Creatine Kinase
Isoenzymes
Creatine
Phosphatidylinositol 3-Kinases
Clinical Enzyme Tests
Phosphocreatine
MAP Kinase Signaling System
Rats, Inbred BB
Protein Kinases
Protein-Serine-Threonine Kinases
Arginine Kinase
Calcium-Calmodulin-Dependent Protein Kinases
4-1BB Ligand
src-Family Kinases
L-Lactate Dehydrogenase
Myocardium
Homeostasis
Brain Injuries
Energy Metabolism
Rats, Wistar
Brain
Cytokines
Production of recombinant human creatine kinase (r-hCK) isozymes by tandem repeat expression of M and B genes and characterization of r-hCK-MB. (1/46)
BACKGROUND: Serum creatine kinase-MB isoenzyme (CK-MB) is widely used as a marker of myocardial injury. We prepared recombinant human CK (r-hCK) MB isoenzyme and examined its potential for use as a control material for assay of CK-MB in serum. METHODS: cDNAs encoding CK-M and CK-B subunits were inserted into the same plasmid vector, followed by transformation of Escherichia coli. The resulting three types of CK isoenzymes were purified by conventional chromatography. RESULTS: The ratio of MB to MM to BB was 50:40:10 on the basis of CK activity. Highly purified CK-MB with a specific activity of 533 U/mg was produced in a yield of 5.7 mg/g of packed cells. Purified r-hCK-MB had the isoelectric point (pI 5.3) and molecular size (46 kDa for the subunit) of native CK-MB. Its immunoreactivity in an ELISA using antibody against native heart enzyme was similar to that of cardiac CK-MB. The r-hCK-MB retained >90% activity for at least 4 months at 11 degrees C in a delipidated serum matrix in a liquid form at a concentration of 118 U/L. CONCLUSIONS: r-hCK-MB shows key properties of the native cardiac isoenzyme and may be useful as a control and calibrator for serum assays of CK-MB. (+info)Identification of novel markers for monitoring minimal residual disease in acute lymphoblastic leukemia. (2/46)
To identify new markers of minimal residual disease (MRD) in B-lineage acute lymphoblastic leukemia (ALL), gene expression of leukemic cells obtained from 4 patients with newly diagnosed ALL was compared with that of normal CD19(+)CD10(+) B-cell progenitors obtained from 2 healthy donors. By cDNA array analysis, 334 of 4132 genes studied were expressed 1.5- to 5.8-fold higher in leukemic cells relative to both normal samples; 238 of these genes were also overexpressed in the leukemic cell line RS4;11. Nine genes were selected among the 274 overexpressed in at least 2 leukemic samples, and expression of the encoded proteins was measured by flow cytometry. Two proteins (caldesmon and myeloid nuclear differentiation antigen) were only weakly expressed in leukemic cells despite strong hybridization signals in the array. By contrast, 7 proteins (CD58, creatine kinase B, ninjurin1, Ref1, calpastatin, HDJ-2, and annexin VI) were expressed in B-lineage ALL cells at higher levels than in normal CD19(+)CD10(+) B-cell progenitors (P <.05 in all comparisons). CD58 was chosen for further analysis because of its abundant and prevalent overexpression. An anti-CD58 antibody identified residual leukemic cells (0.01% to 1.13%; median, 0.03%) in 9 of 104 bone marrow samples from children with ALL in clinical remission. MRD estimates by CD58 staining correlated well with those of polymerase chain reaction amplification of immunoglobulin genes. These results indicate that studies of gene expression with cDNA arrays can aid the discovery of leukemia markers. (Blood. 2001;97:2115-2120) (+info)Comparisons of the effects of tamoxifen, toremifene and raloxifene on enzyme induction and gene expression in the ovariectomised rat uterus. (3/46)
This study compares the actions of oestradiol, tamoxifen, toremifene and raloxifene on enzyme and gene expression in uterine tissues of ovariectomised rats over 72 h. The time-course for the induction of ornithine decarboxylase by the compounds showed a rapid biphasic response, while for creatine kinase brain type (BB) there was a continued increase over 72 h. The efficacy of induction showed that, with both markers, oestradiol gave the highest induction level, followed by tamoxifen or toremifene and then raloxifene. RT-PCR demonstrated that all compounds decreased oestrogen receptor (ER) alpha, ERbeta and ERbeta2 gene expression, 8-24 h after the first dose, suggesting that down-regulation of ER is not the primary cause of the difference in efficacy between these compounds. Using cDNA arrays, expression of 512 genes was examined in the uteri of oestradiol- or tamoxifen-treated rats. Both compounds resulted in the up-regulation of heat-shock protein 27, telomerase-associated protein 1 and secretin. However, most surprising was the marked down-regulation of Wilms' tumour and retinoblastoma genes. We speculate that this may result in a loss of regulation of the transition from the G1 to the S phase in the cell cycle and may make cells more vulnerable to the carcinogenic effects of tamoxifen in this tissue. (+info)Effect of weight bearing on recovery from nerve injury in skeletal muscle. (4/46)
We examined the effect of weight bearing (WB) on muscle recovery after nerve injury. Rats were housed in individual cages for 2 wk under WB or hindlimb suspension (HS) after being subjected to sciatic nerve compression for 1 wk. Sham operated on rats served as controls (sham group). We used 31P- and 19F-nuclear magnetic resonance spectroscopy combined with histochemical, physiological, and biochemical techniques to assess the outcome in the three groups. Creatine kinase-BB (CK-BB) mRNA levels expression, CK activity, and type I fiber density in the WB group were elevated compared with those in the HS group. In addition, sciatic functional index, tetanic tension, energy state, and local circulation dynamics of the WB group were greater than those of the HS group. These results suggested that WB plays an important role in muscle regeneration, inhibits the reduction of CK activity, and facilitates the activation of neural recovery, energy state, and local circulation dynamics. (+info)Expression of brain subtype creatine kinase in the zebrafish embryo. (5/46)
Creatine kinases (CK) play crucial roles in intracellular energy transfer. We have isolated a cDNA from zebrafish embryos, which encodes a CK highly related to the mammalian brain subtype creatine kinase (BCK). The bck mRNA is expressed maternally in the zebrafish embryo and transcripts are distributed uniformly in blastula and gastrula stages. Expression becomes restricted to the prechordal plate and the nervous system during subsequent somitogenesis stages. bck transcripts are abundant in primary neurons in the developing central nervous system of the 1-day-old embryo. While some bck expression persists in the hindbrain, expression vanishes in the spinal cord of the 2-day-old embryo. In summary, the expression pattern of bck is highly dynamic and suggests a role for bck during gastrulation and neuronal differentiation. (+info)Postoperative patterns and kinetics of cTnI, cTnT, CK-MB-activity and CK-activity after elective aortic valve replacement. (6/46)
OBJECTIVES: The aim of this prospective study was to evaluate postoperative kinetics of four different biochemical ischaemic markers after elective aortic valve replacement (AVR). Additionally, pre-, peri- and postoperative data were analysed in order to identify factors with possible impact on the postoperative release of the selected enzymes. DESIGN: Forty patients (14 males, 26 females, aged 70 +/- 11 years; EF = 54 +/- 18% [mean +/- SD]) undergoing elective AVR were prospectively included in this study. For all patients, serum concentrations of cTnI, cTnT, and serum activities of CK-MB and CK were measured preoperatively as well as 0, 6, 12, 24, 48 and 120 hours after removal of the aortic cross-clamp. Clinical data were assessed in all patients and correlated with postoperative enzyme patterns. RESULTS: There were no major complications. Preoperatively, all patients showed enzyme values in the normal range whereas the four ischaemic markers reached higher values postoperatively. cTnI reached its maximum values 24 hours (XMed = 2.35 micrograms/L, 95%-CI [2.0, 3.3]) and cTnT 48 hours after the operation (XMed = 0.239 microgram/L, 95%-CI [0.174, 0.283]). Typical biphasic release kinetics could be demonstrated for cTnT. There was a high linear correlation between cTnI and cTnT at all sampling times. In contrast, a high linear correlation between cTnI, cTnT, and CK-MB-activity was only found 48 hours after aortic unclamping. cTnI nearly was in normal range 120 h postoperatively (XMed = 0.5 microgram/L, 95%-CI [0.2, 0.6]), whereas cTnT still remained pathologically elevated (XMed = 0.223 microgram/L, 95%-CI [0.137, 0.299]). No linear correlation was found between maximum values of the ischaemic markers postoperatively and age, gender, body surface area, ejection fraction, LV-hypertrophy, operating time, ECC time, time of cardiac arrest, lowest body temperature, perfusion pressure, cardioplegia volume, reperfusion time, postoperative septiformic circulatory instability, or ventilation time. CONCLUSIONS: All four ischaemic markers showed individual peak characteristics and kinetics after uncomplicated AVR. In contrast to previous findings, aortic cross-clamping time had no detectable impact on postoperative peak patterns of any ischaemic marker. (+info)Two specific markers for neural differentiation of embryonal carcinoma cells. (7/46)
Two multipotential embryonal carcinoma (EC) cell lines, 1003 and 1009, can be induced to form preferentially neural derivatives in vitro. Synthesis of specific proteins during neural differentiation was followed by two-dimensional gel electrophoresis. The comparison of protein patterns obtained with neural and non-neural derivatives of these EC cell lines indicates that two changes are specific for the neural pathway: (i) the appearance of a new beta-tubulin isoform and (ii) the accumulation of the brain isozyme of creatine phosphokinase already present in small amounts in EC stem cells. These changes were found to take place early in the course of differentiation and to occur even when neurite outgrowth was prevented. (+info)Expression of creatine kinase isoenzyme genes during postnatal development of rat brain cerebellum: evidence for transcriptional regulation. (8/46)
Transcription and accumulation of brain-type creatine kinase (CKB) mRNA and its protein was examined during postnatal development of rat brain cerebellum, the brain region containing highest CKB mRNA in the adult. CKB protein was extremely low at day 1, increased about 10-fold until week 4 and remained constant until week 10. This time course was paralleled by cerebellar CKB mRNA, which was also extremely low at day 1 and increased 5-fold during the first 3 weeks and then remained constant. High levels of CKB protein were also detected in cultured primary cerebellar granular neurons. Nuclear run-on assays directly showed that CKB mRNA accumulation during postnatal cerebellar development was due to increased transcription. When compared with cerebrum and whole brain, cerebellar CKB mRNA accumulation during postnatal development was temporally delayed. Analysis of myocyte enhancer factor (MEF)-2 and Sp1, factors known to initiate or sustain CKB transcription in tissues other than brain, revealed that MEF-2 in cerebellum was low at week 1 but increased 3.5-fold by week 7, while Sp1 remained unchanged. The increase in CKB protein during cerebellar postnatal development was coincident with that of the ubiquitous mitochondrial CK protein and mRNA, indicating that a functional phosphocreatine energy shuttle probably exists for efficient ATP regeneration in the cerebellum. This should be beneficial for the many energy-demanding requirements during cerebellar development, as indicated by the observed temporal co-expression of CKB with myelin basic protein, which is involved in axon myelination by oligodendrocytes. (+info)There are several different types of brain injuries that can occur, including:
1. Concussions: A concussion is a type of mild traumatic brain injury that occurs when the brain is jolted or shaken, often due to a blow to the head.
2. Contusions: A contusion is a bruise on the brain that can occur when the brain is struck by an object, such as during a car accident.
3. Coup-contrecoup injuries: This type of injury occurs when the brain is injured as a result of the force of the body striking another object, such as during a fall.
4. Penetrating injuries: A penetrating injury occurs when an object pierces the brain, such as during a gunshot wound or stab injury.
5. Blast injuries: This type of injury occurs when the brain is exposed to a sudden and explosive force, such as during a bombing.
The symptoms of brain injuries can vary depending on the severity of the injury and the location of the damage in the brain. Some common symptoms include:
* Headaches
* Dizziness or loss of balance
* Confusion or disorientation
* Memory loss or difficulty with concentration
* Slurred speech or difficulty with communication
* Vision problems, such as blurred vision or double vision
* Sleep disturbances
* Mood changes, such as irritability or depression
* Personality changes
* Difficulty with coordination and balance
In some cases, brain injuries can be treated with medication, physical therapy, and other forms of rehabilitation. However, in more severe cases, the damage may be permanent and long-lasting. It is important to seek medical attention immediately if symptoms persist or worsen over time.
Creatine kinase
Macro-creatine kinase
CKB (gene)
Anorexia nervosa
Enolase
Creatine
Ion chromatography
List of MeSH codes (D08)
AMP-activated protein kinase
PPARGC1A
Caffeine
Altered expression and localization of creatine kinase B, heterogeneous nuclear ribonucleoprotein F, and high mobility group...
Creatine kinase B controls futile creatine cycling in thermogenic fat - PubMed
MeSH Browser
Biomarkers Search
MeSH Browser
DeCS
NDF-RT Code NDF-RT Name
Arthritis Comprehensive Blood Test Panel, Men | Walk-In Lab
NEW (2006) MESH HEADINGS WITH SCOPE NOTES (UNIT RECORD FORMAT; 9/3/2005
Pesquisa | Portal Regional da BVS
Hallucinogen Use Workup: Laboratory Studies, Imaging Studies
CPK isoenzymes test: MedlinePlus Medical Encyclopedia
MOUSE Anti- CREATINE PHOSPHOKINASE (BB) Antibody | Technique alternative | 01012572805 - ...
These highlights do not include all the information needed to use
TEKTURNA
®
safely and...
DeCS 2018 - July 31, 2018 version
Frontiers | Treat Iron-Related Childhood-Onset Neurodegeneration (TIRCON)-An International Network on Care and Research for...
Severe Fever with Thrombocytopenia Syndrome Complicated by Co-infection with Spotted Fever Group Rickettsiae, China - Volume 22...
Proc. Natl. Acad. Sci. USA
These highlights do not include all the information needed to use
TEKTURNA
®
safely and...
Luteinizing Hormone, Human, β-Subunit (β-hLH) - scrippslabs.com
Dermatologic Manifestations of Renal Disease: Overview, Dermatologic Manifestations of Diseases Associated With ESRD,...
Diagnosis and Management of Tickborne Rickettsial Diseases: Rocky Mountain Spotted Fever and Other Spotted Fever Group...
RETRACTED ARTICLE: Decreased neuroinflammation and increased brain energy homeostasis following environmental enrichment after...
TERM
Characterization of a Human Point Mutation of VGLUT3 (p.A211V) in the Rodent Brain Suggests a Nonuniform Distribution of the...
JCI -
Volume 93, Issue 3
Poster Sessions | NIH Research Festival
Binge Drinking's Effects on the Body | Alcohol Research: Current Reviews
Journal of the Indian Society of Toxicology
Serum creatine kinase2
Phosphokinase2
- The creatine phosphokinase (CPK) isoenzymes test measures the different forms of CPK in the blood. (medlineplus.gov)
- CREATINE PHOSPHOKINASE Creatine phosphokinase, also known as creatine kinase (CK), is an enzyme expressed by various tissues and cell types. (creatinekinases.com)
Isoenzymes3
- 2. Evaluation and comparison of immunoinhibition and immunoprecipitation methods for differentiating MB and BB from macro forms of creatine kinase isoenzymes in patients and healthy individuals. (nih.gov)
- 5. Differentiation of creatine kinase MB and IgA-linked BB isoenzymes on electrophoresis. (nih.gov)
- 10. Elevated serum CK-MB and CK-BB isoenzymes in a patient with small cell lung cancer: a case report. (nih.gov)
Protein4
- The sequences obtained from the isolated spots revealed that they have close similarity to creatine kinase B (CKB) isoforms, heterogeneous nuclear ribonucleoprotein F (hnRNP F) and high mobility group box 1 protein (HMGB1) isoforms. (nih.gov)
- The various protein kinase inhibitors vary greatly in chemical structure and there is little evidence for cross sensitivity to the liver injury. (nih.gov)
- In addition, levels of AMPK (adenosine monophosphate-activated protein kinase), phosphorylated AMPK and uMtCK (ubiquitous mitochondrial creatine kinase) were assessed as measures of brain energy homeostasis. (biomedcentral.com)
- The proposed mechanisms of such rapid receptor desensitization include receptor phosphorylation by either cAMP-dependent protein kinase or the specific beta-adrenergic receptor kinase (BARK), leading to functional uncoupling from adenylyl cyclase and sequestration of the receptors away from the cell surface. (jci.org)
Adenosine1
- CK catalyses the conversion of creatine and consumes adenosine triphosphate (ATP) to create phosphocreatine and adenosine diphosphate (ADP). (creatinekinases.com)
Concentration2
- 14. Activity concentration and mass concentration (monoclonal antibody immunoenzymometric method) compared for creatine kinase MB isoenzyme in serum. (nih.gov)
- 15. Mass concentration and activity concentration of creatine kinase isoenzyme MB compared in serum after acute myocardial infarction. (nih.gov)
BRAIN1
- A form of creatine kinase found in the BRAIN . (nih.gov)
Muscle2
- Our advisers will certainly help you choose the best Bovine Phosphatidylinositol-3-kinases 2a ELISA Kit[Phosphatidylinositol-3-kinases 2a], Porcine Phosphatidylinositol-3-kinases 2a ELISA Kit[Phosphatidylinositol-3-kinases 2a], Recombinant Dog Creatine kinase B-type (CKB), Rabbit anti-human creatine kinase, Muscle polyclonal Antibody products nad else and advise you on the best solutions for you and your business. (creatinekinases.com)
- Seven studies from 2002 to 2010 show a tendency for 2g of carnitine to improve post-workout recovery through indicators such as 1) reduction in muscle injury, 2) reduction in lactic acid accumulation, 3) grip after training and 4) creatine kinase levels in the blood. (fotopharmacy.com)
Tissues2
- The microglial processes then fused to form an area of containment between healthy and injured tissues, suggesting that microglia may represent the first line of defense following TBI [ 11 ]. (biomedcentral.com)
- The synthetic form of EPO has been shown to exert remarkable, tissue-protective effects on several tissues. (biomedcentral.com)
Specific2
- 3. Sensitive and specific radioimmunoassay for creatine kinase BB isoenzyme in serum, with use of an autoantibody. (nih.gov)
- Sonidegib (soe" ni deg' ib) is an orally available, kinase inhibitor with specific activity against a key step (activation of smoothened: SMO) in the hedgehog signaling pathway. (nih.gov)
Found1
- Glycogen is found in the form of granules in the cytosol in many cell types. (np-mrd.org)
Levels1
- Leftmost panels illustrate different levels of input consistency and input noise by means of the spatial map of the stability of input Creatine cells, defined as the average PV correlation of input cells for each position. (mdm2-inhibitors.com)
Small1
- Sonidegib is a small molecule kinase inhibitor that blocks signaling in the hedgehog pathway and is used in the therapy of unresectable or metastatic basal cell carcinoma. (nih.gov)
Blood1
- Nor do we ask you to fill a cursed inkwell with orc's blood and demon saliva and then use it to complete reams of return forms written in ancient Cyrillic script. (legionathletics.com)
Human2
- 17. Creatine kinase B-subunit activity in human sera: temporal aspects of its sensitivity after myocardial infarction. (nih.gov)
- Awareness, diagnosis, and control of tickborne rickettsial diseases are most effectively addressed by considering the intersecting components of human, animal, and environmental health that collectively form the foundation of One Health ( 1 ), an approach that integrates expertise from multiple disciplines and facilitates understanding of these complex zoonoses. (cdc.gov)
Code1
- The proposed model accounts for differences in how place and grid cells represent different environments and provides a new interpretation in which place and grid cells mutually interact to form a coupled code for space. (mdm2-inhibitors.com)
Test1
- During Creatine the test sessions, the synaptic weights are fixed. (mdm2-inhibitors.com)
Complex3
- 4. Macro creatine kinase BB isoenzyme in serum: most likely an antigen-autoantibody complex. (nih.gov)
- 7. IgA-CK-BB complex with CK-MB electrophoretic mobility can lead to erroneous diagnosis of acute myocardial infarction. (nih.gov)
- P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
Addition1
- In addition, it transports the toxic compounds that form inside the mitochondria outside them, in order to prevent their accumulation. (fotopharmacy.com)
Complete1
- Papers will now be published continuously within yearly volumes in their final and complete form and then quickly released to Pubmed. (oncotarget.com)
Isoenzymes1
- The creatine phosphokinase (CPK) isoenzymes test measures the different forms of CPK in the blood. (medlineplus.gov)
Cardiac3
- The elevated CK-BB in cerebrospinal fluid is a useful predictor of hypoxic brain injury after cardiac arrest. (medscape.com)
- All heart transplant recipients are at risk for cardiac allograft vasculopathy, a form of coronary disease characterized by diffuse intimal proliferation of the coronary vasculature, a process that is to a large extent immune-mediated. (medscape.com)
- To identify patients with periprocedural MI (PMI), several conflicting definitions of PMI have been proposed, relying either on cardiac troponin (cTn) or the MB isoenzyme of creatine kinase, with or without supporting evidence of ischaemia. (medscape.com)
Serum1
- In using kinase inhibitors for treatment of cancer, serum aminotransferase elevations above 5 times the upper limit of normal (if confirmed) or any elevations accompanied by jaundice or symptoms should lead to dose reduction or temporary cessation. (nih.gov)
Subunits1
- The 2 subunits can form 3 isozymes: CK-MM, CK-MB, and CK-BB. (medscape.com)