pathway, interacting with the Toll-like receptor (TLR) adaptor proteins MyD88 and Tirp/TRAM and functioning as an intermediate TLR4 and TLR9 signaling. There are at least four differentially spliced isoforms of IRF7, although their function has not been clearly established. ...
Chapter 6 Study Guide Bones and Skeletal Tissues BIOL 2111 ... Chapter 6 Bones and Skeletal Tissues Study Guide Page 4 of 5 BIOL 2111 Anatomy and Physiology I Tuesday October 6, 2009 C ... If bones do not break the skin .... ...
But lets say that Viewer A purchases a ticket, its a busy day and none of the employees can really remember her face over anyone elses, she gives the ticket to the ticket taker and gets back the stub without a word, she crumples up the stub and tosses it in a trash can. Later, at some point during the movie she leaves to get popcorn, and for whatever reason the usher mistakenly believes she snuck into the movie, what should be done at this point ...
chains in the Genus database with same CATH superfamily 1Z21 A; #chains in the Genus database with same CATH topology 3O6B B; 4N9H A; 1FX7 A; 2E36 A; 3MKL A; 1MDM A; 1R00 A; 4RA2 A; 1XC5 A; 2ZCW A; 1TQM A; 4CUG A; 1J9I A; 4BDY A; 4YFX F; 1VFC A; 2QGU A; 1BI1 A; 3ZQQ A; 2IS4 A; 3ROU A; 1QHH D; 1PJR A; 3PSI A; 1Z9C A; 1TT0 A; 1W5S A; 3CUO A; 2ZO4 A; 4IHX A; 4LG0 A; 4XID A; 5L3C A; 4BEH A; 5HDK A; 4KIC A; 1RIO H; 2BVM A; 3H0D A; 4LLN A; 3F6O A; 4CO8 A; 5LRR A; 2RC4 A; 1YX5 A; 3ZGK A; 3DPU A; 1ODD A; 4Q48 A; 2BHY A; 2DMN A; 3CCS I; 5JVG F; 1WI3 A; 3S17 J; 4B3A A; 2PJR B; 1QVT A; 2LDU A; 5D6F A; 4E7I A; 1YFH A; 4BNC A; 2O7O A; 3K1N A; 1IGN A; 5F08 A; 3F6V A; 3ABU A; 1WJB A; 2NS7 A; 4LIU A; 1MBJ A; 5DD4 A; 2GXA A; 1I1G A; 3FBN B; 2W48 A; 4HBL A; 4EEF G; 3GTJ J; 5E17 F; 1LFP A; 1WWX A; 2XAH A; 2QSG X; 4ZYD A; 3F3X A; 4HOB A; 4CCJ A; 2L9R A; 3OYF A; 5FLV A; 1RC9 A; 2Y0S N; 3HPG A; 1IV8 A; 3HTS B; 3FM5 A; 4HX7 A; 4MFE A; 2R5Y B; 2HU9 A; 1G6N A; 3QQA A; 4IL6 C; 2L4A A; 3DWL E; 1K6Y A; 1YQA A; 2FML A; 2NVY ...
chains in the Genus database with same CATH superfamily 1XJA A; 2ARA A; 2ARC A; 2AAC A; #chains in the Genus database with same CATH topology 3HVD A; 2WSV A; 1HB4 A; 4KWJ A; 5CNA A; 2RDS A; 3IKW A; 3ZYH A; 4CDW C; 3GDB A; 3HAG A; 5EP9 A; 5F6K A; 4MUV A; 3IPV A; 2AZ5 A; 3AYD A; 4JZR A; 4Q4W 1; 2ZAB A; 5GLU A; 3ZIX A; 3N7M A; 1XOY A; 4HOO A; 3DPR C; 1GAN A; 1C1L A; 1QH7 A; 1WW7 A; 3MEP A; 3TN9 1; 1WCS A; 4CCO A; 1G9B A; 1K12 A; 4K9S A; 1H9W A; 5JI9 A; 2MEV 1; 1DBN A; 2B45 X; 1NKG A; 2RR1 2; 2UU8 A; 4JX0 A; 3KVA A; 1CAX B; 1W99 A; 1SQ4 A; 4GB3 2; 3VDD B; 1BJQ A; 3LOB A; 5LBC A; 2PYT A; 1TME 1; 2I2S A; 5EYX A; 2V73 A; 2PHL A; 4DZG A; 2DFB A; 2LRP A; 2YU2 A; 1UXX X; 4B1L A; 1EUT A; 1POQ A; 4W6Y A; 3APB A; 2KA3 A; 4YW7 A; 4XBL A; 4IW3 A; 3WW3 A; 5FRA A; 3AZX A; 5HCB A; 4HK8 A; 2NN8 A; 3MBW A; 5KBF A; 1XJA A; 1GZW A; 4FPY A; 4DY3 A; 4JHT A; 1ODM A; 2UY8 A; 2JX9 A; 5FZB A; 5FV3 A; 4YYO A; 4LUK A; 3DXT A; 3NQH A; 1C5H A; 3T2O A; 1YQ5 A; 2XL9 A; 5FYI A; 1VRH 1; 2RS3 3; 4FOW A; 1LCL A; 5BNN B; 1LKN A; 5T5J ...
ach ago agy alb alf alk aln alo alp aly ami amy arc ark arn aro aru ary ash ask asp ass ati auh auk aus bab bac bag bah bal bam ban bap bar bas bat baw bay ben ber bes bey bib bin bis bob bon boo bop bos bow boy bra bub bun bus buy cab cag cal cam can cap car cat caw cay cep che chi cho cly cob con coo cop cos cow coy cro cry cub cup cyp ers ess fag fam far fat fei fen feu few fey fib fin fip fir flu fob fon foo fop fou fow foy fra fro fry fub fun gab gan gap gas gau gaw gay gen geo ges gey hag ham hat hau hei hen hep her hew hey hic hin hip his hob hoi hop how hoy hub huh huk hun hup hyp iba ibo ice ich icy ife ihi ila ind ink inn ino ion ira ire irk ism iso ita ivy iyo kat ker khu kin kip kob koi kon kop kos kou kra kru kui lab lac lai lak lan lao lap las law lay lif lin lip lis liv luo mob moi mon moo mop mou mow moy nab nag nak nam nan nap nar nat naw nay neb nef nei neo nep new nib nip nob non now noy nth nub nun oam oar oat obe obi och ock ods oer oes off ofo oho oii oki ona one ons opt ...
A study was undertaken to understand the genetics of yield formation traits in muskmelon (Cucumis melo L.) germplasm collected from Andhra Pradesh, India that has potential for yield improvement. Thirty five genotypes were evaluated in a randomized block design with three replications during late rabi season at the Vegetable Research Station, Rajendranagar, Hyderabad, Andhra Pradesh, India. Analysis of variance revealed significant differences for almost all the characters under study except number of fruits per vine indicating presence of sufficient amount of variability in the germplasm under study offering ample scope for improving the population for these characters. The ranges of mean values revealed sufficient variation for all the traits under study. Average fruit weight, fruit cavity length and rind thickness had high magnitude of genotypic coefficient of variation. The magnitude of phenotypic coefficients of variation was higher than the corresponding genotypic coefficients of variation for all
The consumption of netted muskmelons (Cucumis melo L. Reticulatus group) has raised health concerns due to pathogenic bacteria attaching to sites on the netted rind inaccessible to sanitation. The purpose of this study was to compare 1) the enzymic and nonenzymic antioxidant capacity between representative cultivars of netted muskmelon and both green- and orange-fleshed honey dew muskmelons during storage for 17 days and 2) levels of non-nutrient phytochemicals between these genotypes in consideration of ultimately substituting netted orange-fleshed with non-netted orange-fleshed muskmelon. Netted muskmelon (`Cruiser), green-fleshed (`Honey Brew), and orange-fleshed (`Orange Dew) muskmelons were harvested in Texas at the beginning (21 May) and at the end (11 June) of the production season in 2004. Fruit were analyzed immediately (day 0) or stored simulating retail conditions for 7 or 14 days at 7 °C and 95% ± 2% relative humidity plus 3 days at 21 °C. Both `Orange Dew and `Honey Brew ...
The hemibiotrophic pathogen Colletotrichum orbiculare develops biotrophic hyphae inside cucumber (Cucumis sativus) cells via appressorial penetration; later, the pathogen switches to necrotrophy. C. orbiculare also expresses specific effectors at different stages. Here, we found that virulence-related effectors of C. orbiculare accumulate in a pathogen-host biotrophic interface. Fluorescence-tagged effectors accumulated in a ring-like region around the neck of the biotrophic primary hyphae. Fluorescence imaging of cellular components and transmission electron microscopy showed that the ring-like signals of the effectors localized at the pathogen-plant interface. Effector accumulation at the interface required induction of its expression during the early biotrophic phase, suggesting that transcriptional regulation may link to effector localization. We also investigated the route of effector secretion to the interface. An exocytosis-related component, the Rab GTPase SEC4, localized to the necks of ...
Yes, muskmelons are a great addition to your diet for young-looking, refreshing skin. These melons are also used as face masks and face packs to obtain clear and glowing skin. High amount of antioxidants can help in purification of skin. A study published in the US National Library of Medicine in 2016 emphasized the benefits of muskmelon for treating abnormal dental pain. Apply this paste on your face and leave it on for 10-15 minutes. [2], Muskmelon is rich in vitamin A & C which help in skin regeneration. 20. Applying the paste to your skin can help reduce any signs of dryness, blemishes, acne, etc. Muskmelon is a sweet and nutritious fruit with a variety of culinary uses and health benefits. Bananas are rich in potassium, natural oils, carbohydrates and vitamins, which help soften the hair. Muskmelon is also packed with skin-friendly collagen, which is a protein that helps in keeping the skin tissues soft and tight while preventing it from withering. 7. 18. Muskmelon Health Benefits. This all ...
Cucumis melo L., belonging to the Cucurbitaceae family, is cultivated on more than 23,000 ha in Italy. Cantaloupe (C. melo L. var. cantalupensis Naudin) is the most popular variety. In summer 2010, a previously unknown rot was observed on fruits produced in Italy and marketed in the Piedmont Region of northern Italy. Early symptoms on fruit consisted of irregular, brown, soft, sunken lesions up to 10 cm in diameter. No surface mold was visible and pycnidia were not present. Internally, the decay is adjacent to the sunken area of the fruits surface and is soft, water soaked, spongy, with a nearly circular margin, and easily separated from healthy tissues. Fragments (approximately 3 mm3) were taken from the margin of the internal diseased tissues, cultured on potato dextrose agar (PDA), and incubated at 24 ± 1°C, (16 h of light and 8 h of darkness). Fungal colonies initially appeared coarse, at first whitish then buff brown, and produced dark pycnidia 0.5 mm in diameter, which exuded numerous ...
The Decomposition of Aliphatic Esters by Aerobic Microorganisms W. D. LANGLEY, Engineering Research Associate W. B. DAVIS, Associate Professor and Head P. A. RICHARDS, Captain, USAF Environmental Engineering Division Civil Engineering Department Texas A&M University College Station, Texas INTRODUCTION Based on its ability to resolve and quantitatively analyze the various components of a multi-component system, gas chromatography is a valuable analytical technique for industrial wastewater characterization and treatment studies. Used in conjunction with the hydrogen flame ionization detector and with proper selection of operating variables the technique is capable of precise analysis of volatile organics in water solution at the part per million level without prior sample preparation. The technique and some of its applications to industrial wastes have been thoroughly described by Baker (1, 2). It has been shown to be of practical value in monitoring process waste streams and treatment plant ...
Colletotrichum orbiculare is a plant pathogen of melons and cucumber. Sherriff, Christine; Whelan, Mitzi J.; Arnold, Gillian M.; Lafay, Jean-Francois; Brygoo, Yves; Bailey, John A. (1994). Ribosomal DNA Sequence Analysis Reveals New Species Groupings in the Genus Colletotrichum. Experimental Mycology. 18 (2): 121-138. doi:10.1006/emyc.1994.1014. ISSN 0147-5975. Index Fungorum USDA ARS Fungal ...
Four rotation sequences consisting of ungrafted tomato cv. Durinta - melon cv. Paloma or tomato grafted onto the resistant rootstock Aligator - melon grafted onto the resistant Cucumis metuliferus accession BGV11135, and in reverse order, were conducted from 2015 to 2017 in a plastic greenhouse infested or not with Meloidogyne incognita to determine the plant tolerance (T), the minimum relative crop yield (m) and fruit quality. The relationship between M. incognita densities in soil at transplanting (Pi) of each crop and the crop yield was assessed and T and m were estimated by the Seinhorsts damage model. In addition, the volume and the number of nuclei of single giant cells and the number of giant cells, its volume and the number of nuclei per feeding site in susceptible tomato and melon were compared to those in the resistant tomato and C. metuliferus 15 days after nematode inoculation in pot test. The relationship between the Pi and the relative crop yield fitted the Seinhorsts damage model in
1. Cheng ZJ, Wang HS, Zhang ZB. et al. Genetic diversity of melon (Cucumis melo L.) germplasm based on AFLPs. Acta Bot Boreali-Occidentalia Sinica. 2007;27:244-248 2. Keiko O, Akio U, Tomoko T. et al. Enrichment of sugar content in melon fruits by hydrogen peroxide treatment. J Plant Physiol. 2009;166:569-578 3. Song WY, Zhang ZB, Shao HB. et al. Relationship between calcium decoding elements and plant abiotic-stress resistance. Int J Biol Sci. 2008;4:116-125 4. Liu YF, Li TL, Qi HY. et al. Effects of grafting on carbohydrate accumulation and sugar-metabolic enzyme activities in muskmelon. Afr J Biotechnol. 2010;9:25-35 5. Lee JM, Oda M. Grafting of herbaceous vegetable and ornamental crops. Hort Rev. 2003;28:61-124 6. Pavlou G.C, Vakalonnakis DJ, Ligoxigakis EK. Control of root and stem rot of cucumber, caused by F. oxysporum f. sp radicis cucumerinum, by grafting onto resistant rootstocks. Plant Dis. 2002;86:379-382 7. Shao HB, Chu LY, Lu ZH. et al. Primary antioxidant free radical scavenging ...
A changing global climate may impact the respiration of fine roots. While many models adjust fine root respiration as temperature increases, the influence of soil nutrient availability and the possibility that root respiration may be adapted to local climate are often not addressed. Rates of fine root respiration were measured in four sugar maple (Acer saccharum Marsh.) forests located along a latitudinal gradient in Michigan. Root respiration was measured as O2 consumption at temperatures ranging from 6 to 24 C on excised fine root samples in early September, October, and November of 1994. Root respiration increased exponentially with temperature with an average Q10 of 2.7; there were no differences in Q10 among sites. However, there were differences among sites in mean respiration rate at a given temperature. This site effect did not indicate ecotypic adaptation to local climate, but rather reflected fine root N concentration. Respiration at a given temperature was consistently higher in roots ...
Muskmelon/ Cantaloupe/Kharbooja Benefits For Health, Skin,Hair Muskmelon or cantaloupe is one of the seasonal fruits which are easily available to all during summers. The arrival of summers is confirmed with the arrival of these tasty and healthy Kharboojas
The present invention refers to a medicament which activates gastrointestinal movement. The medicament consists essentially of Cucurbitacin D and one or more substances form the group including Cucurbitacin A, Cucurbitacin B, Cucurbitacin E, Isocucurbitacin B and Isocucurbitacin D. The medicament is made from an extract obtained from Muskmelon Base, the fruit stem of Cucumis melo L. The medicament can promote enterokinesia in both normal animals and in animal models where gastrointestinal movement is inhibited. It has also been demonstrated to activate the movements of the stomach, small and large intestines. The extract may be used alone or in combination with the other botanical ingredients or chemical substances to form the pharmaceutical preparation.
We describe a cell-based assay for antimitotic compounds that is suitable for drug discovery and for quantitative determination of antimitotic activity, In the assay, cells arrested in mitosis as a result of exposure to antimitotic agents in pure form or in crude natural extracts are detected by ELISA using the monoclonal antibody TG-3, The assay was used to screen ,24,000 extracts of marine microorganisms and invertebrates and terrestrial plants and to guide the purification of active compounds from 5 of 119 positive extracts. A new rhizoxin analogue was found in a Pseudomonas species, six new eleutherobin analogues were identified from the octocoral Erythropodium caribaeorum, and two paclitaxel analogues were found in the stem bark of the tree Ilex macrophylla. The assay was also used for quantitative comparison of the antimitotic activity of different analogues. It revealed the importance of the C-11 to C-13 segment of the diterpene core of eleutherobin for its antimitotic activity. The ...
Bacterial wilt of cucurbits is cause by the bacteria Erwinia tracheiphila, it affects cucumber, squash, muskmelon, pumpkin, gourds;[3] certain varieties of cucumber and squash have different degrees of resistance. Once a plant is infected, the bacteria spread through the xylem vessels from the area of infection to the main stem, and the entire plant wilts and dies. Initial symptoms may include the wilting of single leaves and smaller stems. Infected plants may produce a creamy white bacterial ooze when cut. The bacteria survive winter in the digestive tract of striped cucumber beetles and spotted cucumber beetles. In the spring when the beetles are feeding on susceptible plants, the bacteria, which are contained in the fecal matter of the beetles enters the plant through wounds in the epidermis. The bacteria need a film of water to facilitate infection. The bacteria can also be transmitted from one plant to another when beetles feed on an infected plant and the bacteria becomes attached to the ...
18. Invitro Anticancer and Insecticidal activity of Crossandra infundibuliformis.. 19.Isolation and Characterisation of Natural Mucillage from Cucumis melo L.. 20. Antidiabetic and Anthelmintic Activity Of Crossandra Infundibuliformis. ...
The health benefits of muskmelon or cantaloupe include supply of essential vitamins and minerals, good source of antioxidants, offers eye protection, offer
This thesis comprises two parts. Part-I:Synthesis of Azaterpenoids and their biological evaluation. Part-II:Studies on the chemical constituents of Cucumis prophetarum. The part A describes the synthesis of Betulin N-oxide from betulin (25-29), ursolic-N-oxide from ursolic acid (30-34), and an azasteroid from a very common sterol of plant, namely, B-sistosterol (35-39). The compounds which were synthesized are as follows:. ...
Telford, I.R.H., Schaefer, H., Greuter, W. & Renner, S.S. (2011) A new Australian species of Luffa (Cucurbitaceae) and typification of two Australian Cucumis names, all based on specimens collected by Ferdinand Mueller in 1856, PhytoKeys, 2011(5): 21-29. doi: 10.3897/phytokeys.5.1395. Available on line [1]. Accessed 2014 Aug 26. Refers to C. picrocarpus ...
Common Name : Bristly Bryony, Mukia maderaspatana, Madras pea pumpkin Botanical name : Cucumis maderaspatanus Family : Cucurbitaceae Tamil : muchumuchukkai, Musumuskkai, Nagilangiai, paripuskarai Type : Annual climbing creeper ...
TY - JOUR. T1 - Systematic reappraisal of species in Phoma section Paraphoma, Pyrenochaeta and Pleurophoma. AU - de Gruyter, J.. AU - Woudenberg, J.H.C.. AU - Aveskamp, M.M.. AU - Verkley, G.J.M.. AU - Groenewald, J.Z.. AU - Crous, P.W.. N1 - Reporting year: 2010. PY - 2010. Y1 - 2010. N2 - Sequence data from the 18S nrDNA (SSU) and 28S nrDNA (LSU) regions of isolates of Phoma section. Paraphoma were compared with those of representative isolates of the morphologically similar an am orph genera Pleurophoma and Pyrenochaeta and of the type species of Phoma sections Phonza, Pilosa and Plenodomus. Phoma section. Paraphoma was found to be highly polyphyletic within the Pleosporales and only distantly related to Phoma section Phoma. The genus Paraphonza, which is based on Paraphoma radicina, is reintroduced in the Phaeosphaeriaceae with two additional taxa. The new genera Setophoma and Neosetophoma, type species Setophoma terrestris comb. nov. and Neosetophoma samarorum comb. nov., are introduced and ...
Researchers at the RIKEN-Max Planck Joint Research Center in Japan have demonstrated that hallmark symptoms of Alzheimers disease can be reduced when sugars are prevented from binding to one of the key enzymes implicated in the disease. The new findings, reported in EMBO Molecular Medicine, show that abnormal attachment of a particular sugar to the enzyme BACE1 is a critical factor leading to the formation of Aβ plaques in the brain, and that plaques were reduced and cognitive performance improved when this action was prevented in mice through loss of the enzyme GnT-III.
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2; Derived by automated computational analysis using gene prediction method- Gnomon. Supporting evidence includes similarity to- 1 mRNA, 7 ESTs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns (691 aa ...
associations are meant to be specific and meaningful, i.e. proteins jointly contribute to a shared function; this does not necessarily mean they are physically binding each other. ...
the regioselective synthesis of aliphatic esters is described using benzoyl ... with an alcohol yields the ester. A one-pot procedure ... Portal Investigation of the Yamaguchi Esterification Mechanism. Synthesis of ... ...
EP is a simple aliphatic ester derived from pyruvic acid that has been shown to be an effective anti-inflammatory agent in a variety of in vivo and in vitro model systems (Fink,2003). It is well known that pyruvate is an ROS scavenger (Adickes and Andresen, 1943; Bunton, 1949; Melzer and Schmidt, 1988; Dobsak et al., 1999), and data are available suggesting that EP is as well (Varma et al., 1998; Tawadrous et al., 2002). NAC, a derivative of the amino acid l-cysteine, is both an ROS scavenger itself (Aruoma et al., 1989) and a precursor for the synthesis of the important endogenous antioxidant, GSH (Fernandez et al., 1999). Since redox-sensitive signaling pathways are thought to regulate the expression of various pro- and anti-inflammatory mediators involved in the innate immune response (Janssen-Heininger et al., 2000; Garg and Aggarwal, 2002; Haddad, 2002a), we sought to compare the pharmacological effects of similar concentrations of EP and the widely employed reagent, NAC.. Our studies ...
Lately Ive been thinking about this figure with respect to nanoparticle (also virus, exosome) capture in a centrifuge. In this application we are interested in generating a clogging event but the clogging mechanism should be pore blocking (i.e. filling the pore as a plug). Interestingly, we didnt see this mechanism in the JMS paper but it seems it would require a careful tuning of particle size and concentration. The particles should be around 40 - 50 nm to be captured inside tapered pores and the concentration should be tuned to the match the number of pores. With roughly 10 x 10^10 pores/cm^2 and a 0.036 cm^2 for our newest (4 slot SepCon) membranes, we can theoretically capture 3.6 billion particles. Lets say we start with a 200 ul sample and spin 100 ul through the membrane, the sample could theoretically be as concentration as 3.6 x 10^10 /ml NPs to reach saturation. Dropping to 10% of this number seems safer, so 3.6 x 10^9 /ml. Interpolating from the figure above to an imaginary 40 nm ...
A weed of disturbed areas, stems and leaves bear rough hairs, tendrils present. Leaves alternate, deeply 5-lobed may be up to 9.5 cm long and 9 cm broad. Flowers have a yellow 5-lobed corolla. Fruit a pepo, ellipsoidal to 6 cm long, 3 cm diameter with short prickles on surface giving a rough feel, yellowish when ripe.. ...
Lysosomes are membrane-bound organelles found in most animal cells. They are responsible for treating cellular waste. Genetic mutations in lysosomal enzymes lead to lysosome malfunction and waste accumulation ...
In order to generate the aldehyde needed in the reaction above, three additional enzymes are needed. The fatty acids needed for the reaction are pulled out from the fatty acid biosynthesis pathway by the enzyme acyl-transferase. Acyl-trasferase reacts with acyl-ACP (from Fatty Acid pathway) to release R-COOH, a free fatty acid. R-COOH is reduced by a two-enzyme system to an adehyde ...
In order to generate the aldehyde needed in the reaction above, three additional enzymes are needed. The fatty acids needed for the reaction are pulled out from the fatty acid biosynthesis pathway by the enzyme acyl-transferase. Acyl-trasferase reacts with acyl-ACP (from Fatty Acid pathway) to release R-COOH, a free fatty acid. R-COOH is reduced by a two-enzyme system to an adehyde ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
So since were sharing (over sharing) poo humor.... (cross posted from Fold or Crumple) A couple of years ago at Halloween I went to work and forgot to dress up for the work costume contest. I walked
Punk not dead scalp specialist nyc Swann married his wife, Sarah, a clinical research associate, in January 2010. They live in West Bridgford, Nottinghamshire, with their two child-ren, Wilfred, who was born in February 2011, and Charlotte, born last October. Spending months away on tour can be tough on family life. It is awful when you have little kids who dont understand why you are going away, and you see their little faces crumple up when you disappear, he says. You get back from a tour and everything is great and then you go to the shops to buy something and your kids go into meltdown because they think youve left them. So apart from the severe abandonment issues that your kids get, its great. When you find out your kids have just said their first words, or taken their first steps, it hurts. But if youre sitting in a five-star hotel in Sydney it doesnt hurt as much as if youre sitting in a tent in Basra, so Im not complaining.. ...
Whether you are using paper, leather or cloth for your book cover, one of the easiest and quickest ways to give the appearance of age is to create wrinkles. Crumple up the material and use some pressure to make sure the wrinkles stay.
Trek and Bontrager have developed a new cycling helmet technology that looks to dramatically improve performance and safety. Dubbed WaveCel, the new tech uses three processes - flex, crumple, and glide - to disperse the energy absorbed on contact in an accident, providing up to 48 times more protection against head injury.
I picked my Mom up two days ago for a house visit. I had not seen her in two weeks as I had been very busy with my kids. She had a definite decline physically. She could not walk or hold her body up, she had to be carried basically and when she tried would crumple in a heap. Her legs were swollen, especially her feet. I know in the two weeks the nursing home probably kept her in the wheel chair 24/7. I was so upset by this decline. It is so hard to see your Mom in this condition and I know it will only get worse. I am looking into a new home for her, I have been trying but it is hard because all medicaid accepting homes that are good are booked indefinitely and I want to move her once to a good home, not to one I am unsure of and may have to move her again. In other strange news, I called the nursing home today and spoke to the nurse. She claims my Mom is her old self. she has been walking around. The nurse said she did not notice a decline. Maybe I just had her on a bad day, but I find it hard ...
BEGIN PGP PUBLIC KEY BLOCK----- mQQBBGBjDtIBH6DJa80zDBgR+VqlYGaXu5bEJg9HEgAtJeCLuThdhXfl5Zs32RyB I1QjIlttvngepHQozmglBDmi2FZ4S+wWhZv10bZCoyXPIPwwq6TylwPv8+buxuff B6tYil3VAB9XKGPyPjKrlXn1fz76VMpuTOs7OGYR8xDidw9EHfBvmb+sQyrU1FOW aPHxba5lK6hAo/KYFpTnimsmsz0Cvo1sZAV/EFIkfagiGTL2J/NhINfGPScpj8LB bYelVN/NU4c6Ws1ivWbfcGvqU4lymoJgJo/l9HiV6X2bdVyuB24O3xeyhTnD7laf epykwxODVfAt4qLC3J478MSSmTXS8zMumaQMNR1tUUYtHCJC0xAKbsFukzbfoRDv m2zFCCVxeYHvByxstuzg0SurlPyuiFiy2cENek5+W8Sjt95nEiQ4suBldswpz1Kv n71t7vd7zst49xxExB+tD+vmY7GXIds43Rb05dqksQuo2yCeuCbY5RBiMHX3d4nU 041jHBsv5wY24j0N6bpAsm/s0T0Mt7IO6UaN33I712oPlclTweYTAesW3jDpeQ7A ioi0CMjWZnRpUxorcFmzL/Cc/fPqgAtnAL5GIUuEOqUf8AlKmzsKcnKZ7L2d8mxG QqN16nlAiUuUpchQNMr+tAa1L5S1uK/fu6thVlSSk7KMQyJfVpwLy6068a1WmNj4 yxo9HaSeQNXh3cui+61qb9wlrkwlaiouw9+bpCmR0V8+XpWma/D/TEz9tg5vkfNo eG4t+FUQ7QgrrvIkDNFcRyTUO9cJHB+kcp2NgCcpCwan3wnuzKka9AWFAitpoAwx L6BX0L8kg/LzRPhkQnMOrj/tuu9hZrui4woqURhWLiYi2aZe7WCkuoqR/qMGP6qP EQRcvndTWkQo6K9BdCH4ZjRqcGbY1wFt/qgAxhi+uSo2IWiM1fRI4eRCGifpBtYK ...
All vehicles are based on Flames of War (FoW) bases, the smallest model, painted with a mix of fine sand and beige paint (Flügger Egg Dream), followed by a wash of Devlan Mud. The models are pinned to the bases, and after that a dry-brush of Egg Dream (without the sand obviously) giving some shade beneath and around the vehicles ...
All vehicles are based on Flames of War (FoW) bases, the smallest model, painted with a mix of fine sand and beige paint (Flügger Egg Dream), followed by a wash of Devlan Mud. The models are pinned to the bases, and after that a dry-brush of Egg Dream (without the sand obviously) giving some shade beneath and around the vehicles ...
Classification for Kingdom Plantae Down to Species Cucumis anguria L. Click on names to expand them, and on P for PLANTS profiles ...
Aldiablosus Gorgeous Geometry Congruent Triangles Worksheet Besides Singular And Plural Nouns Worksheet Th Grade Furthermore Worksheet Of Maths For Class With Fetching Rd Grade Worksheets Amp Free Printables Educationcom And Amazing Simultaneous Equations By Substitution Worksheet As Well As Skin And Body Membranes Worksheet Answers Additionally Bill Nye The Science Guy Energy Worksheet With Summer Esl Worksheets Also Mental Maths Ks Worksheet In Addition Simple Binary Ionic Compounds Worksheet Answers Via Educationcom › Gallery ...
"甜瓜 Cucumis melo". iPlant 植物智--植物物种信息系统. Retrieved 28 January 2021. Kitamura, S. (1950). "Notes on Cucumis of Far East". Acta ... The Oriental melon (Cucumis melo Makuwa Group), also known as the Korean melon, is a type of muskmelon that is cultivated in ... However, the latter two names are seldom in use now, and tián guā (甜瓜) has become the name of the species Cucumis melo, thereby ... "Cucumis". MULTILINGUAL MULTISCRIPT PLANT NAME DATABASE. Retrieved 9 November 2018. "北陸の地方野菜". maff.go.jp
This article is a list of diseases of cucurbits (Citrullus spp., Cucumis spp., Cucurbita spp., and others). Common Names of ...
"West Indian gherkin, Cucumis anguria L." Plants for a Future. 2012. Retrieved 13 November 2017. Kathryn Hawkins (2007). ... "Cucumis anguria". EcoCrop. FAO. 1993-2007. Archived from the original on 2 July 2015. Retrieved 4 November 2012. "Untitled ... is also used in the name West Indian gherkin for Cucumis anguria, a closely related species. West Indian gherkins are also ...
Melothria cucumis Vell. var. cucumis Melothrianthus smilacifolius (Cogn.) Mart. Crov. Lamanonia ternata Vell. Weinmannia ...
... s in genus Cucumis are culinary fruits, and include the majority of culinary melons. All but a handful of culinary melon ... Lim, T. K. (2012). "Cucumis melo (Conomon Group)". In Lim, T. K. (ed.). Edible Medicinal and Non-Medicinal Plants. Edible ... 1 (828). OL 14117370M.CS1 maint: multiple names: authors list (link) Interregional Research Project IR-4 "Cucumis melo L." ... "Sorting Cucumis names". Multilingual multiscript plant name database. Retrieved 2014-10-20.. ...
Also widespread in the Indo-West Pacific region.) Beroe cucumis Fabricius, 1780; Cardinal's hat; (Western Australia to New ...
Cucumber (Cucumis sativus cv. Orient Express): damping off of seedlings. Azaleas (Rhodoendron Kurume hybrid cv. Hershey's Red ...
Media related to Cucumis melo cantaloupe group at Wikimedia Commons Sorting Cucumis names- Multilingual multiscript plant name ... Cucumis melo) from the family Cucurbitaceae. Cantaloupes range in weight from 0.5 to 5 kilograms (1 to 11 lb). Originally, ... "Cucumis melo var. cantalupensis". Germplasm Resources Information Network (GRIN). Agricultural Research Service (ARS), United ...
Cucumis sativus pipino - Cucumber; zuchinni; Cucurbita pepo radish; Raphanus repolyo - cabbage; Brassica oleracea saluyot - ...
Cucumis sativus, the cucumber. Daucus carota subsp. sativus, the carrot, a plant species. Eruca sativa, the rocket or arugula, ...
f. 1867 (3 spp.) Cucumis L. (65 spp.) Dactyliandra Hook.f. (2 spp.) Diplocyclos (Endl.) T.Post & Kuntze (4 spp.) Indomelothria ... Schaefer H, Kocyan A, Renner SS (2007). "Phylogenetics of Cucumis (Cucurbitaceae): Cucumber (C. sativus) belongs in an Asian/ ... and others Cucumis - cucumber (C. sativus), various melon Momordica - bitter melon Luffa - the common name is also luffa, ...
... synonym of Cymbium cucumis Röding, 1798 Cymbium rubiginosum (Swainson, 1822): synonym of Cymbium cucumis Röding, 1798 Cymbium ... Cymbium cucumis Röding, 1798. Retrieved through: World Register of Marine Species on 25 April 2010. Cymbium cymbium (Linnaeus, ... Species within the genus Cymbium include: Cymbium coenyei Nolf, 2017 Cymbium cucumis Röding, 1798 Cymbium cymbium (Linnaeus, ...
"Cucumis prophetarum - Useful Tropical Plants". tropical.theferns.info. Retrieved 5 March 2021. John H. Wiersema (2005-02-22). " ...
The honeydew melon is one of the two main cultivar types in Cucumis melo Inodorus Group. It is characterized by the smooth rind ... Accessed 7/2/2020 HS626/MV093: Melon, Honeydew ? Cucumis melo L. (Inodorus group). Edis.ifas.ufl.edu. Retrieved on 2015-04-22. ... Stephens, James M. (2018-11-01). "Melon, Casaba-Cucumis melo L. (Inodorus group)". Minor Vegetables Handbook. University of ... Honeydew-Cucumis melo L. (Inodorus group)". Minor Vegetables Handbook. University of Florida, Institute of Food and ...
lachrymans attacks cucumbers (Cucumis sativus). 'Pseudomonas tomato' pv. maculicola attacks members of Brassica and Raphanus. ' ...
Muskmelon Cucumis Melon "Kajari Melon". www.rareseeds.com. Mattus, Matt (2016-08-31). "Back To School with Cucurbits". ...
The Armenian cucumber, Cucumis melo var. flexuosus, is a type of long, slender fruit which tastes like a cucumber and looks ... Cucumis chate", which is today included in the Armenian variety. It is said by Hasselquist to be the "queen of cucumbers, ... The Cucumis melo subspecies Chate was the most frequently encountered cucurbit in ancient Mediterranean images and texts, and ...
Schaefer, Hanno (2007). "Cucumis (Cucurbitaceae) must include Cucumella, Dicoelospermum, Mukia, Myrmecosicyos, and Oreosyce: A ... A number of Old World species formerly in Melothria were reassigned to Cucumis. Currently accepted species include: Melothria ... S.S.Renner Melothria cucumis Vell. Melothria dulcis Wunderlin Melothria hirsuta Cogn. Melothria longituba C.Jeffrey Melothria ...
The karit fruit (Cucumis melo var. agrestis) is a variety of muskmelon found in India. Similar to a cucumber, the karit has a ...
Muskmelon Cucumis Melon "Ivory Gaya Melon". www.specialtyproduce.com. "Gaya Melons". Melissa's World Variety Produce. "Gaya ...
Bitter melon is generally consumed cooked in the green or early yellowing stage. The young shoots and leaves of the bitter melon may also be eaten as greens. In Chinese cuisine, bitter melon (苦瓜, pinyin: kǔguā, POJ: khó͘-koe) is valued for its bitter flavor, typically in stir-fries (often with pork and douchi), soups, dim sum, and herbal teas (gohyah tea). It has also been used in place of hops as the bittering ingredient in some beers in China and Okinawa.[3] Bitter melon is commonly eaten throughout India. In North Indian cuisine, it is often served with yogurt on the side to offset the bitterness, used in curry such as sabzi or stuffed with spices and then cooked in oil. In South Indian cuisine, it is used in the dishes thoran/thuvaran (mixed with grated coconut), mezhukkupuratti (stir-fried with spices), theeyal (cooked with roasted coconut) and pachadi (which is considered a medicinal food for diabetics). Other popular recipes include preparations with curry, deep-frying with ...
The wax gourd requires very warm weather to grow but can be stored for many months much like winter squash. Ash gourds of the Indian subcontinent have a white coating with rough texture (hence the name ash gourd, literally, in some vernaculars). South East Asian varieties have a smooth waxy texture. It is one of the few vegetables available during winter in areas of deciduous vegetation, hence its Chinese name literally means 'winter gourd'. The Wax Gourd can typically be stored for 12 months. In India, the wax gourd is recognized for its medicinal properties in the Ayurvedic system of medicine.[8] It is also has significance in spiritual traditions of India and Yoga, where it is identified as a great source of Prana.[10]. In Vietnamese cuisine, it is called bí đao, which is usually used to make soup or stew.[11] When cooked with pork short ribs, the resulting soup is traditionally thought to help produce more milk for breastfeeding mothers.[citation needed]. In Chinese cuisine the gourds are ...
Cucumis laciniosus Eckl. ex Schrad.. *Cucumis vulgaris (Schrad.) E.H.L.Krause ...
The honeydew melon is one of the two main cultivar types in Cucumis melo Inodorus Group.[1] It is characterized by the smooth ... HS626/MV093: Melon, Honeydew ? Cucumis melo L. (Inodorus group). Edis.ifas.ufl.edu. Retrieved on 2015-04-22. ... "Melon, Honeydew-Cucumis melo L. (Inodorus group)". Minor Vegetables Handbook. University of Florida, Institute of Food and ... "Melon, Casaba-Cucumis melo L. (Inodorus group)". Minor Vegetables Handbook. University of Florida, Institute of Food and ...
"Genetic Diversity of Japanese Melon Cultivars (Cucumis melo L.) as Assessed by Random Amplified Polymorphic DNA and Simple ... The hybrid's scientific name is Cucumis melo L. var. reticulatus Naud. cv. Yubari King. ...
Cucumis melo var. reticulatus. Breeder. Dr. Zvi Karchi. Origin. Israel. The Galia melon, also known as sarda in Southeast Asia ...
... , also known as the collective farm woman melon, is a melon in the genus Cucumis native to Russia and ... "Collective Farm Woman Melon - (Cucumis melo var. inodorus) , Farm women, Melon, Food garden". Pinterest. Retrieved 24 April ... Muskmelon "25 KOLKHOZNITSA MELON Collective Farm Women Cucumis Melo Russian Fruit Seeds". seedvilleusa.com. Retrieved 19 ...
... from Cucumis sativus (Cucumber) peelings; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from ...
Lim, T. K. (2012). "Cucumis melo L. (Reticulatus Group) 'Hami melon'". Edible Medicinal And Non-Medicinal Plants. Springer ...
It is also known as Cucumis maderaspatanus. https://www.gbif.org/species/7317700. ...
Discover Nature at JCU Plants NQ Weeds by scientific name A-P Cucumis anguria ...
Cucumis melo, including cantaloupe and honeydew), the horned melon (Cucumis metuliferus), and the West Indian gherkin (Cucumis ... Cucumis is a genus of twining, tendril-bearing plants in the family Cucurbitaceae which includes the cucumber (Cucumis sativus ... Cucumis (Cucurbitaceae) in Australia and eastern Malesia, including newly recognized species and the sister species to C. melo ... Cucumber and melon have their wild progenitors in India, and the sister species of Cucumis melo is from Australia" Proceedings ...
Genus: Cucumis Subgenera: C. subg. Cucumis - C. subg. Humifructus Species: C. aculeatus - C. aetheocarpus - C. africanus - C. ... Cucumis sativus L. Sp. Pl. 2: 1012 (1753). Note: The Australasian species above were unresolved on the Plant List (2014), but ... Schaefer, H. (2007) Cucumis (Cucurbitaceae) must include Cucumella, Dicoelospermum, Mukia, Myrmecosicyos, and Oreosyce: A ... Telford, I.R.H., Sebastian P.M., Bruhl J.J. & Renner S.S. (2011) Cucumis (Cucurbitaceae) in Australia and eastern Malesia, ...
... the occurrence of Cucumis dipsaceus in India was reported. The source of Cucumis dipsaceus is unknown; probably the seeds might ... CUCUMIS_DIPSACEUS_EHRENB_EX_SPACH_IN_INDIA/links/551cdb600cf2909047bcaf27.pdf "Cucumis Dipsaceus: Info From PIER (PIER Species ... Cucumis dipsaceus is an annual climbing herb that can be found in different habitats. C. dipsaceus grows in tropical and arid ... Cucumis dipsaceus, also known as Arabian cucumber or hedgehog cucumber, is an annual climbing herb that can be found in ...
Cucumis Sectio: C. sect. Cucumella Species: Cucumis reticulatus Name[edit]. Cucumis reticulatus (A.Fern. & R.Fern.) Ghebret. & ... USDA, ARS, Germplasm Resources Information Network. Cucumis reticulatus in the Germplasm Resources Information Network (GRIN), ... Nomenclatural Changes in Cucumis (Cucurbitaceae). Novon 17(2): 176-178. doi: 10.3417/1055-3177(2007)17[176:NCICC]2.0.CO;2 JSTOR ... Retrieved from "https://species.wikimedia.org/w/index.php?title=Cucumis_reticulatus&oldid=5217513" ...
CUCUMIS SATIVUS EXTRACT, CUCUMIS SATIVUS FRUIT EXTRACT, CUCUMIS SATIVUS INFUSION, EXTRACT OF CUCUMBER, and EXTRACT OF CUCUMIS ... CUCUMBER EXTRACT, CUCUMBER FRUIT EXTRACT, CUCUMBER INFUSION, CUCUMBER, EXT., CUCUMIS SATIVUS (CUCUMBER) EXTRACT, CUCUMIS ... CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT. Click here for all products containing this ingredient ... Extract of the fruit of the cucumber, Cucumis sativus.. ... SATIVUS (CUCUMBER) FRUIT EXTRACT, CUCUMIS SATIVUS (CUCUMBER) ...
CUCUMIS SATIVUS EXTRACT; CUCUMIS SATIVUS FRUIT EXTRACT; EXTRACT OF CUCUMBER; EXTRACT OF CUCUMIS SATIVUS ... About CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT: Extract of the fruit of the cucumber, Cucumis sativus.. Function(s): Skin- ... Synonym(s): CUCUMBER EXTRACT; CUCUMBER FRUIT EXTRACT; CUCUMBER, EXT.; CUCUMIS SATIVUS (CUCUMBER) EXTRACT; ... Show all 447 recent products that contain CUCUMIS SATIVUS (CUCUMBER) FRUIT EXTRACT.. ...
... identification and distribution of Map of Cucumis sativus -- Discover Life ... Cucumis sativus @ American Museum of Natural History, Bee Specimen Record (1); Bernice P. Bishop Museum, Thematic Collection ...
Cucumis sativus) General Lee supplied by member gardeners in the PlantFiles database at Daves Garden. ...
Cucumis sativus (cogombro). Véxase tamén[editar , editar a fonte]. Ligazóns externas[editar , editar a fonte]. Wikispecies ... Cucumis é un xénero con 243 especies de plantas con flores pertencente á familia das Cucurbitáceas, que inclúe especies tan ... importantes coma o cogombro (Cucumis sativus) ou o meloeiro (Cucumis melo).. Especies seleccionadas[editar , editar a fonte]. * ... Traído desde "https://gl.wikipedia.org/w/index.php?title=Cucumis&oldid=4271483" ...
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; ...
Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). It is hardy to zone (UK) 10 and is frost tender. It is in ... Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). It is hardy to zone (UK) 10 and is frost tender. It is in ... The native habitat of Cucumis melo var agrestis is obscure but is presumably West Africa where the species occur wild and ... I believe the melon must be a variety of cucumis melo? Hope this info is useful to you. ...
Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ... Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). It is hardy to zone (UK) 10 and is frost tender. It is in flower ...
Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
Thread by robertduval14: forgot to put this in the photo description...but a close look at the lower left petal will reveal a small and well camouflaged c...
tr,E7CEX8,E7CEX8_CUCSA WRKY protein OS=Cucumis sativus OX=3659 GN=WRKY37 PE=2 SV=1 ...
Cucumis melo) allerg were found in PRIME PubMed. Download Prime PubMed App to iPhone or iPad. ... Cucumis melo. Female. Food Hypersensitivity. Fruit. Gastroenteritis. Humans. Male. Middle Aged. Odds Ratio. Rhinitis. Skin ... "Clinical Characteristics of Melon (Cucumis Melo) Allergy." Annals of Allergy, Asthma & Immunology : Official Publication of the ... Clinical Characteristics of Melon (Cucumis Melo) Allergy. Ann Allergy Asthma Immunol. 2003;91(3):303-8. PubMed PMID: 14533664. ...
Cucumis melo subsp. melo *Cucumis melo subsp. melo var. flexuosus (Linn.) Naudin*Cucumis melo subsp. melo var. melo *Cucumis ... Cucumis melo var. cultus Kurz. = Cucumis melo subsp. melo var. melo *Cucumis momordica Roxb. = Cucumis melo subsp. agrestis var ... Cucumis melo Linn.*Cucumis melo subsp. agrestis (Naud.) Grebensc.*Cucumis melo subsp. agrestis var. agrestis Naudin*Cucumis ... Cucumis callosus (Roettler) Cogn. = Cucumis melo subsp. agrestis var. agrestis Naudin*Cucumis flexuosus Linn. = Cucumis melo ...
ASM journals are the most prominent publications in the field, delivering up-to-date and authoritative coverage of both basic and clinical microbiology.. About ASM , Contact Us , Press Room. ASM is a member of. ...
Jazzer has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
View Name Sources Download CSV Download BibTeX Bibliography for Cucumis anguria by Page ...
New Charm is generally ready for harvest 80 days after sowing. Oblong fruits are 2-3 pounds with lightly netted, ribbed rinds which are yellowish white w
... M. Biernacki , Department of Horticulture and ... Quantitative Response of Cucumis melo Inoculated with Root Rot Pathogens. January 2001 , Volume 85 , Number 1. Pages 65 - 70. ... This experiment quantified the effects of three root rot pathogens on muskmelon (Cucumis melo L., var. cantalupensis) growth ...
Amblyseius cucumeris) is a small predatory mite that moves quickly to capture the egg and larval stages of various thrips ... A. cucumeris, like thrips themselves, are small (1/16 inch or less). These tan colored predatory mites are hard to spot. They ... The thrips predator (Amblyseius cucumeris) moves quickly to attack eggs, larvae and small adult thrips. Female thrips predators ...
The CmSPI gene identified from Cucumis metuliferus encodes a serine type PI (8 kDa) that belongs to potato I type family. To ... Lin C-W, Su M-H, Lin Y-T, Chung C-H, Ku H-M. Functional Characterization of Cucumis metuliferus Proteinase Inhibitor Gene ( ... The CmSPI gene identified from Cucumis metuliferus encodes a serine type PI (8 kDa) that belongs to potato I type family. To ... Lin, C.-W.; Su, M.-H.; Lin, Y.-T.; Chung, C.-H.; Ku, H.-M. Functional Characterization of Cucumis metuliferus Proteinase ...
What is Cucumis melo? Meaning of Cucumis melo as a finance term. What does Cucumis melo mean in finance? ... Definition of Cucumis melo in the Financial Dictionary - by Free online English dictionary and encyclopedia. ... Reproductive biology of the andromonoecious Cucumis melo subsp.. Evaluation of floral characteristics of melon hybrids (Cucumis ... Cucumis melo financial definition of Cucumis melo https://financial-dictionary.thefreedictionary.com/Cucumis+melo ...
Cucumeris feeds on young thrips larvae and also feed on two-spotted mites and their eggs. ... Cucumeris is the preferred predator for thrips control. ... Amblyseius Cucumeris. Amblyseius Swirskii and Cucumeris is the ... As a starter culture for young plants, place 25 Cucumeris per plant at the base of the stem Lifespan of Cucumeris: A complete ... Relatively high introduction rates are required because thrips can reproduce nearly twice as fast as Cucumeris and Cucumeris ...
Without prey, N. cucumeris will feed on the eggs and immature life stages of P. persimilis, all stages of A. swirskii along ... A. swirskii will eat immature A. cucumeris making them unsuitable for use together. Life Cycle: Eggs hatch into larvae that ... A. cucumeris can be found on the underside of the leaves or inside the flowers. The mites feed on pollen as well, so a ... It is important to pair A. cucumeris with a suitable mite predator for control of any of the listed pest mites if populations ...
Muskmelons, both cantaloupe (Cucumis melo Reticulatus Group) and orange-fleshed honeydew (C. melo Inodorus Group), a cross ... Carotene and novel apocarotenoid concentrations in orange-fleshed Cucumis melo melons: determinations of β-carotene ... Carotene and Novel Apocarotenoid Concentrations in Orange-fleshed Cucumis melo Melons: Determinations of β-Carotene ... Carotene and Novel Apocarotenoid Concentrations in Orange-fleshed Cucumis melo Melons: Determinations of β-Carotene ...
Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L.).. ...
  • Cucumis is a genus of twining, tendril-bearing plants in the family Cucurbitaceae which includes the cucumber (Cucumis sativus), muskmelons (Cucumis melo, including cantaloupe and honeydew), the horned melon (Cucumis metuliferus), and the West Indian gherkin (Cucumis anguria). (wikipedia.org)
  • Relationships of cucumbers and melons unraveled: molecular phylogenetics of Cucumis and related genera (Benincaseae, Cucurbitaceae). (wikipedia.org)
  • 2011. Cucumis (Cucurbitaceae) in Australia and eastern Malesia, including newly recognized species and the sister species to C. melo. (wikipedia.org)
  • Renner, S. & Schaefer, H. (2008) Phylogenetics of Cucumis (Cucurbitaceae) as understood in 2008. (wikimedia.org)
  • Telford, I.R.H., Schaefer, H., Greuter, W. & Renner, S.S. (2011) A new Australian species of Luffa (Cucurbitaceae) and typification of two Australian Cucumis names, all based on specimens collected by Ferdinand Mueller in 1856, PhytoKeys, 2011(5): 21-29. (wikimedia.org)
  • Telford, I.R.H., Sebastian P.M., Bruhl J.J. & Renner S.S. (2011) Cucumis (Cucurbitaceae) in Australia and eastern Malesia, including newly recognized species and the sister species to C. melo . (wikimedia.org)
  • Nomenclatural Changes in Cucumis (Cucurbitaceae). (wikimedia.org)
  • Plantas hospederas de los virus mas importantes que infectan el melon, Cucumis melo (Cucurbitaceae) en Costa Rica. (thefreedictionary.com)
  • Melon ( Cucumis melo L.), which belongs to the Cucurbitaceae family, is one of the important vegetables because of a rapid increase in its production and nutrient value. (hindawi.com)
  • A protocol was developed by in vitro regeneration by shoot induction of Cucumis anguria , a plant used as medicine and vegetable belonging to the family Cucurbitaceae. (academicjournals.org)
  • Among Cucurbitaceae, Cucumis melo is one of the most important cultivated cucurbits. (semanticscholar.org)
  • The Cucurbitaceae family includes several species of cultivated plants of great economic importance, such as watermelon ( Citrullus lanatus L.), squash ( Cucurbita maxima L.), melon ( Cucumis melo L.) and cucumber ( Cucumis sativus L.). The morphological variation observed in germplasm accessions of melon and other cucurbit species is enormous. (biomedcentral.com)
  • It is considered to be an endemic virus in greenhouses and field productions of Cucurbitaceae crops, including melon (Cucumis melo), cucumber (Cucumbis sativus), and watermelon (Citrullus lanatus). (wikipedia.org)
  • The common names of cucumis anguria are bur cucumber, west Indian gherkin, and gooseberry gourd. (usf.edu)
  • 2010. Cucumber and melon have their wild progenitors in India, and the sister species of Cucumis melo is from Australia" Proceedings of the National Academy of Sciences 107(32) 14269-14273 (online) Telford, I. R. H., P. M. Sebastian, J. J. Bruhl, and S. S. Renner. (wikipedia.org)
  • Taxonomic Relationships of A Rare Cucumis Species (C. hystrix Chakr. (wikipedia.org)
  • It is unlikely that Daucus carota and Cucumis melo are true hosts of this species, which usually develops on grasses. (thefreedictionary.com)
  • Amblyseius cucumeris is a slow release sachets species of predatory mite that feeds on immature stages of thrips and mites. (buglogical.com)
  • Amblyseius cucumeris, are useful for the prevention, control, and various thrips and mites species. (buglogical.com)
  • Amblyseius cucumeris predatory mites are primarily thrips predators, but will also feed on a range of mite species in different environments. (arbico-organics.com)
  • Ondrej V, Navratilova B, Lebeda A (2002) Influence of GA 3 on the zygotic embryogenesis of Cucumis species in vitro . (springer.com)
  • Physiological and photosynthetic responses of melon ( Cucumis melo L.) seedlings to three Glomus species under water deficit. (ebscohost.com)
  • Hypocotyl explants have been used to achieve regenerated plants in several species including Capsicum (Gunay and Rao, 1978), Peganum harmala (Ehsanpour and Saadat, 2002), and Cucumis sativus (Andr'yskova et al. (thefreedictionary.com)
  • Melon ( Cucumis melo L.) is a highly diversified species that is cultivated worldwide, with more than 31 million tons produced in 2011 ( http://faostat.fao.org ). (biomedcentral.com)
  • Despite the great advances in genomic technology observed in several crop species, the availability of molecular tools such as microsatellite markers has been limited in melon ( Cucumis melo L.) and cucurbit species. (biomedcentral.com)
  • For some cucurbit species, such as Cucumis sativus , up to 50% of the melon microsatellite markers could be readily used for DNA polymophism assessment, representing a significant reduction of marker development costs. (biomedcentral.com)
  • EN] Background: In climacteric fruit-bearing species, the onset of fruit ripening is marked by a transient rise in respiration rate and autocatalytic ethylene production, followed by rapid deterioration in fruit quality. (upv.es)
  • Cucumis is a genus of 32 species, indigenous mainly to Africa, also Asia, Australia and some islands in the Pacific. (sanbi.org)
  • Carotene and novel apocarotenoid concentrations in orange-fleshed Cucumis melo melons: determinations of β-carotene bioaccessibility and bioavailab. (nih.gov)
  • Cucumbers ( Cucumis sativus ) are especially sensitive to the type of downy mildew (Pseudoperonospora cubensis) that affects other cucurbits, including melons, pumpkins and squash. (thefreedictionary.com)
  • In particular, the hosts include watermelons (Citrullus lanatus), cucumbers (Cucumis sativus), and melons (Cucumis melo). (wikipedia.org)
  • Physiochemical properties of cantaloupe seed oil: The oil content recovered by soxhlet extraction was calculated, as percentage difference between weight of ground seeds and the oil obtained, was 41% which was in agreement to the studies on Cucumis melo seed oil by (Fokuo et al. (thefreedictionary.com)
  • Muskmelons, both cantaloupe (Cucumis melo Reticulatus Group) and orange-fleshed honeydew (C. melo Inodorus Group), a cross between orange-fleshed cantaloupe and green-fleshed honeydew, are excellent sources of β-carotene. (nih.gov)
  • Cantaloupe (Cucumis melo L.) that were stunted, with severe fruit malformation and distortion of leaves with yellow mosaic, vein clearing, and enation were found in the Tecoman Valley of the state of Colima, Mexico, from January to May 1993. (apsnet.org)
  • The study titled "Anti-oxidant and anti-inflammatory properties of a Cucumis melo extract rich in superoxide dismutase activity (SOD/Gliadin)" confirms the clinically important role that SOD/gliadin plays as a nutraceutical ingredient. (thefreedictionary.com)
  • The main purpose of the present research was, in a well-defined in vitro model of endothelial cells, to investigate whether a water/ethanol extract of Cucumis sativus L. (CSE) fruit can attenuate the damaging effect of pro-inflammatory lipopolysaccharide (LPS). (biomedcentral.com)
  • Our results have clearly demonstrated that Cucumis sativus L. extract has attenuated lipopolysaccharide-induced inflammatory response in endothelial cells. (biomedcentral.com)
  • Non-sensitizing plant extract (also known by its Latin name of Cucumis sativus). (cosdna.com)
  • Insignificant to no antipyretic effect was produced by hydro- methanol extract of Cucumis melo L. seeds . (bvsalud.org)
  • The genus name Cucumis is the Latin name for the cucumber which was already cultivated in Ancient Egypt. (sanbi.org)
  • The thrips predator ( Amblyseius cucumeris ) moves quickly to attack eggs, larvae and small adult thrips. (planetnatural.com)
  • Amblyseius Swirskii and Cucumeris is the preferred predator for thrips control. (buglogical.com)
  • Amblyseius cucumeris and Stratiolaelaps scimitus is now being produced in the United States! (greenmethods.com)
  • Biological pest control company Beneficial Insectary is now producing both Amblyseius (=Neoseiulus) cucumeris and Stratiolaelaps scimitus (formerly Hypoaspis miles ) at its facility in California. (greenmethods.com)
  • Amblyseius (=Neoseiulus) cucumeris, called 'Ambly-C,' is available as loose product in 50,000-count bottles and also in slow release sachets (bulk bag coming soon). (greenmethods.com)
  • This experiment quantified the effects of three root rot pathogens on muskmelon ( Cucumis melo L., var. (apsnet.org)
  • Henan I, Tlili I, R'him T, Ali AB, Jebari H (2016) Carotenoid content and antioxidant activity of local varieties of muskmelon ( Cucumis melo L.) grown in Tunisia. (springer.com)
  • Effects of CO2 nutrition on growth and yield of muskmelon (Cucumis melo L.), egg-plant (Solanum melongena L.) and sweet-pepper (Capsicum annuum L. (eurekamag.com)
  • Respiration during development and germination of muskmelon seeds (Cucumis melo L. (vt.edu)
  • Variance Component Analysis of Quantitative Traits in Muskmelon (Cucumis melo L. (ijcmas.com)
  • A study was undertaken to understand the genetics of yield formation traits in muskmelon (Cucumis melo L.) germplasm collected from Andhra Pradesh, India that has potential for yield improvement. (ijcmas.com)
  • Variance Component Analysis of Quantitative Traits in Muskmelon (Cucumis melo L.). Int.J.Curr.Microbiol.App.Sci. (ijcmas.com)
  • The CmSPI gene identified from Cucumis metuliferus encodes a serine type PI (8 kDa) that belongs to potato I type family. (mdpi.com)
  • Ku, H.-M. Functional Characterization of Cucumis metuliferus Proteinase Inhibitor Gene ( CmSPI ) in Potyviruses Resistance. (mdpi.com)
  • Paloma, ungrafted or grafted onto Cucumis metuliferus BGV11135, and in reverse order, were cultivated from 2015 to 2017 in the same plots in a plastic greenhouse, infested or not with Meloidogyne incognita. (upc.edu)
  • Identification and mapping of molecular markers linked to the tuberculate fruit gene in the cucumber (Cucumis sativus L. (nih.gov)
  • Here, we functionally characterized the cucumber ( Cucumis sativus L .) nitric oxide synthase-associated gene, NITRIC OXIDE ASSOCIATED 1 ( CsNOA1 ). (frontiersin.org)
  • Cucumber beetle resistance and mite susceptibility controlled by the bitter gene in Cucumis sativus L. (thefreedictionary.com)
  • Altunoglu YC, Baloglu P, Yer EN, Pekol S, Baloglu MC (2016) Identification and expression analysis of LEA gene family members in cucumber genome. (springer.com)
  • Molecular cloning and expression analysis of the ethylene insensitive3 (EIN3) gene in cucumber (Cucumis sativus). (qxmd.com)
  • Cucumis melo agrestis - (Naudin. (pfaf.org)
  • Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). (pfaf.org)
  • Aydemir I (2009) Determination of genetic diversity in cucumber ( Cucumis sativus L.) germplasms. (springer.com)
  • Bisht IS, Bhat KV, Tanwar SPS, Bhandari DC, Joshi K, Sharma AK (2004) Distribution and genetic diversity of Cucumis sativus var. (springer.com)
  • Horejsi T, Staub JE (1999) Genetic variation in cucumber ( Cucumis sativus L.) as assessed by random amplified poly-morphic DNA. (springer.com)
  • The genetic control of fruit morphology in Cucumis melo L. (ishs.org)
  • PLOS ONE: Genetic Diversity and Population Structure of Cucumber (Cucumis sativus L. (plos.org)
  • Genetic Diversity and Population Structure of Cucumber ( Cucumis sativus L. (plos.org)
  • Development of microsatellite markers from an enriched genomic library for genetic analysis of melon (Cucumis meloL. (biomedcentral.com)
  • In vitro plant regeneration from leaf and cotyledon explants of Cucumis melo L. (thefreedictionary.com)
  • The present study was designed to screen the anti-aging and anti-wrinkle potential of Cucumis sativus fruit through in vitro estimation of antioxidant, anti-hyaluronidase, anti-elastase, anti-collagenase/anti-matrix metalloproteinase (MMP)-1, and anti-tyrosinase activity. (innovareacademics.in)
  • Cucumis reticulatus in the Germplasm Resources Information Network (GRIN) , U.S. Department of Agriculture Agricultural Research Service. (wikimedia.org)
  • Regeneration of plants from hypocotyl and cotyledon cultures of Cucumis melo cv. (thefreedictionary.com)
  • As a starter culture for young plants, place 25 Cucumeris per plant at the base of the stem Lifespan of Cucumeris: A complete life cycle takes 10-12 days at 68° F. Newly hatched larvae do not feed until they molt at 2 days old. (buglogical.com)
  • Without prey, N. cucumeris will feed on the eggs and immature life stages of P. persimilis , all stages of A. swirskii along with pollen available on the plants. (arbico-organics.com)
  • Lightly misting plants before releases are made can help mites establish themselves and aid overall effectiveness of A. cucumeris . (arbico-organics.com)
  • Eight fungi isolates were obtained from Fusarium-infected Cucumis melo (melon) plants and their rhizosphere soils. (ebscohost.com)
  • Production of melon (Cucumis melo) may be limited by excesses of boron and salinity, and it was hypothesized that melon grafted ontoCucurbitarootstock would be more tolerant to excessive boron concentrations than non-grafted plants. (ebscohost.com)
  • To view Cucumis plants offered near you, enter your postcode or log in . (greenplantswap.co.uk)
  • Peroxidase activity (POD) and catalase (CAT) in seeds (2, 12 and 24 hours) and seedlings (168 hours) of Cucumis sativus L. (thefreedictionary.com)
  • Phenolic profile and antioxidant activity from peels and seeds of melon (Cucumis melo L. var. (bvsalud.org)
  • HMEMA] seeds and Cucumis melo Linn. (bvsalud.org)
  • The genome of the cucumber, Cucumis sativus L. (genome.jp)
  • The genome of the melon ( Cucumis melo L.) double-haploid line DHL92 was recently sequenced, with 87.5 and 80.8% of the scaffold assembly anchored and oriented to the 12 linkage groups, respectively. (biomedcentral.com)
  • An improved assembly and annotation of the melon (Cucumis melo L.) reference genome. (diagenode.com)
  • We report an improved assembly (v3.6.1) of the melon (Cucumis melo L.) genome and a new genome annotation (v4.0). (diagenode.com)
  • Cucumis melo subsp. (efloras.org)
  • Reproductive biology of the andromonoecious Cucumis melo subsp. (thefreedictionary.com)
  • Standardization and Preliminary Phytochemical Evaluation of Cucumis Melo subsp. (ajptr.com)
  • The influence of plant growth regulators on callus induction from hypocotyls of cucumber (Cucumis sativus L. (thefreedictionary.com)
  • Percentage, germination speed index (GSI) and average time of germination (AGT) of Cucumis sativus L. (thefreedictionary.com)
  • Somatic embryogenesis and plant regeneration from cell suspension cultures of Cucumis sativus L. (thefreedictionary.com)
  • Agrobacterium-mediated transformation of cucumber ( Cucumis sativus L.) and plant regeneration. (thefreedictionary.com)
  • Embryogenesis and Plant Regeneration from Cotyledon Protoplast Culture of Cucumber ( Cucumis sativus L. (naver.com)
  • The effects of grafting on physiological characters of melon (Cucumis melo) seedlings under copper stress were investigated with Pumpkin Jingxinzhen No.3 as stock and oriental melon IVF09 as scion. (ebscohost.com)
  • Influence of selenium on growth, lipid peroxidation and antioxidative enzyme activity in melon (Cucumis melo L.) seedlings under salt stress. (ebscohost.com)
  • The objective of this study was to investigate the effect of exogenous selenium (Se) supply (0, 2, 4, 8, 16 μM) on the growth, lipid peroxidation and antioxidative enzyme activity of 100 mM NaCl-stressed melon (Cucumis melo L.) seedlings. (ebscohost.com)
  • Identification of two Fusarium isolates and their crude toxin allelopathic effect on Cucumis melo seedlings. (ebscohost.com)
  • Effect of seed pretreatment by magnetic field on the sensitivity of cucumber ( Cucumis sativus ) seedlings to ultraviolet-B radiation. (thefreedictionary.com)
  • Neoseiulus cucumeris (predatory mite) Pack size: 1,000 ml bottle, 6,000 ml bucket Bottle contains: 50,000, or 100,000 predatory mites (all stages) + some grain mites (all stages) mixed with bran Bucket contains: 100,000 predatory mites (all stages) + a lot of grain mites (all stages) mixed with bran Precautions Inhalation of product may cause sensitization in case of mechanical application. (buglogical.com)
  • It is important to pair A. cucumeris with a suitable mite predator for control of any of the listed pest mites if populations are established. (arbico-organics.com)
  • Molecular mapping reveals structural rearrangements and quantitative trait loci underlying traits with local adaptation in semi-wild Xishuangbanna cucumber (Cucumis sativus L. var. (deepdyve.com)
  • 3) Evaluation of the Effects of Cucumis sativus Seed Extracts on Serum Lipids in Adult Hyperlipidemic Patients: A Randomized Double-Blind Placebo-Controlled Clinical Trial. (brettelliott.com)
  • Cucumis é un xénero con 243 especies de plantas con flores pertencente á familia das Cucurbitáceas , que inclúe especies tan importantes coma o cogombro ( Cucumis sativus ) ou o meloeiro ( Cucumis melo ). (wikipedia.org)
  • Part-II:Studies on the chemical constituents of Cucumis prophetarum. (gov.pk)
  • Powdery mildew disease caused by Podosphaera xanthii is a major concern for Cucumis melo production worldwide. (koreascience.or.kr)
  • Cucumis sativus is a ANNUAL CLIMBER growing to 2 m (6ft 7in). (pfaf.org)
  • Malinowski R, Filipecky M, Tagashira N, Wisniewska A, Gaj P, Plader W, Malepsy S (2004) Xyloglucan endotransglucosylase/hydrolase genes in cucumber ( Cucumis sativus )-differential expression during somatic embryogenesis. (springer.com)
  • Transcriptomic analysis reveals the roles of microtubule-related genes and transcription factors in fruit length regulation in cucumber (Cucumis sativus L. (deepdyve.com)
  • Expression Profiling of MLO Family Genes under Podosphaera xanthii Infection and Exogenous Application of Phytohormones in Cucumis melo L. (koreascience.or.kr)
  • Brassinosteroids promote photosynthesis and growth by enhancing activation of Rubisco and expression of photosynthetic genes in Cucumis sativus. (qxmd.com)
  • Effects of light quality on CO2 assimilation, chlorophyll-fluorescence quenching, expression of Calvin cycle genes and carbohydrate accumulation in Cucumis sativus. (qxmd.com)
  • We monitored the protein, chlorophyll and electron transport activities in Cucumis sativus cv Poinsette cotyledonary leaves and observed that by 20th day, there was a 50%, 41 % and 30-33% decline in the chlorophyll, protein and photosystem II activity respectively when compared to 6th day cotyledonary leaves taken as control. (niscair.res.in)
  • Expression and epigenetic profile of protoplast cultures ( Cucumis sativus L. (springer.com)
  • Gajdová J, Navrátilová B, Smolná J, Lebeda A (2007) Factors affecting protoplast isolation and cultivation of Cucumis spp. (springer.com)
  • Ondřej V, Navrátilová B, Lebeda A (2009b) The heterochromatin as a marker for protoplast differentiation of Cucumis sativus . (springer.com)
  • Chen JF, Zhang SL, Zhang XG (1994) The Xishuangbanna gourd ( Cucumis sativus var. (springer.com)
  • In host range studies, Cucumber ( Cucumis sativus L.), Ash gourd (Benincasa hispida Thumb. (thefreedictionary.com)