Copepoda: A huge subclass of mostly marine CRUSTACEA, containing over 14,000 species. The 10 orders comprise both planktonic and benthic organisms, and include both free-living and parasitic forms. Planktonic copepods form the principle link between PHYTOPLANKTON and the higher trophic levels of the marine food chains.Ectoparasitic Infestations: Infestations by PARASITES which live on, or burrow into, the surface of their host's EPIDERMIS. Most ectoparasites are ARTHROPODS.Cladocera: A suborder of CRUSTACEA, order Diplostraca, comprising the water fleas. They are benthic filter feeders that consume PHYTOPLANKTON. The body is laterally compressed and enclosed in a bivalved carapace, from which the head extends.Zooplankton: Minute free-floating animal organisms which live in practically all natural waters.Crutches: Wooden or metal staffs designed to aid a person in walking. (UMDNS,1999)Round Ligament: A fibromuscular band that attaches to the UTERUS and then passes along the BROAD LIGAMENT, out through the INGUINAL RING, and into the labium majus.Fin Whale: The species Balaenoptera physalus, in the family Balaenopteridae, characterized by a large, strongly curved, dorsal fin. It is the second largest of the WHALES, highly migratory, but rarely seen near the shore.Fresh Water: Water containing no significant amounts of salts, such as water from RIVERS and LAKES.Fish Diseases: Diseases of freshwater, marine, hatchery or aquarium fish. This term includes diseases of both teleosts (true fish) and elasmobranchs (sharks, rays and skates).Population Density: Number of individuals in a population relative to space.Population Groups: Individuals classified according to their sex, racial origin, religion, common place of living, financial or social status, or some other cultural or behavioral attribute. (UMLS, 2003)BrazilSeasons: Divisions of the year according to some regularly recurrent phenomena usually astronomical or climatic. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Rhodophyta: Plants of the division Rhodophyta, commonly known as red algae, in which the red pigment (PHYCOERYTHRIN) predominates. However, if this pigment is destroyed, the algae can appear purple, brown, green, or yellow. Two important substances found in the cell walls of red algae are AGAR and CARRAGEENAN. Some rhodophyta are notable SEAWEED (macroalgae).Salmo salar: A commercially important species of SALMON in the family SALMONIDAE, order SALMONIFORMES, which occurs in the North Atlantic.Crustacea: A large subphylum of mostly marine ARTHROPODS containing over 42,000 species. They include familiar arthropods such as lobsters (NEPHROPIDAE), crabs (BRACHYURA), shrimp (PENAEIDAE), and barnacles (THORACICA).Perciformes: The most diversified of all fish orders and the largest vertebrate order. It includes many of the commonly known fish such as porgies, croakers, sunfishes, dolphin fish, mackerels, TUNA, etc.RNA, Ribosomal, 18S: Constituent of the 40S subunit of eukaryotic ribosomes. 18S rRNA is involved in the initiation of polypeptide synthesis in eukaryotes.VietnamAedes: A genus of mosquitoes (CULICIDAE) frequently found in tropical and subtropical regions. YELLOW FEVER and DENGUE are two of the diseases that can be transmitted by species of this genus.Dengue: An acute febrile disease transmitted by the bite of AEDES mosquitoes infected with DENGUE VIRUS. It is self-limiting and characterized by fever, myalgia, headache, and rash. SEVERE DENGUE is a more virulent form of dengue.Dengue Virus: A species of the genus FLAVIVIRUS which causes an acute febrile and sometimes hemorrhagic disease in man. Dengue is mosquito-borne and four serotypes are known.Bromelia: A plant genus of the family BROMELIACEAE. Members contain karatasin and balansain (ENDOPEPTIDASES) and BROMELAINS.Hospitals, State: Hospitals controlled by agencies and departments of the state government.Nova Scotia: A province of eastern Canada, one of the Maritime Provinces with NEW BRUNSWICK; PRINCE EDWARD ISLAND; and sometimes NEWFOUNDLAND AND LABRADOR. Its capital is Halifax. The territory was granted in 1621 by James I to the Scotsman Sir William Alexander and was called Nova Scotia, the Latin for New Scotland. The territory had earlier belonged to the French, under the name of Acadia. (From Webster's New Geographical Dictionary, 1988, p871 & Room, Brewer's Dictionary of Names, 1992, p384)Euphausiacea: An order of pelagic, shrimplike CRUSTACEA. Many consume ZOOPLANKTON and a few are predacious. Many antarctic species, such as Euphausia superba, constitute the chief food of other animals.Life Cycle Stages: The continuous sequence of changes undergone by living organisms during the post-embryonic developmental process, such as metamorphosis in insects and amphibians. This includes the developmental stages of apicomplexans such as the malarial parasite, PLASMODIUM FALCIPARUM.Population Dynamics: The pattern of any process, or the interrelationship of phenomena, which affects growth or change within a population.Desulfovibrio gigas: A species of gram-negative, anaerobic, spiral-shaped bacteria originally isolated from a saltwater pond in France. It contains a well-characterized metabolic pathway that enables it to survive transient contacts with OXYGEN.North SeaPhocoena: A genus of PORPOISES, in the family Phocoenidae, comprised of several species. They frequent coastal waters, bays, estuaries, and the mouths of large rivers.Kelp: Large, robust forms of brown algae (PHAEOPHYCEAE) in the order Laminariales. They are a major component of the lower intertidal and sublittoral zones on rocky coasts in temperate and polar waters. Kelp, a kind of SEAWEED, usually refers to species in the genera LAMINARIA or MACROCYSTIS, but the term may also be used for species in FUCUS or Nereocystis.Biomass: Total mass of all the organisms of a given type and/or in a given area. (From Concise Dictionary of Biology, 1990) It includes the yield of vegetative mass produced from any given crop.Synechococcus: A form-genus of spherical to rod-shaped CYANOBACTERIA in the order Chroococcales. They contain THYLAKOIDS and are found in a wide range of habitats.Plankton: Community of tiny aquatic PLANTS and ANIMALS, and photosynthetic BACTERIA, that are either free-floating or suspended in the water, with little or no power of locomotion. They are divided into PHYTOPLANKTON and ZOOPLANKTON.Agkistrodon: A genus of venomous snakes of the subfamily Crotalinae. Twelve species of this genus are found in North and Central America and Asia. Agkistrodon contortrix is the copperhead, A. piscivorus, the cottonmouth. The former is named for its russet or orange-brown color, the latter for the white interior of its mouth. (Goin, Goin, and Zug, Introduction to Herpetology, 3d ed, p336; Moore, Poisonous Snakes of the World, 1980, p75)Dolphins: Mammals of the families Delphinidae (ocean dolphins), Iniidae, Lipotidae, Pontoporiidae, and Platanistidae (all river dolphins). Among the most well-known species are the BOTTLE-NOSED DOLPHIN and the KILLER WHALE (a dolphin). The common name dolphin is applied to small cetaceans having a beaklike snout and a slender, streamlined body, whereas PORPOISES are small cetaceans with a blunt snout and rather stocky body. (From Walker's Mammals of the World, 5th ed, pp978-9)Crotalid Venoms: Venoms from snakes of the subfamily Crotalinae or pit vipers, found mostly in the Americas. They include the rattlesnake, cottonmouth, fer-de-lance, bushmaster, and American copperhead. Their venoms contain nontoxic proteins, cardio-, hemo-, cyto-, and neurotoxins, and many enzymes, especially phospholipases A. Many of the toxins have been characterized.Locomotion: Movement or the ability to move from one place or another. It can refer to humans, vertebrate or invertebrate animals, and microorganisms.Energy Metabolism: The chemical reactions involved in the production and utilization of various forms of energy in cells.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Arthropods: Members of the phylum Arthropoda, composed of organisms having a hard, jointed exoskeleton and paired jointed legs. It includes the class INSECTS and the subclass ARACHNIDA, many species of which are important medically as parasites or as vectors of organisms capable of causing disease in man.Evolution, Molecular: The process of cumulative change at the level of DNA; RNA; and PROTEINS, over successive generations.Access to Information: Individual's rights to obtain and use information collected or generated by others.Urotensins: Teleost hormones. A family of small peptides isolated from urophyses of bony fishes. They have many different physiological effects, including long-lasting hypotensive activity and have been proposed as antihypertensives. There are at least four different compounds: urotensin I, urotensin II, urotensin III, and urotensin IV.Orthodontics: A dental specialty concerned with the prevention and correction of dental and oral anomalies (malocclusion).Dissertations, Academic as Topic: Dissertations embodying results of original research and especially substantiating a specific view, e.g., substantial papers written by candidates for an academic degree under the individual direction of a professor or papers written by undergraduates desirous of achieving honors or distinction.Libraries, Digital: Libraries in which a major proportion of the resources are available in machine-readable format, rather than on paper or MICROFORM.Cestoda: A subclass of segmented worms comprising the tapeworms.Felis: Genus in the family FELIDAE comprised of small felines including the domestic cat, Felis catus (CATS) and its ancestor the wild cat, Felis silvestris.Rodentia: A mammalian order which consists of 29 families and many genera.

Clinical efficacy of teflubenzuron (Calicide) for the treatment of Lepeophtheirus salmonis infestations of farmed Atlantic salmon Salmo salar at low water temperatures. (1/284)

The efficacy of teflubenzuron (Calicide) for the treatment of farmed Atlantic salmon Salmo salar L. infested with sea lice Lepeophtheirus salmonis (Kroyer, 1838), was investigated at low water temperatures in 2 commercial salmon farms. Calicide, coated on commercial feed pellets, was administered orally at 10 mg kg(-1) d(-1) for 7 consecutive days. Fish were randomly sampled and lice numbers recorded from both treated and control groups on 3 or 4 sampling occasions post-medication. Statistically significant reductions in the number of L. salmonis per fish were recorded. Maximum efficacy was observed toward chalimus and preadult stages of L. salmonis, and was achieved approximately 26 d post-medication. No adverse drug reactions or palatability problems were associated with the treatments.  (+info)

Laboratory evaluation of Mesocyclops annulatus (Wierzejski, 1892) (Copepoda: Cyclopidea) as a predator of container-breeding mosquitoes in Argentina. (2/284)

In laboratory bioassays we tested the predatory capacity of the copepod Mesocyclops annulatus on Aedes aegypti and Culex pipiens larvae. A single adult female of M. annulatus caused 51.6% and 52.3% mortality of 50 first instar larvae of Ae. aegypti and Cx. pipiens respectively, in a 72 h test period. When alternative food was added to the containers, mortality rates declined to 16% and 10.3% for Ae. aegypti and Cx. pipiens respectively. When 50 first instar larvae of each of the two mosquito species tested were placed together with a single adult female of M. annulatus, mortality rates were 75.5% for Ae. aegypti larvae and 23.5% for Cx. pipiens larvae in a three day test period. Different density of adult females of M. annulatus ranged from 5 to 25 females produced mortality rates of Ae. aegypti first instar larvae from 50% to 100% respectively. When a single adult female of M. annulatus was exposed to an increasing number of first-instar Ae. aegypti larvae ranging from 10 to 100, 100% mortality was recorded from 1 to 25 larvae, then mortality declined to 30% with 100 larvae. The average larvae killed per 24 h period by a single copepod were 29.  (+info)

Copepod feeding currents: flow patterns, filtration rates and energetics. (3/284)

Particle image velocimetry was used to construct a quasi 3-dimensional image of the flow generated by the feeding appendages of the calanoid copepod Temora longicornis. By scanning layers of flow, detailed information was obtained on flow velocity and velocity gradients. The flow around feeding T. longicornis was laminar, and was symmetrical viewed dorsally, but highly asymmetrical viewed laterally, with high levels of vorticity on the ventral side. The flow rate through the feeding appendages varied between 77 and 220 ml day(-1) per individual. The morphology of the flow field ensured that water was entrained over the full length of the first antennae. These were kept out of areas with high velocity gradients that could interfere with distant mechano- or chemoreception. The volume of influence, i.e. the volume of water around the foraging copepod, where shear rates were significantly higher than background levels, was calculated. Implications for encounter probability and mechanoreception are discussed. The average rate of energy dissipation within the copepod's volume of influence is several times higher than the levels of turbulent energy dissipation these animals are likely to encounter in their environment. Even in highly turbulent environments, adult T. longicornis will not experience very significant effects of turbulence. Within the volume of influence of the copepods the energy dissipation due to viscous friction varied between 6.6 x 10(-11) and 2.3 x 10(-10)W. Taking mechanical efficiency and muscle efficiency into account, this results in a total energetic cost of the feeding current of 1.6 x 10(-9)W per copepod. This value represents only a small percentage of the total energy budget of small calanoid copepods.  (+info)

Escape from viscosity: the kinematics and hydrodynamics of copepod foraging and escape swimming. (4/284)

Feeding and escape swimming in adult females of the calanoid copepod Temora longicornis Muller were investigated and compared. Swimming velocities were calculated using a 3-D filming setup. Foraging velocities ranged between 2 and 6 mm s(-1), while maximum velocities of up to 80 mm s(-1) were reached during escape responses. Foraging took place at Reynolds numbers between 2 and 6, indicating that viscous forces are considerable during this swimming mode. Inertial forces are much more important during escape responses, when Reynolds numbers of more than 100 are reached. High-speed film recordings at 500 frames s(-1) of the motion pattern of the feeding appendages and the escape movement of the swimming legs revealed that the two swimming modes are essentially very different. While foraging, the first three mouth appendages (antennae, mandibular palps and maxillules) create a backwards motion of water with a metachronal beating pattern. During escape movements the mouth appendages stop moving and the swimming legs beat in a very fast metachronal rhythm, accelerating a jet of water backwards. The large antennules are folded backwards, resulting in a streamlined body shape. Particle image velocimetry analysis of the flow around foraging and escaping copepods revealed that during foraging an asymmetrical vortex system is created on the ventral side of the animal. The feeding motion is steady over a long period of time. The rate of energy dissipation due to viscous friction relates directly to the energetic cost of the feeding current. During escape responses a vortex ring appears behind the animal, which dissipates over time. Several seconds after cessation of swimming leg movements, energy dissipation can still be measured. During escape responses the rate of energy dissipation due to viscous friction increases by up to two orders of magnitude compared to the rate when foraging.  (+info)

Spectral sensitivity of vertically migrating marine copepods. (5/284)

Light is a critical factor in the proximate basis of diel vertical migration (DVM) in zooplankton. A photobehavioral approach was used to examine the spectral sensitivity of four coastal species of calanoid copepod, representing a diversity of DVM patterns, to test whether species that migrate (nocturnal or reverse DVM) have response spectra that differ from non-migratory surface dwellers. The following species were given light stimuli at wavelengths from 350 to 740 nm, and their photoresponses were measured: Centropages typicus (nocturnal migrator), Calanopia americana (nocturnal migrator), Anomalocera ornata (reverse migrator), and Labidocera aestiva (non-migrator). Centropages typicus and A. ornata had peak responses at 500 and 520 nm, respectively, while Calanopia americana had maximum responses at 480 and 520 nm. Thus, the species that undergo DVM have peak photobehavioral responses at wavelengths corresponding to those available during twilight in coastal water, although the range of wavelengths to which they respond is variable. Non-migratory surface-dwelling L. aestiva had numerous response peaks over a broad spectral range, which may serve to maximize photon capture for vision in their broad-spectrum shallow-water habitat.  (+info)

Longitudinal processes in Salto Grande Reservoir (Americana, SP, Brazil) and its influence in the formation of compartment system. (6/284)

Studies on the longitudinal processes in reservoirs, involving physical, chemical and biological processes have been thoroughly appraised, suggesting the existence of a longitudinal organization controlled by the entrance and circulation of water which inserts modifications in the structuring of the system. To evaluate this effect, the Salto Grande reservoir (Americana, SP) was analyzed in 11 sampling stations in its longitudinal axis, in the rainy and dry seasons of 1997 considering the physical chemical and biological variables. Analyzing the results in agreement with the declining concentration degree of the river-barrage direction, a more significant correlation was verified in the dry period for total phosphorus (r2 = 0.86), dissolved total phosphate (r2 = 0.83), nitrite (r2 = 0.93), inorganic phosphate (r2 = 0.89), ammonium (r2 = 0.84) and suspended material (r2 = 0.85). In the rainy period, only nitrite (r2 = 0.90) and conductivity (r2 = 0.89) presented correlation with the distance of the dam, which demonstrates the effects of precipitation and the operational mechanism of the dam, as well as the distinction among the physical (sedimentation), chemical (oxidation) and biological (decomposition) processes in spatial heterogeneity of the system. These factors were decisive in the organization of these communities, with higher occurrence of rotifers and copepods in relation to cladocerans, the first ones being more abundant in the entrance of the Atibaia river, decreasing towards the dam direction, while copepods presented an inverse pattern. A distribution pattern similar to Copepoda was also verified for the Cladocera, evidencing a tendency to increase the density of organisms in the stations distant to the entrance of the Atibaia river, not being registered, however, a distribution gradient in the longitudinal axis, as observed for rotifers and copepods. In relation to the trophic degree a longitudinal gradient was also verified from eutrophic to oligotrophic depending on the location of the sampling station in relation to the longitudinal axis and period of analysis. The differences obtained, relating to the distribution of the environmental variables, demonstrate a characteristic pattern for reservoirs, with a longitudinal gradient in the sense river-barrage that inserts changes in the physical and chemical composition of the water, contributing to the differentiated establishing of biological communities.  (+info)

Susceptibility of rainbow trout Oncorhynchus mykiss, Atlantic salmon Salmo salar and coho salmon Oncorhynchus kisutch to experimental infection with sea lice Lepeophtheirus salmonis. (7/284)

Physiological, immunological and biochemical parameters of blood and mucus, as well as skin histology, were compared in 3 salmonid species (rainbow trout Oncorhynchus mykiss, Atlantic salmon Salmo salar and coho salmon O. kisutch) following experimental infection with sea lice Lepeophtheirus salmonis. The 3 salmonid species were cohabited in order to standardize initial infection conditions. Lice density was significantly reduced on coho salmon within 7 to 14 d, while lice persisted in higher numbers on rainbow trout and Atlantic salmon. Lice matured more slowly on coho salmon than on the other 2 species, and maturation was slightly slower on rainbow trout than on Atlantic salmon. Head kidney macrophages from infected Atlantic salmon had diminished respiratory burst and phagocytic capacity at 14 and 21 d post-infection (dpi), while infected rainbow trout macrophages had reduced respiratory burst and phagocytic capacities at 21 dpi, compared to controls. The slower development of lice, coupled with delayed suppression of immune parameters, suggests that rainbow trout are slightly more resistant to lice than Atlantic salmon. Infected rainbow trout and Atlantic salmon showed increases in mucus lysozyme activities at 1 dpi, which decreased over the rest of the study. Mucus lysozyme activities of infected rainbow trout, however, remained higher than controls over the entire period. Coho salmon lysozyme activities did not increase in infected fish until 21 dpi. Mucus alkaline phosphatase levels were also higher in infected Atlantic salmon compared to controls at 3 and 21 dpi. Low molecular weight (LMW) proteases increased in infected rainbow trout and Atlantic salmon between 14 and 21 dpi. Histological analysis of the outer epithelium revealed mucus cell hypertrophy in rainbow trout and Atlantic salmon following infection. Plasma cortisol, glucose, electrolyte and protein concentrations and hematocrit all remained within physiological limits for each species, with no differences occurring between infected and control fish. Our results demonstrate that significant differences in mucus biochemistry and numbers of L. salmonis occur between these species.  (+info)

Insights into fish host-parasite trophic relationships revealed by stable isotope analysis. (8/284)

Trophic relationships between 10 species of fish host and their associated nematode, cestode, and copepod parasites were investigated using stable isotopes of carbon and nitrogen. Nematodes and cestodes were consistently depleted in 15N with respect to their host, and such fractionation patterns are unlike those conventionally observed between consumers and their diets. Species of copepod parasite were sometimes depleted and sometimes enriched in 15N with respect to fish hosts, and this confirms earlier reports that the nature and magnitude of ectoparasite-host fractionations can vary. Significant differences in delta15N and delta13C were observed among fish tissues, and the isotopic signature of parasites did not always closely correspond to that of the tissue with which the parasite was found most closely associated, or on which the parasite was thought to be feeding. Several possible explanations are considered for such discrepancies, including selective feeding on specific amino acids or lipids, migration of the parasite among different fish tissues, changes in the metabolism of the parasite associated with life history and migration between different host animals.  (+info)

*Otto Schmeil

Copepoda. I. Gymnoplea, Berlin 1898 (with Wilhelm Giesbrecht) - The animal kingdom. Copepoda. I. Gymnoplea. Flora von ...

*Boeckella palustris

Crustacea: Copepoda". Transactions of the Linnean Society of London. 3rd series. 1 (3): 219-247. doi:10.1111/j.1096-3642.1955. ... Ian A. E. Bayly (1992). "Fusion of the genera Boeckella and Pseudoboeckella (Copepoda) and revision of their species from South ... "Boeckella palustris (Harding, 1955)". World Copepoda database. World Register of Marine Species. Retrieved June 11, 2011. ... Copepoda: Centropagidae): a track analysis". Journal of Crustacean Biology. 20 (2): 262-272. doi:10.1651/0278-0372(2000)020[ ...

*Lernaeopodidae

"Copepoda: copepods". In Klaus Rohde. Marine Parasitology. CSIRO Publishing. pp. 121-133. ISBN 978-0-643-09927-2. Geoff Boxshall ...

*Artotrogidae

A monograph of the free and semi-parasitic Copepoda of the British Islands. GS Brady - 1880 Boxshall, G. (2001). Copepoda (excl ...

*Hamaticolax unisagittatus

Luiz E. R. Tavares & José L. Luque (2003). "A New Species of Acantholochus (Copepoda: Bomolochidae) Parasitic on Centropomus ... "Hamaticolax unisagittatus (Tavares & Luque, 2003)". World Copepoda database. World Register of Marine Species. Retrieved ...

*Paradiaptomus

"Paradiaptomus Daday, 1910". World Copepoda database. World Register of Marine Species. Retrieved May 16, 2010. ...

*Lernaeocera branchialis

J. B. Jones (1998). "Distant water sailors: parasitic Copepoda of the open ocean". Journal of Marine Systems. 15: 207-214. doi: ... ISBN 978-0-313-33922-6. Z. Kabata (1979). Parasitic Copepoda of British Fishes. London: Ray Society. ISBN 978-0-903874-05-2. ... "Lernaeocera branchialis (Linnaeus, 1767)". World Copepoda database. World Register of Marine Species. Retrieved March 11, 2011 ... Copepoda : Pennellidae) (PDF) (PhD thesis). University of Stirling. [permanent dead link] Bernard E. Matthews (1998). "From ...

*Mesocyclops

"Mesocyclops Sars G.O., 1914". World Copepoda database. World Register of Marine Species. Retrieved March 8, 2010. ... January 2005). "Elimination of dengue by community programs using Mesocyclops (Copepoda) against Aedes aegypti in central ...

*Metadiaptomus

"Metadiaptomus Methuen, 1910". World Copepoda database. World Register of Marine Species. Retrieved October 3, 2010. ...

*Notodiaptomus

"Notodiaptomus Kiefer, 1936". World Copepoda database. World Register of Marine Species. Retrieved November 25, 2010. J. W. Reid ...

*List of diseases and parasites in cod

copepodite Copepoda fam. gen. sp. copepodite Copepoda - adults Acanthochondria soleae Caligus curtus Caligus diaphanus Caligus ... adults Calliobdella nodulifera Johanssonia arctica Copepoda - larval forms Caligus sp. ...

*Mastigodiaptomus

"Mastigodiaptomus Light, 1939". World Copepoda database. World Register of Marine Species. Retrieved April 14, 2010. J. W. Reid ... Copepoda, Diaptomidae) from southeastern Mexico, with a key for the identification of the known species of the genus" (PDF). ...

*Leptocaris

Copepoda: Harpacticoida: Darcythompsoniidae)". Journal of the Marine Biological Association of the United Kingdom (in press): 1 ... "Leptocaris Scott T., 1899". World Copepoda database. World Register of Marine Species. Retrieved April 14, 2010. Sung Joon Song ...

*Pontella

"Pontella Dana, 1846". World Copepoda database. World Register of Marine Species. Retrieved February 10, 2011. ...

*Tropodiaptomus

"Tropodiaptomus Kiefer, 1932". World Copepoda database. World Register of Marine Species. Retrieved May 16, 2010. Reid, J.W. ( ...

*Calocalanus pavo

J. Kouwenberg & G. Boxshall (2009). "Calocalanus pavo (Dana, 1852)". World Copepoda database. Retrieved March 3, 2009. Accessed ...

*Acartia simplex

"Acartia (Acartiura) simplex Sars G.O., 1905". World Copepoda database. World Register of Marine Species. Retrieved July 22, ... Janet Bradford (1976). "Partial Revision of the Acartia Subgenus Acartiura (Copepoda: Calanoida: Acartiidae)". New Zealand ...

*Tantulocarida

"Basipodellidae". World Copepoda database. World Register of Marine Species. Retrieved 2016-09-10. Geoff Boxshall (August 20, ... "Microdajidae". World Copepoda database. World Register of Marine Species. Retrieved 2016-09-10. Geoff Boxshall (2012). Walter ... "Doryphallophoridae". World Copepoda database. World Register of Marine Species. Retrieved 2016-09-10. Geoff Boxshall (August 20 ...

*Oncaea venusta

"Oncaea venusta Philippi, 1843". World Copepoda database. World Register of Marine Species. Retrieved June 24, 2011. William S. ...

*Metacyclops

"Metacyclops Kiefer, 1927". World Copepoda database. World Register of Marine Species. Retrieved October 12, 2010. B. Sket (1996 ...

*Sapphirinidae

"Sapphirinidae". World Copepoda database. World Register of Marine Species. Retrieved October 28, 2010. ...

*Ommatokoita

"Ommatokoita Leigh-Sharpe, 1926". World Copepoda database. World Register of Marine Species. Retrieved March 8, 2010. ...

*Argulus foliaceus

2013). Argulus foliaceus (Linnaeus, 1758). World Copepoda Database. Accessed through World Register of Marine Species 28 August ...

*Cyclops (genus)

"Cyclops Müller, 1785". World Copepoda database. G. G. Marten (1986). "Issues in the development of Cyclops for mosquito control ...

*Oncaea

"Oncaea Philippi, 1843". World Copepoda database. World Register of Marine Species. Retrieved February 24, 2011. ...
Hildebrandt, Nicole; Niehoff, Barbara; Sartoris, Franz-Josef (2014): Performance of the Arctic calanoid copepods Calanus glacialis and C. hyperboreus under elevated pCO2 and temperatures. PANGAEA, https://doi.org/10.1594/PANGAEA.834091, Supplement to: Hildebrandt, N et al. (2014): Long-term effects of elevated CO2 and temperature on the Arctic calanoid copepods Calanus glacialis and C. hyperboreus. Marine Pollution Bulletin, 80(1-2), 59-70, https://doi.org/10.1016/j.marpolbul.2014.01.050
The light intensity and spectral sensitivities of the calanoid copepod Acartia tonsa Dana were determined by measuring phototactic responses. Adult females
Kattner, G. and Krause, M. (1987): Changes in lipids during the development of Calanus finmarchicus s.l. from copepodid I to adult. , Marine Biology ...
Scanning electron micrograph (SEM) of Marine calanoid copepod (Euchaeta sp.). Euchaeta is a genus of the calanoid copepods in the family Euchaetidae (order Calanoida). Calanoida is an order of copepods that can live in both marine and freshwater. Calanoid copepods are dominant in the plankton in many parts of the worlds oceans (55%-95% of plankton). They are very important in the aquatic food chain. Commercial fish are dependent on calanoid copepods (larval or adult forms). Magnification x7 when shortest axis printed at 25 millimetres. - Stock Image C037/0487
Ohman, M. D. and Hirche, H. J. (2001): Density-dependent egg mortality in Calanus finmarchicus , ICES/GLOBEC Newsletter,8, December ...
We present an accurate, fast, simple and non-destructive photographic method to estimate wax ester and lipid content in single individuals of the calanoid copepod genus Calanus and test this method against gas-chromatographic lipid measurements ...
Marine calanoid copepod Acartia tonsa of known age are placed into test vessels containing a series of concentrations of the test material in water for 48 hours. The animals are observed after 24 and 48 hours and the number of mortalities in each vessel are recorded. EC50 values, NOECs and LOECs are estimated.. ...
ABSTRACT The diploid chromosome number 2n = 24 has been established in the harpacticoid copepod Tigriopus sp. coming from Kerguelen Island, while the population of Tigriopus inhabiting Crozet Island possesses the diploid number 2n = 22. The two populations differ also in homogeneity of the karyotype, thereby further supporting the hypothesis that these two populations belong to different species.
Walter, T. Chad (2013). Tigriopus fulvus adriatica Douwe, 1913. In: Walter, T.C. & Boxshall, G. (2017). World of Copepods database. Accessed at http://www.marinespecies.org/copepoda/aphia.php?p=taxdetails&id=363760 on 2017-12- ...
original description Chullasorn S., H.U. Dahms & P. Klangsina. (2013). A new species of Tigriopus (Copepoda: Harpacticoida: Harpacticidae) from Thailand with a key to the species of the genus. Journal of Natural History 47(5-12):427-447. , available online at https://doi.org/10.1080/00222933.2012.757660 [details] Available for editors ...
The oil exploration and search for new oil production fields is expanding further north and has reached the Arctic. Oil drilling activities release large amounts of produced water (PW) to the marine environment and sub-lethal effects on biota cannot be excluded. The polycyclic aromatic hydrocarbons (PAHs) present in PW have previously been shown to exhibit negative effects on growth, development and survival of aquatic organisms. The Arctic copepod Calanus glacialis is an abundant zooplankton species and holds a key position in the energy transfer from primary production to higher trophic levels. C. glacialis accumulates large volumes of lipids during late developmental stages which makes it prone to the uptake of lipophilic oil components. This study assesses the potential impact of PW-related PAHs on the metabolism of C. glacialis. In a semi-static setup, stage V C. glacialis copepodites from Kongsfjorden, Svalbard were exposed to the water soluble fraction of 11 selected PAHs (ΣPAH 7,90 µg ...
The salmon louse (Lepeophtheirus salmonis) is an ectoparasitic copepod feeding on skin, mucous and blood from salmonid hosts. Recently it was shown that L. salmonis infections in farmed fish induce epizootics in wild fish [1,2]. The life cycle of L.salmonis consists of 8 developmental stages separated by ecdysis [3,4] and after the final molt, females develop into mature adults that continuously produce eggs for life. The first free-living larvae (naupli I) hatch directly from egg-strings attached to adult females and all three larval stages (naupli I, naupli II and the infectious copepidid stage) can be transported by the ocean currents over large distances depending on hydrographical conditions [5]. After host settlement the infectious copepodids stage molt into chalimus. The two chalimus stages, all separated by molting, are anchored to the host by a frontal filament [6], which restricts the feeding area. However, in the succeeding pre-ad I and -II and adult stages the salmon louse can move ...
대전광역시 유성구 대학로 245 한국과학기술정보연구원TEL : 042.869.1234 서울시 동대문구 회기로 66NDSL고객센터 : 080.969.4114E-mail : [email protected] 대표자 : 한선화사업자등록번호 : 205-82-04043 ...
ABSTRACT: Fine-scale water column structure was mimicked in a laboratory plane jet flume to examine responses of the calanoid copepods Temora longicornis and Acartia tonsa to layers consisting of a velocity gradient, density gradient, phytoplankton exudates and food (phytoplankton). Copepods were exposed to isolated layers and combinations of cues as defined by in situ conditions. Behaviors elicited by the velocity gradient and chemical exudate layers included increased swimming speed and turn frequency consistent with excited area-restricted search behavior, which led to increased proportional residence time in the layers. Both species had significant responses to isolated layers of velocity gradients and chemical exudates, with T. longicornis responding more intensely to chemical cues than velocity gradients and A. tonsa responding equally to both. Combined fluid mechanical and chemical cues elicited species-specific responses. For T. longicornis, chemical presence induced responses that ...
Thermo Scientific™ Gaussia Luciferase Reporter Assay Vectors pMCS-Gaussia Luc Vector Thermo Scientific™ Gaussia Luciferase Reporter Assay Vectors...
Use the simple Search box at the top of the page or the Advanced Search linked from the top of the page to find book and journal content. Refine results with the filtering options on the left side of the Advanced Search page or on your search results page. Click the Browse box to see a selection of books and journals by: Research Area, Titles A-Z, Publisher, Books only, or Journals only.. ...
ABSTRACT: During mid-May-early June 1997 observations of hydrography, phytoplankton and nitrate concentrations, and abundance and stage distribution of Calanus finmarchicus populations were made in the Labrador Sea and south of Greenland. Egg production rates were also measured for isolated C. finmarchicus females. Surface nitrate and integrated phytoplankton concentrations indicated that, in the deep water, the phytoplankton bloom had ended in the north and east, was in progress in the north central Labrador Sea and near the basin margins, and had not yet become established in an area stretching from the central Labrador Sea to the south of Greenland. C. finmarchicus egg production rates and stage distributions at stations in the 3 areas designated as early, mid- and late/post-bloom zones, suggested that development rates of the overwintered G0 generation into mature adults (females and males) were probably low before the bloom, but accelerated during its development. Individual and areal rates ...
We developed a Gaussia luciferase (Gluc) reporter replicon of West Nile virus (WNV) and used it to quantify viral translation and RNA replication. The advantage of the Gluc replicon is that Gaussia luciferase is secreted into the culture medium from cells transfected with Gluc replicon RNA, and the medium can be assayed directly for luciferase activity. Using a known Flavivirus inhibitor (NITD008), we demonstrated that the Gluc-WNV replicon could be used for antiviral screening. The Gluc-WNV-Rep will be useful for research in antiviral drug development programs, as well as for studying viral replication and pathogenesis of WNV.
Phytoplankton color index from the Continuous Plankton Recorder transect across the Gulf of Maine is shown in the top panel. The decrease in spring chlorophyll concentration observed from satellites is also evident in the in situ data. Extremely low color indices were observed in the 1960s and early 1970s. There was then a rapid increase until about 1985 when a gradual decrease started. The decrease in color index seemed to accelerate in 2000 and low levels have been observed since. Abundances of two species of copepods from the Gulf of Maine Continuous Plankton Recorder transect are shown. Adult Calanus finmarchicus, which is a key indicator species for ecosystem status in the Gulf of Maine, has recently increases after a period of lower values in the 1990s. Smaller zooplankton, as exemplified by Oithona, have decreased after a period of higher values in the 1990s. These changes are indicators of shifts in community structure from larger bodied copepods, including Calanus in the 1980s, to ...
However, the actual feeding mechanisms employed by different zooplankters exert an overriding primary control that of food particle acquisition. It is in this context that we primarily attribute Ceratiums influence on zooplankton composition favouring Bosmina and calanoid copepods, while inhibiting Daphnia and Moina (as explained below).. Bosmina has been characterised as an undergrowth taxon able to find and feed on diffuse small food particles (including bacteria) in a nutritional environment overwhelmed by large, mostly inedible particles (Sommer et al., 1986). Similarly, the raptorial feeding mechanism of calanoid (and cyclopoid) copepods allows them to very selectively locate scarce suitable food particles (Koehl and Strickler, 1981; Strickler, 1984; Vanderploeg and Paffenhofer, 1985; Paffenhofer and Lewis, 1990; Brandl, 1998). Conversely, Daphnia employs non-selective bulk filtration, a mode of food collection that greatly compromises it when suspended particles are predominantly ...
The present study provides the first phylogenomic evidence to support the monophyletic origin of four major orders of copepods and the group of podopleans. The monophyletic status of Copepoda has been broadly accepted by both morphological [5, 14] and large-scale phylogenomic analyses [28-30]. Although this study does not include all copepod orders, there can be no doubt of the monophyly of copepods. The subclass Copepoda consists of two infraclasses, Progymnoplea and Neocopepoda, suggested by Huys and Boxshall [5]. The infraclass Neocopepoda can be further divided into two superorder groups, Gymnoplea and Podoplea (Fig. 1). The concept of this classification was proposed by Giesbrecht [67] and became generally accepted [5, 12, 68]. However, the naupliar musculature and the molecular phylogeny using partial nuclear 28S rRNA gene (a total aligned sequence length of 484 bp from the D9/D10 region) (Fig. 2A) showed conflicting results and suggested a possible paraphyletic origin of podopleans [15, ...
JARAMILLO, R et al. Polysiphonia spp as epibiont of Caligus rogercresseyi (Crustacea: Copepoda) in Salmo salar farming centers. Arch. med. vet. [online]. 2016, vol.48, n.3, pp.321-324. ISSN 0301-732X. http://dx.doi.org/10.4067/S0301-732X2016000300013.. The association between Polysiphonia spp and ovigerous females of Caligus rogercresseyi is analysed. Females carrying egg sacs exhibited individuals of Polysiphonia spp externally attached to the cuticle of both dorsal cephalothorax and abdomen by a mounting disk without penetrating the tissues.. Palavras-chave : Polysiphonia; epibiont; Caligus; Salmo. ...
Wold, Anette; Darnis, Gerald; Søreide, Janne E; Leu, Eva; Philippe, Benoit; Fortier, Louis; Poulin, Michel; Kattner, Gerhard; Graeve, Martin; Falk-Petersen, Stig (2011): Diatom abundance and fatty acid composition of ice algae and of Calanus glacialis in samples obtained in 2008 in the eastern Beaufort Sea. PANGAEA, https://doi.org/10.1594/PANGAEA.817986, Supplement to: Wold, A et al. (2011): Life strategy and diet of Calanus glacialis during the winter-spring transition in Amundsen Gulf, south-eastern Beaufort Sea. Polar Biology, 34(12), 1929-1946, https://doi.org/10.1007/s00300-011-1062-6
1. Sodium uptake and loss rates are given for three gammarids acclimatized to media ranging from fresh water to undiluted sea water.. 2. In Gammarus zaddachi and G. tigrinus the sodium transporting system at the body surface is half-saturated at an external concentration of about 1 mM/l. and fully saturated at about 10 mM/l. sodium. In Marinogammarus finmarchicus the respective concentrations are six to ten times higher.. 3. M. finmarchicus is more permeable to water and salts than G. zaddachi and G. tigrinus. Estimated urine flow rates were equivalent to 6.5% body weight/hr./ osmole gradient at 10°C. in M. finmarchicus and 2.8% body weight/hr./osmole gradient in G. zaddachi. The permeability of the body surface to outward diffusion of sodium was four times higher in M. finmarchicus, but sodium losses across the body surface represent at least 50% of the total losses in both M. finmarchicus and G. zaddachi.. 4. Calculations suggest that G. zaddachi produces urine slightly hypotonic to the blood ...
Assessing the impact of global warming on the food web of the North Atlantic will require difficult-to-obtain physiological data on a key copepod crustacean, Calanus finmarchicus. The de novo transcriptome presented here represents a new resource for acquiring such data. It was produced from multiplexed gene libraries using RNA collected from six developmental stages: embryo, early nauplius (NI-II), late nauplius (NV-VI), early copepodite (CI-II), late copepodite (CV) and adult (CVI) female. Over 400,000,000 paired-end reads (100 base-pairs long) were sequenced on an Illumina instrument, and assembled into 206,041 contigs using Trinity software. Coverage was estimated to be at least 65%. A reference transcriptome comprising 96,090 unique components (
The copepod, Calanus finmarchicus is a keystone species for the North Atlantic. Because of recent changes in the geographic distribution of this species, there are questions as to how this organism ...
Abstract Copepodite stages V and females of four dominant Antarctic species of calanoid copepods were collected during various expeditions to the eastern Weddell Sea in mid-winter, late winter to early spring, summer and autumn. Analyses of total lipid content and sexual maturity showed some genera...
Startle responses in zooplankton and other organisms attempting to escape a predator are likely to be executed with the maximum muscular force and power output that the organism can produce. We have estimated these parameters from observed velocity variation during the course of copepod escape jumps by means of direct numerical simulations. Our method represents an advance over previous attempts (Vlymen 1970; Fields 2000) since we solve the Navier-Stokes equation directly and thus include the so-called history term. Our approach, however, ignores the motion of the swimming legs and the estimated parameters are, thus, preliminary and, presumably, conservative. We nevertheless have confidence in our estimates, because the estimate of forces compare well with-but are slightly smaller than-those measured experimentally in similar-sized copepods tethered to a force transducer (Lenz & Hartline 1999; Lenz et al. 2004) or a spring (Alcaraz & Strickler 1988). Specifically, the observations of Lenz et al. ...
Gaussia Luciferase (GLuc) reporter gene offers bright bioluminescence, either as a standalone expression monitor or as a fusion partner with other protein.
Calanus hyperboreus is a copepod found in the Arctic, and not further south than the Bering Strait in the Pacific and the Lofoten Islands in the Atlantic. It occurs up to a depth of 5,000 metres (16,000 ft). Mature females more often inhabit shallower waters. The size of C. hyperboreus varies with its geography; individuals located in more temperate waters usually range from just over 4 to 5.5 millimetres (0.16 to 0.22 in) in more temperate waters, whereas those in colder areas usually range from 6 to 7 millimetres (0.24 to 0.28 in). The length of its prosome can vary anywhere from 2.5 to 5.6 millimetres (0.098 to 0.220 in). The antennae are longer or of equal length to the body. This copepod is very clear, and is generally colourless. The gut walls and posterior may be orange to dark red in colour, with a prominent lipid sac that is usually red-orange. The borders between segments have a deep red pigment. This copepod spawns between October and March (winter), using lipid-reserves to fuel ...
Through their physiological processes, mesozooplankton can contribute significantly to the marine biogeochemical cycling of carbon and nitrogen. However some of these processes have been poorly parameterised in ecosystem models. Respiration in particular has been measured in terms of basal respiration which is related to temperature but independent of other metabolic activities such as feeding. This project will investigate the response of copepod physiology to food quality and temperature. A range of food quality (phytoplankton N:P ratio) will be achieved through sampling a latitudinal transect in the Atlantic Ocean (Atlantic Meridional Transect cruise, October 2010), a coastal time series station 20 km south of Plymouth, UK (spring, summer, autumn, winter sampling 2010-2011), and maintaining continuous cultures of selected species of phytoplankton under N and P limitation. Copepod (Calanus spp. and Oithona spp.) feeding rate, egg production, excretion and respiration rate will be determined across
xml version=1.0 encoding=UTF-8?,,EVENT,,EVENTLOG,,PORTALID,brill,/PORTALID,,SESSIONID,i3s5zl3hQ2JkFu9Er4OY24wq.x-brill-live-03,/SESSIONID,,USERAGENT,CCBot/2.0 (http://commoncrawl.org/faq/),/USERAGENT,,IDENTITYID,guest,/IDENTITYID,,IDENTITY_LIST,guest,/IDENTITY_LIST,,IPADDRESS,54.227.126.69,/IPADDRESS,,EVENTTYPE,PERSONALISATION,/EVENTTYPE,,CREATEDON,1512951278392,/CREATEDON,,/EVENTLOG,,EVENTLOGPROPERTY,,ITEM_ID,http://brill.metastore.ingenta.com/content/journals/10.1163/156854070x00149,/ITEM_ID,,TYPE,favourite,/TYPE,,/EVENTLOGPROPERTY,,/EVENT ...
Anthropic mechanisms : Transport in ships ballast, Opening of the Suez Canal, Indirect introduction - Diversity and Geographic Distribution of Pelagic Copepoda
Hybrid breakdown is a pattern of postzygotic isolation that occurs during the early stages of allopatric divergence, and it is characterized by markedly reduced fitness in F2 and later generation hybrids [1]. Hybrid breakdown has been observed in a wide array of phenotypes, including fecundity [2], sperm swimming speed [3], offspring viability [4,5], growth rate [6] and stress response [7]. The genes involved in the early stages of reproductive isolation are likely to be found in the cellular and biochemical pathways underlying these phenotypes.. Hybrid breakdown is often explained by the Dobzhansky-Muller (DM) model; evolution results in coadaptation among interacting sets of alleles within diverging isolated populations, but incompatibilities are revealed in recombinant F2 genomes of interpopulation hybrids [8,9]. Although most investigations of DM incompatibilities have focused on interactions among nuclear genes [10], epistasis between nuclear and mitochondrial genomes may be particularly ...
The April-June report shows that sea lice numbers have generally remained low and that some improvements in numbers can be seen when comparing with the January-March 2014 report.. However, the Loch Long and Croe region, which is home to three active farms, has seen an increase in lice numbers from average numbers of 1.74 in April to 7.10 in June and Skye and Small Isles North region an increase from 2.33 to 7.95 over the same period.. In general, across all regions, sea lice numbers increased slightly from April to June 2014. Concerned over the effect of sea lice on wild salmon, the Scottish Salmon and Trout Association (SS&TA) stated that some farms are breaching industry sea-lice standards which may threaten the survival of migrating young wild salmon and sea-trout.. Looking specifically at the Special Area for Conservation on the Little Gruinard River in the Wester Ross region, Guy Linley-Adams, Solicitor to the SS&TA Aquaculture Campaign, said that sea lice have been over the threshold and ...
The half-life of GLuc remains unclear. All GLuc-expressing vectors available for mammalian expression at NEB harbor the humanized codons for GLuc in which the secreted GLuc has activity similar to that of the native protein. Once GLuc is secreted into the culture medium, it is very stable. For example, ~20% of the GLuc activity was detectable after incubating a GLuc-containing sample at 99˚C for 15 minutes ...
Barange M, Fernandes JA, Kay S, Hossain MAR, Ahmed M, Lauria V. 2018. Marine Ecosystems and Fisheries: Trends and Prospects. In: Nicholls, RJ; Hutton, CW; Adger, WN; Hanson, SE; Rahman, MM; Salehin, M, (eds.) Ecosystem Services for Well-Being in Deltas. Cham, Springer International Publishing, 469-488, 20pp. Ciavatta S, Brewin RJW, Skákala J, Polimene L, Artioli Y, Allen JI, de Mora L. 2018. Assimilation of ocean-colour plankton functional types to improve marine ecosystem simulations. Journal of Geophysical Research-Oceans. doi.org/10.1002/2017JC013490 Cornwell L, Findlay HS, Fileman ES, Smyth TJ, Hirst AG, Bruun JT, McEvoy AJ, Widdicombe CE, Castellani C, Lewis C, Atkinson A. 2018. Seasonality of Oithona similis and Calanus helgolandicus reproduction and abundance: contrasting responses to environmental variation at a shelf site. Journal of Plankton Research, 40 (3). 295-310. doi.org/10.1093/plankt/fby007 de Mora L, Yool A, Palmieri J, Sellar A, Kuhlbrodt T, Popova E, Jones C, and Allen JI. ...
The pCMV-GLuc 2 Control Plasmid is a mammalian expression vector that encodes the secreted luciferase from the copepod Gaussia princeps as a reporter, under the control of the constitutive CMV (cytomegalovirus) promoter. Gaussia luciferase (GLuc) is a 19 kDa protein encoded by a humanized sequence, and it contains a native signal peptide at the N-terminus that allows it to be secreted from mammalian cells into the cell culture medium. A neomycin resistance gene under the control of an SV40 promoter allows selection for stable integration of the plasmid into the mammalian cell genome using G418.
A new species of parasitic copepod, Caligus fajerae n. sp. (Caligidae), is described from Scomberomorus sierra Jordan & Starks (Scombridae) caught off the northwestern coast of Mexico. The new species morphologically resembles Caligus cybii Bassett-Smith, 1898, Caligus kanagurta Pillai, 1961, Caligus pelamydis Krøyer, 1863 and Caligus robustus Bassett-Smith, 1898, all of which have been reported from scombrid hosts. Caligus fajerae n. sp. differs from these species by having spinules on the abdomen and caudal ramus, two processes on the proximal antennulary segment, fine striations on the claw of the antenna and maxilliped, a stouter and more recurved maxillulary dentiform process, shorter tines on the sternal furca, two additional patches of spinules on the distal endopodal segment of leg 2, a sclerotised lobe on the anteromedian surface of the leg 3 protopod and serrations on both margins of the first exopodal spine of leg 3 ...
Trends in the dynamics of respiration rate and the efficiency of swimming in dependence on mechanical energy of locomotion were analyzed in six species of Black...
O rasprostranenii Tracheliastes maculatus Kollar 1836 (Copepoda Parasitica) v vodokhranilishchak Kharkovskoi oblasti i morfologii samki etogo vida. On the distribution of Tracheliastes maculatus Kollar, 1836 (Copepoda, Parasitica) in the reservoirs of the Kharkov province and the morphology of the female of this species ...
The attractiveness of secreted luciferases as reporters is a strong stimulus for the investigation and exploitation of new bioluminescent systems. Metridia longa is a small luminous marine copepod (Fig. 3D). The bioluminescence originates as a secretion from epidermal glands located in the head part and abdomen in response to mechanical, electrical, or chemical stimuli. Bioluminescence in Metridia longa may well serve as a defense mechanism against predators; the release of a luminous bolus from the animal is accompanied by rapid swimming that displaces the copepod away from its "glowing phantom". This luciferase emits light at a peak of 480 nm with a broad emission spectrum extending to 600 nm. Gaussia luciferase has been cloned, overexpressed in bacteria, and used as a sensitive analytical reporter for hybridization assays and monitoring of cellular expression in culture and in vivo (Tannous et al. 2005). 7 Coelenterazine Dependent Luciferases 9 Fig. 3 Origins of Glow-light reporter genes used ...
Every night across the worlds oceans, numerous marine animals arrive at the surface of the ocean to feed on plankton after an upward migration of hundreds of metres. Just before sunrise, this migration is reversed and the animals return to their daytime residence in the dark mesopelagic zone (at a depth of 200-1,000 m). This daily excursion, referred to as diel vertical migration (DVM), is thought of primarily as an adaptation to avoid visual predators in the sunlit surface layer1,2 and was first recorded using ship-net hauls nearly 200 years ago3. Nowadays, DVMs are routinely recorded by ship-mounted acoustic systems (for example, acoustic Doppler current profilers). These data show that night-time arrival and departure times are highly conserved across ocean regions4 and that daytime descent depths increase with water clarity4,5, indicating that animals have faster swimming speeds in clearer waters4. However, after decades of acoustic measurements, vast ocean areas remain unsampled and places for
Every night across the worlds oceans, numerous marine animals arrive at the surface of the ocean to feed on plankton after an upward migration of hundreds of metres. Just before sunrise, this migration is reversed and the animals return to their daytime residence in the dark mesopelagic zone (at a depth of 200-1,000 m). This daily excursion, referred to as diel vertical migration (DVM), is thought of primarily as an adaptation to avoid visual predators in the sunlit surface layer1,2 and was first recorded using ship-net hauls nearly 200 years ago3. Nowadays, DVMs are routinely recorded by ship-mounted acoustic systems (for example, acoustic Doppler current profilers). These data show that night-time arrival and departure times are highly conserved across ocean regions4 and that daytime descent depths increase with water clarity4,5, indicating that animals have faster swimming speeds in clearer waters4. However, after decades of acoustic measurements, vast ocean areas remain unsampled and places for
To our knowledge, this is the first study that demonstrates NCEs extending multiple generations in a complex community involving many (i.e. ,5) competing species and multiple trophic levels. The presence of fish, caged to ensure no consumptive effects, had profound effects on both dominant zooplankton groups (copepods and cladocerans), with, for example, a striking reversal of dominance in copepod taxa by the fish NCE reducing the calanoid/cyclopoid ratio from 6.3 to 0.43. A large body of literature has shown that presence of predators has effects on fitness correlates of species, such as individual growth rate and survivorship, and some recent studies have shown population level effects of NCEs in controlled laboratory settings with a few species [30,31]. Further, in a multiple year experiment in which the density of a consumer was manipulated experimentally each generation, Schmitz [32] found strong effects of spider-induced changes in grasshopper behaviour on plant composition and ecosystem ...
The consequences of high (735 copepodids fish-1) and low (243 copepodids fish-1) level exposures of size-matched juvenile pink and chum salmon to ...
OPUS (Open Publications of UTS Scholars) is the UTS institutional repository. It showcases the research of UTS staff and postgraduate students to a global audience. For you, as a researcher, OPUS increases the visibility and accessibility of your research by making it openly available regardless of where you choose to publish.. Items in OPUS are enhanced with high quality metadata and seeded to search engines such as Google Scholar as well as being linked to your UTS research profile, increasing discoverability and opportunities for citation of your work and collaboration. In addition, works in OPUS are preserved for long-term access and discovery.. The UTS Open Access Policy requires UTS research outputs to be openly available via OPUS. Depositing your work in OPUS also assists you in complying with ARC, NHMRC and other funder Open Access policies. Providing Open Access to your research outputs through OPUS not only ensures you comply with these important policies, but increases opportunities ...
Water, Adult, Atlantic Salmon, Bacteria, Disease, Lepeophtheirus Salmonis, Lice, Prevalence, Pseudomonas, Pseudomonas Fluorescens, Role, Salmon, Screening, Stomach, Stomach Contents, Temperatures, Tenacibaculum, Vibrio
Table of Contents. Instructions to Authors / (p. iii-iv) -- Tidal flushing of intracoastal bays / Ned P. Smith (p. 1-12) -- Spatial and seasonal distribution of hydrocarbon-utilizing bacteria of sediment from the Northwestern Gulf of Mexico / S.K. Alexander, S.J. Schropp and J.R. Schwarz (p. 13-20) -- New records and range extensions of deepwater algae from East Flower Garden Bank, northwestern Gulf of Mexico / N.J. Eisman and S.M. Blair (p. 21-26) -- Laboratory studies of a marine copepod (Temora turbinata Dana) tracking dinoflagellate migrations in a miniature water column / J.L. Bird and C.L. Kitting (p. 27-44) -- Shallow water marine isopods of Texas / S.T. Clark and P.B. Robertson (p. 45-60) -- Abundance and distribution patterns of demersal fishes on the south Texas outer continental shelf: a statistical description / R.M. Yoshiyama, J. Holt, S. Holt, R. Godbout and D.E. Wohlschlag (p. 61-84) -- Red drum (Sciaenops ocellatus) movement in Texas Bays / Hal R. Osburn, G.C. Matlock and A.W. ...
53. Glippa O, Brutemark A, Johnson J, Spilling K, Candolin U, Engström-Öst J: Early development of the threespine stickleback larvae in relation to water pH. Frontiers in Marine Science (in press). 52. Engström-Öst, J, Barrett, NJ, Brutemark, A, Vehmaa, A, Dwyer, A, Almén, A-K, De Stasio B (2017) Feeding, survival and reproduction of two populations of Eurytemora (Copepoda) exposed to local toxic cyanobacteria. Journal of Great Lakes Research 43:1091-1100. Abstract. 51. Jacobsen L & Engström-Öst J: Coping with environments - vegetation, turbidity and abiotics. In: (Eds. Nilsson A & Skov C), Biology and ecology of pike, CRC Press. (in press). 50. Almén A-K, Brutemark A, Jutfelt F, Riebesell U & Engström-Öst J (2017) Ocean acidification shows no detectable effect on swimming activity and body size in a common copepod. Hydrobiologia 802: 235-243.. 49. Almén A-K, Glippa O, Pettersson H, Alenius P, Engström-Öst J (2017) Changes in wintertime pH and hydrography of the Gulf of Finland with ...
Found in free swimming parasitic copepods captured in plankton nets. Transfers from one copepod host to another when these crustacean parasites are mating (a sexual disease of copepods). May feed on parasitic copepods instead of fish host; covers these crustacean parasites with eggs that are probably detrimental. May harm other parasites and may actually benefit fish host (Ref. 359). Members of the class Trematoda are parasitic, thus requires a host to survive. Life cycle: Eggs are passed on to the feces of the hosts. Embryos hatch into miracidia and penetrate the tissues of snails where they further undergo three stages: sporocysts (Ref. 833). ...
Apollo is a web-based application that supports and enables collaborative genome curation in real time, allowing teams of curators to improve on existing autom…
Most people usually think of copepods as tiny crustaceans which live as zooplankton near the, and for most part that is true. But it might be a surprise to some of you that over a third of all known copepods are actually parasitic and they live on/in all kinds of aquatic animals. One particularly successful family of such copepods is the Pennelidae - not that you would necessarily recognise them as crustacean if you are to ever see one. While most species in this family live on fish, the parasite that we are featuring today has evolved to be a bit different. Instead of infecting fish, it has managed to colonised aquatic mammals - specifically cetaceans (whales ...
Carboxypeptidase O (CPO), a member of the M14 family of proteolytic enzymes, preferentially cleaves C-terminal acidic amino acids, with weak affinity towards hydrophobic amino acids. We investigated the subcellular localization of CPO, and after immunofluorescent analysis of stably-transfected MDCK cells, we found that CPO co-localized with calnexin, an ER marker. To determine what CPO does in the ER, MDCK cells were transfected with plasmids expressing Gaussia Luciferase (GLuc) containing a C-terminal ER retention signal (KDEL). Previous experiments suggested that CPO cleaves the KDEL sequence of GLuc, causing its secretion. In ongoing experiments, plasmids expressing GLuc tagged with modified KDEL sequences (KDELD, KDELE, and KDELEL) will be transfected, and the intracellular activity of CPO against these substrates will be assessed.
Parasites can infect larval, juvenile or adult marine fishes; however, the effects of parasites on the growth and condition of fish larvae have seldom been investigated. This study analysed the effect
AlgaGen ReefPODS Copepod Refugium Starter Kit 16oz ReefPODS™ are the only truly tropical live copepod culture available on the market today. Your reef will enjoy this supplemental trio of Tisbe, Apocyclops, and blend of LIVE microalgae, not only as a food source, but as an excess nutrient export.Alg
Label License, Gaussia luciferase, material transfer license, US Patent, 6232107, 6436682, 6780974, 7045599, 7109315, 7238497, HTS, high throughput screening
Copepod larva. Rheinberg illuminated light micrograph of a nauplius larva. A nauplius is the first larval stage of a crustacean in which the thorax and abdomen have not developed yet. Nauplii larvae do not feed, but use internal yolk reserves from the egg for energy. Magnification: x200 when printed at 10 centimetres wide. - Stock Image C025/3705
We can envisage two fundamentally different functions of light sensitivity in early metazoans: (i) mediating photoperiodic activities such as diel vertical migration, feeding or reproduction and (ii) phototaxis, the movement towards or away from light. Very likely, these two functions were separated early in metazoan evolution and this might have triggered the diversification of PRC types among Metazoa, characterized by distinct morphologies and molecular fingerprints (Arendt & Wittbrodt 2001; Arendt 2003). Whereas the former function only requires a PRC to measure light intensity, the latter needs an eye, a system allowing tracking sources of light (Foster 2009). In unicellular eukaryotes and in the swimming planktonic larvae of invertebrate animals, phototaxis is driven by locomotor flagella or cilia (Jékely 2009). In these metazoan larvae, there are no muscular systems involved.. For phototactic steering to evolve, several basic functions have to be directly coupled: photoreception mediated ...
De los R os-Escalante, Patricio et al. An update of the distribution of Boeckella gracilis (Daday, 1902) (Crustacea, Copepoda) in the Araucania region (38 S), Chile, and a null model for understanding its species associations in its habitat. Lat. Am. J. Aquat. Res., 2010, vol.38, no.3, p.507-513. ISSN 0718- ...
An Australian teen was attacked by sea lice that caused him to bleed profusely on the lower portion of his legs for hours Saturday before it was brought under control at a hospital the following day.
The only realistic way to attack the problem of how to predict effects in the future is to understand the present. Accordingly, we focus on a specific problem at a specific site to see how well we can "put it all together". As an example, let us imagine compiling our "best" assessment of the biology of the individual life stages of a given species of, say a copepod. Let us further construct the "best" model of the transport phenomena (advection plus mixing) at a site of limited extent, perhaps a coastal site. Then, given the observed physical forcing(s) plus the observed level(s) of predators upon the copepod stages (and prey items in the copepod diet) can we make a prediction about the concentration and distribution of the copepod population as the individuals progress through their life history? Recent work of this kind in the South Atlantic Bight (Hofmann, 1988) suggests that, so long as the time horizon is not too long, we may be closer to this specific goal than ever before.. Such attempts ...
Funktastic. Thats some funky shiat. I liked it. Grooves well, but honestly gotta say got a little repetitive pretty fast. I know its supposed to be loopy for flash stuff and all, but there was tonsa room in there to push it further. Great groove though.. ...
... di- ets - investasi dana forex, monitoring forex broker, forex analyst report, trading system in forex, happy forex 1 5
U Srbiji će sutra biti pretežno sunčano i malo toplije, uz lokalni razvoj oblačnosti, sa maksimalnom temperaturom do 28 stepeni Celzijusa.. Jutro sveže, ponegde sa kratkotrajnom maglom. U severnim krajevima ponegde sa kratkotrajnom kišom, a u planinskim predelima mogući su kratkotrajni pljuskovi sa grmljavinom, saopštio je RHMZ.. Vetar slab i umeren, severni i severozapadni. Jutarnja temperatura od 8 do 15 stepeni Celzijusa, a najviša dnevna od 24 do 28 stepeni.. U Beogradu će sutra biti pretežno sunčano ili malo oblačno i toplije. Vetar slab, severozapadni. Jutarnja temperatura oko 14, a najviša dnevna oko 26 stepeni Celzijusa.. Prema izgledima vremena za sedam dana, do 19. jula, u subotu ujutru i pre podne, a na istoku i veći deo dana biće pretežno sunčano.. Naoblačenje sa kišom pljuskovima i grmljavinama koje će sredinom dana zahvatiti zapadne, jugozapadne i severne delove zemlje do kraja dana, tokom noći i u nedelju će se uz manji pad temperature proširiti i na ostale ...
Creating a World of Change with Karlyn Emile 05, 11 Author: Dana Ratliff https://fiualumni.com/2016/07/27/creating-a-world-of-change-with-karlyn-emile-05-11/
DANA BUD A U Manua deII s tr a I de VALERI MOlUOV D\HR/" dintr-un lrnsns sentiment de regret Cal1E nu are ...
UFC President Dana White talked about Ronda Rousey's impressive performance at UFC 190 on the post-fight show. White was all praise for Rousey's 34 second dismantling of Bethe Correia, and called her "the most badass woman anyone has ever seen." "You don't see women knock women out like that," White said. "She knocked her out. She's an absolute beast. She j
Free, trusted local advisors in Dana Point have helped more than 365 families find Alzheimers Care. | Get pricing, photos & reviews | Schedule tours
Check out the UFC 216 Ultimate Media Day face-offs where UFC president Dana White was on guard, even though Tony Ferguson snuck it a little ...
dan:Dana_GF12175 K00799 glutathione S-transferase [EC:2.5.1.18] , (RefSeq) uncharacterized protein (A) MGKLVLYGVEASPPVRACKLTLDALGLQYEYKLVNLLAGEHRTKEYTLKNPQHTVPMLED DGRWIWESHAICAYLVRRYAKDDSLYPRDYFKRALVDQRLHFESGVLFQGCIRNIAAPLF YKNKTEVPRSKIDAIYEAYDFLETFIGNQPYLCGSGITIADFSIVSSVSSLVGLASIDPQ RYPKLNGWLDRMAKQPNYQSLNGNGAQMLIDMLTSKITKIV ...
Sea lice is a common name for a large number of species of marine ectoparasitic copepods, many of which are widespread and important disease ...
At The Natural Path Center for Wellness we help our patients overcome and cope with a wide variety of health concerns. Below are some of the more common issues we assist people with ...
Direct OE replacement Jeep parts and accessories built to the original specifications by Omix-ADA. Limited five year manufacturers warranty.
All of u - Stop answering questions. Instead ask me questions so I can answer. . All of u - ... | Page: 89 | 1630551 | Geet - Hui Sabse Parayee Forum
Pink Roses, Lilije i zelenilo, da napravite prekrasan buket. Cvece za Bejrut nudi isti dan cveće za Bejrut veoma niske kamatne stope. U ponudi imamo bukete od 23.00 {zaokr} | 18.87 EUR | 16.64 GBP sa dostava istog dana.
Guhandar, guhanî an jî memikdar (Mammalia), çînek movikdar in ku mêyên wan ji bo zadpêdana zaroyên xwe di memik an guhanên xwe da şîrî çê dikin. Memikdaran mû an hirî heye, sê hestiyên biçûk di nav guhên wan a hene, di mejiyê wan da çîneka nû ya korteksê heye, didanên wan taybetmend in, xwîngerm in anko germî ya laşê wan di hundir da tiraz dibit û li goreyê germiya derdorê nahêt guhartin. Piraniya wan hevalzaro heye. Mejiyê wan germiya laşê wan û gera xwînê bi rêya dilekê çar odeyî tiraz dikit.. ...
... ,美術,Kai Althoff/ Glenn Brown/ Dana Schutz/ Balthasar Burkhard,Parkett Verlag,,誠品網路書店,9783907582350
Romantično srce roza ruža vezao sa crvenom vrpcom. Cvijeće za Mijas / Mijas Costa nudi isti dan cvijet isporuka za Mijas / Mijas Costa po vrlo niskim cijenama. Nudimo buketi od 8.00 {a} | 9.32 USD | 7.01 GBP s isti dan isporuke. Otvoreno 7 dana u tjednu · Siguran Shopping · Najniže cijene · Ista dostava · 100% Svježe cvijeće · Platiti CC ili Paypal · Telefonska podrška
Prekrasan buket Ljubičasta ruža, bijelim ljiljanima i ponekog lišće. Vaza... Cvijeće za Mijas / Mijas Costa nudi isti dan cvijet isporuka za Mijas / Mijas Costa po vrlo niskim cijenama. Nudimo buketi od 8.00 {a} | 9.32 USD | 7.01 GBP s isti dan isporuke. Otvoreno 7 dana u tjednu · Siguran Shopping · Najniže cijene · Ista dostava · 100% Svježe cvijeće · Platiti CC ili Paypal · Telefonska podrška
There has been a common understanding that wax esters are poorly absorbed by humans, partly due to outbreaks of the purgative effect named keriorrhea, associated with consumption of oilfish (Ruvettus pretiosus) and escolar (Lepdocybium flavobrunneum). Fillets from these fish species contain up to 20% fat, where 90% of the fat comes as wax esters, resulting in a typical intake of more than 30 000 mg wax esters from one single meal. Orange roughy (Hoplostethus atlanticus) is an attractive food fish with 5,5% fat, where 90% of the fat comes as wax esters. Consumption of this fish gives no unpleasant adverse effects, most likely due to the relatively low fat content that provides approximately 10 000 mg wax ester per 200 grams serving of fish.. In 2015 a randomized, two-period crossover human study, showed that EPA and DHA from oil extracted from the small crustacean Calanus finmarchicus was highly bioavailable and the study concluded that oil from C. finmarchicus could serve as a relevant source of ...
Durbin E, Teegarden G, Campbell R, Cembella A, Baumgartner MF, Mate B. North Atlantic right whales, Eubalaena glacialis, exposed to paralytic shellfish poisoning (PSP) toxins via a zooplankton vector, Calanus finmarchicus. Harmful Algae. 2002 ;1:243-251. ...
Anthropogenically driven climate change not only results in rising of sea temperature but also leads to more frequent and longer-lasting cold and heat waves. Meanwhile, coastal marine ecosystems are constantly challenged by increasing threats of chemical pollution. Temperature and chemical stressors can jointly affect the livelihood of marine organisms, but their combined effects are still poorly understood. Therefore, this study aimed to investigate the effects of thermal stress and chemical exposure on the marine medaka Oryzias melastigma, copepod Tigriopus japonicus and rotifer Brachionus koreanus. The four selected chemical contaminants included copper sulphate pentahydrate (Cu), dichlorophenyltrichloroethane (DDT), triphenyltin chloride and copper pyrithione. It was hypothesized that marine organisms are more susceptible to chemical exposure at both cold and warm extremes. In vivo acute ecotoxicity tests were conducted over a wide temperature range to ascertain the relationship between ...
Blanco-Bercial, L., Cornils, A., Copley, N., Bucklin, A. 2014. DNA barcoding of marine copepods: assessment of analytical approaches to species identification. PLOS Currents Tree of Life. 2014 Jun 23. Edition 1 (doi:10.1371/currents.tol.cdf8b74881f87e3b01d56b43791626d2). More than 2,500 species of copepods (Class Maxillopoda; Subclass Copepoda) occur in the marine planktonic environment. The exceptional morphological conservation of the group, with numerous sibling species groups, makes the identification of species challenging, even for expert taxonomists. Molecular approaches to species identification have allowed rapid detection, discrimination, and identification of species based on DNA sequencing of single specimens and environmental samples. Despite the recent development of diverse genetic and genomic markers, the barcode region of the mitochondrial cytochrome c oxidase subunit I (COI) gene remains a useful and - in some cases - unequaled diagnostic character for species-level ...
During a survey of the zooplankton community of Bahía Amuay, Venezuelan Caribbean, specimens of an undescribed species of Caligus Müller were collected. It resembles C. xystercus Cressey and C. ocyurus Cressey, both known only from the Caribbean Sea. The new species can be distinguished from these and other congeners by a combination of characters including the armature of legs 1 and 4, but mainly by its unique female genital complex. This is the first species of Caligus described from Venezuela. The species is described in full and a key to the species of the genus recorded in Venezuela is provided.
From September 2000 to June 2003, a community-based program for dengue control using local predacious copepods of the genus Mesocyclops was conducted in three rural communes in the central Vietnam provinces of Quang Nam, Quang Ngai, and Khanh Hoa. Post-project, three subsequent entomologic surveys were conducted until March 2004. The number of households and residents in the communes were 5,913 and 27,167, respectively, and dengue notification rates for these communes from 1996 were as high as 2,418.5 per 100,000 persons. Following knowledge, attitude, and practice evaluations, surveys of water storage containers indicated that Mesocyclops spp. already occurred in 3-17% and that large tanks up to 2,000 liters, 130-300-liter jars, wells, and some 220-liter metal drums were the most productive habitats for Aedes aegypti. With technical support, the programs were driven by communal management committees, health collaborators, schoolteachers, and pupils. From quantitative estimates of the standing crop of
Friday, January 18, 2013, 05:20 (GMT + 9) A new study provides unprecedented evidence of viral infections in copepods, or tiny marine crustaceans. Viruses could account for part of the up to 35 per cent of the zooplanktons mortalities, whose causes are currently unknown but suspected to be harmful algae, environmental stressors, parasites and diseases. Researchers used genomic techniques to support the hypothesis that viral infections are a major cause of copepod deaths.. The study was published in the Proceedings of the National Academies of Science.. This is the first evidence of viruses in marine zooplankton, said Ian Hewson, Cornell University assistant professor of microbiology and senior author of the paper. Copepods are critical in oceanic food webs and ocean carbon cycling, which helps regulate the Earths climate. They also consume most of the oceans phytoplankton, which seize about half of the carbon dioxide pulled from the atmosphere and fixed in plant cells. As copepods defecate ...
Redescription of Adults and Description of Copepodid Development of Dermatomyson nigripes (Brady & Robertson, 1876) and Asterocheres lilljeborgi Boeck, 1859 (Copepoda: Siphonostomatoida: Asterocheridae ...
Reliability of genomic selection (GS) models was tested in an admixed population of Atlantic salmon, originating from crossing of several wild subpopulations. The models included ordinary genomic BLUP models (GBLUP), using genome-wide SNP markers of varying densities (1 to 220k), a genomic identity-by-descent model (IBD-GS), using linkage analysis of sparse genome-wide markers, as well as a classical pedigree-based model. Reliabilities of the models were compared through 5-fold cross-validation. The traits studied were salmon lice (Lepeophtheirus salmonis) resistance (LR), measured as (log) density on the skin and fillet color (FC), with respective estimated heritabilities of 0.14 and 0.43. All genomic models outperformed the classical pedigree-based model, for both traits and at all marker densities. However, the relative improvement differed considerably between traits, models and marker densities. For the highly heritable FC, the IBD-GS had similar reliability as GBLUP at high marker densities (|22k)
The surface temperature (within 1 m) at the fixed hydrographic station in Sognesjøen (outer region of Sognefjorden) during January and February was 6.4 and 3.5°C in 2013 and 6.1 and 5.7°C in 2014 (6.3 and 5.5°C on average for the period 2000− 2012, www.imr.no), respectively.. Consequently, the temperature was well below temperatures that routinely occur during the summer and early autumn months in Sognefjorden (July average = 15.4°C).. According to the model by Stien et al. (2005), it will take more than 28 d for individuals to reach the chalimus 1 stage at 5.7°C. This suggests that the production of the main proportion of the lice observed on the fish occurred in January or February. Natural salmon lice intensity during winter months on sea trout is usually not above 3 lice per fish, with a prevalence seldom exceeding 20% (Schram et al. 1998, Rikardsen 2004).. Consequently, the prevalence and abundance observed here are above normal and can be defined as a winter epizootic.. One likely ...
To evaluate the effects of different anthropogenic activities on zooplankton and the pelagic ecosystem, we conducted seasonal cruises in 2010 to assess spatial heterogeneity among the mesozooplankton communities of Xiangshan Bay, a subtropical semi-enclosed bay in China. The evaluation included five different areas: a kelp farm, an oyster farm, a fish farm, the thermal discharge area of a power plant, and an artificial reef, and we aimed to identify whether anthropogenic activities dominated spatial variation in the mesozooplankton communities. The results demonstrated clear spatial heterogeneity among the mesozooplankton communities of the studied areas, dominantly driven by natural hydrographic properties, except in the area near the thermal discharge outlet of the power station. In the outlet area, thermal shock caused by the discharge influenced the mesozooplankton community by decreasing abundance and biomass throughout the four seasons, even causing a shift in the dominant species near the ...
Barreto F.S, Burton RS. 2013. Elevated oxidative damage is correlated with reduced fitness in interpopulation hybrids of a marine copepod. Proceedings of the Royal Society B-Biological Sciences. 280 ...
The name plankton is derived from the Greek adjective πλαγκτός - planktos, meaning "errant", and by extension "wanderer" or "drifter".[1] Plankton typically flow with ocean currents. While some forms are capable of independent movement and can swim hundreds of meters vertically in a single day (a behavior called diel vertical migration), their horizontal position is primarily determined by the surrounding currents. This is in contrast to nekton organisms that can swim against the ambient flow and control their position (e.g. squid, fish, and marine mammals).. Within the plankton, holoplankton spend their entire life cycle as plankton (e.g. most algae, copepods, salps, and some jellyfish). By contrast, meroplankton are only planktic for part of their lives (usually the larval stage), and then graduate to either a nektic or benthic (sea floor) existence. Examples of meroplankton include the larvae of sea urchins, starfish, crustaceans, marine worms, and most fish.. Full article ▸. ...
Among copepods, reproduction is facilitated by a combination of sensory modalities, such as mechano- and chemoreception. The role of chemical communication in copepod mate recognition was assessed using behavioural bioassays that were based on precopulatory behaviours of an estuarine harpacticoid, Coullana canadensis, and the sibling species Coullana sp. Intra- and interspecific crosses demonstrated that males recognize genetically distinct conspecific and heterospecific females, indicating that prezygotic isolation remains incomplete. There was no association between the frequency of mate-guarding behaviour and geographic distance between populations of C. canadensis. However, reduced levels of interspecific mate guarding relative to intraspecific frequencies suggest the existence of a species-specific mate-recognition system. Lectins, which possess strong affinities for specific carbohydrate groups, were used to confirm that glycoproteins on the surface of females function as mate-recognition ...
Purpose: One of the key limiting parameters in the penetration and effectiveness of topically applied ocular therapeutics is their mean residence time. Most of an instilled solution clears through drainage, with first-order clearance about 4 times that of bulk tear flow (~5 ul/min). For protein drugs, the problem becomes more acute due to the additional burden of reduced penetrance through the cornea and conjunctiva. Residence time might be increased however by fusing a protein of interest to a mucosal surface binding protein, such as galectin-3 (gal-3). Gal-3 is a small pentameric ocular surface resident protein that cross-links O-type mucins.. Methods: We used Gaussia luciferase (luc) as our test protein, fused at its N-terminus to one or 2 copies of the carbohydrate binding domain of gal-3 (gal). Fusions were expressed in HEK cells and purified by IMAC chromatography, and evaluated mucin binding by ELISA and by their ocular surface half-lives on mouse eyes and rabbit corneas, using luciferase ...
This post is about study on Balaenophilus manatorum - a tiny parasitic copepod that lives on sea turtles. How does a tiny crustacean like that manage to find their way onto a turtle in the wide expanse of the sea? Do they jump on board when the turtle come into contact with each other, or can the larval stage swim on their own? Obviously they have managed to find a way because this copepod is very common among the juvenile loggerheads in the western Mediterranean, with over 80 percent of loggerhead turtles infected with B. manatorum. Given how small they are (the adult copepod is only about a millimetre long), it seems as if they would be barely a nuisance to their host. But when they occur in large numbers, they can be an serious menace. And they seem to have a very particular taste. It was thought that B. manatorum feed mostly (if not exclusively) on sea turtle skin ...
Salmon migrations serve to protect newly hatched youngsters from the parasites that afflict their parents. But salmon farms undermine this protection and jeopardise wild stocks by exposing young salmon to large numbers of parasitic sea lice. The next time you buy salmon from your local supermarket, think about the hidden costs in each succulent fillet.…
The aim of this study was to compare the nutritional composition and effects of short periods with cultivated copepod nauplii versus rotifers in first-feeding. Atlantic cod (Gadus morhua) and ballan wrasse (Labrus bergylta) larvae were given four different dietary regimes in the earliest start-feedi.... ...
The environmental drivers of zooplankton variability are poorly explored for the central subtropical Pacific, where a direct bottom-up food-web connection is suggested by increasing trends in primary production and mesozooplankton biomass at station ALOHA (A Long-term Oligotrophic Habitat Assessment) over the past 20 years (1994-2013). Here we use generalized additive models (GAMs) to investigate how these trends relate to the major modes of North Pacific climate variability. A GAM based on monthly mean data explains 43% of the temporal variability in mesozooplankton biomass with significant influences from primary productivity (PP), sea surface temperature (SST), North Pacific Gyre Oscillation (NPGO), and El Nino. This result mainly reflects the seasonal plankton cycle at station ALOHA, in which increasing light and SST lead to enhanced nitrogen fixation, productivity, and zooplankton biomass during summertime. Based on annual mean data, GAMs for two variables suggest that PP and 3-4 year ...
Abstract An evaluation of the Lao Aedes aegypti control program and of the predatory abilities of copepods from Vientiane, Lao People's Democratic Republic was undertaken before a field release of copepods in Thongkankam village, Vientiane. Copepods were transported to Australia for evaluation of predatory abilities and their survival under various nutrient and pH conditions. Mesocyclops guangxiensis was chosen for release over M. aspericornis due to its higher reproduction rate and its ability to survive in lower nutrient environments. Mesocyclops guangxiensis was released into 142 containers and 20 wells in a village in Vientiane. Copepods were present in 7% of the containers after one month and were absent six months postinoculation. In comparison, 100% of wells were still positive after six months, with average numbers of Ae. aegypti in the wells decreasing from 59.5 ± 18.5 (± SEM) to 0 after six months. Numbers of Culex quinquefasciatus and Anopheles maculatus also decreased to 0 after six
We analyzed a large data set of laboratory experiments to examine the effects of cyanobacteria containing or lacking intracellular toxic metabolites and of different morphology on zooplankton population growth rates across multiple genera and species of cladocerans, rotifers and cyanobacteria. Twenty-one of the 29 zooplankton species maintained positive growth rates when fed a diet containing cyanobacteria even though cyanobacteria were a poor food source for half of the zooplankton species tested relative to a diet containing only green algae and/or flagellates. Differences among zooplankton species could not be explained by grazer species body lengths, even when experiments were restricted to those that used only filamentous cyanobacteria. Single-celled cyanobacteria were more detrimental to a larger number of zooplankton species compared to filamentous or chroococcoid colonial cyanobacteria. We also found no clear effect of putative cyanobacterial toxins on the growth of seven zooplankton ...
Read "On Catching Humpback Salmon Oncorhynchus gorbuscha and Chum Salmon Oncorhynchus keta of Rare Age, Russian Journal of Marine Biology" on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Wholesale Emamectin Benzoate 5%+ - Select 2018 high quality Wholesale Emamectin Benzoate 5%+ products in best price from certified Chinese Sodium Benzoate Bp manufacturers, Sodium Benzoate Food Grade suppliers, wholesalers and factory on Made-in-China.com
8 9 10 11 12 British Columbia Ministry of the Environment, Salmon Aquaculture in British Columbia, 2010 Quick Facts. Department of Fisheries and Oceans, Socio-Economic Impact of Aquaculture in Canada, 2010, p. 8-9. Atlantic Canada Fish Farmers Association, Fish Farming: Atlantic Canadas Vibrant and Thriving Industry. Department of Fisheries and Oceans, Socio-Economic Impact of Aquaculture in Canada, 2010, p. 41. Food and Agriculture Organization of the United Nations, Fisheries and Aquaculture Department, Fishery Statistical Collections, Global Aquaculture Production, FAO Yearbook of Fishery and Aquaculture Statistics Summary Tables, 2009. Statistics Canada, Aquaculture Statistics, Catalogue No. 23-222-X, 2010, p. 17. Ibid., 2009, p. 11. Department of Fisheries and Oceans, 2010, Socio-Economic Impact of Aquaculture in Canada, p. 8-9; and Agriculture and Agri-Food Canada, International Business, Fish and Seafood, Fact Sheets, Farmed Salmon. Clare Backman, Director Sustainability, Marine Harvest ...
Disease outbreaks are a major constraint to salmon aquaculture worldwide. Therefore, there is considerable interest in finding means to alleviate this problem by enhancing their innate immune system. Because lysozyme is an important component of this system, we generated a line of transgenic Atlantic salmon using a gene construct consisting of a rainbow trout lysozyme gene under the control of the ocean pout antifreeze protein gene promoter op5a (opAFP-rtLys). The results show that the transgene exhibited Mendelian inheritance at both the F1 and the F2 generations and demonstrated that it had integrated into a single chromosome in the genetic founder. Sequence analysis of F2 generation salmon revealed the presence of a complete copy of an intact lysozyme transgene integrant that was identical in sequence to that of the construct. The computationally translated peptide sequence of the lysozyme coding region differed by four amino acids from those present in GenBank (accession nos CAA42084; ...
During the spring breeding season throughout the channeled scablands of eastern Washington, metamorphosed male and female blotched tiger salamanders (Ambystoma tigrinum melanostictum) utilize oropharyngeal suction to capture large quantities of small aquatic invertebrates. Stomach content analysis on salamanders from three populations of this subspecies revealed that they consume the following taxa: Copepoda, Cladocera, Culicidae, Anostraca, and Chironomidae. Although the amount of energy obtained by adults via in-water feeding was not calculated, the large volume of aquatic invertebrate material flushed from salamander stomachs suggests that this feeding strategy should add significantly to their total annual nutrient consumption.

CopepodaCopepoda

... Click on an image to view larger version & data in a new window ... Copepoda. Version 01 January 2002 (temporary). http://tolweb.org/Copepoda/6246/2002.01.01 in The Tree of Life Web Project, http ... Diversity and Geographical Distribution of Pelagic Copepoda. Observatoire océanologique, Laboratoire Arago, Banyuls/Mer, France ...
more infohttp://www.tolweb.org/Copepoda/6246

CopepodaCopepoda

... Click on an image to view larger version & data in a new window ... Copepoda. Version 01 January 2002 (temporary). http://tolweb.org/Copepoda/6246/2002.01.01 in The Tree of Life Web Project, http ... Diversity and Geographical Distribution of Pelagic Copepoda. Observatoire océanologique, Laboratoire Arago, Banyuls/Mer, France ...
more infohttp://tolweb.org/Copepoda/6246

Copepoda ImagesCopepoda Images

... Click on an image to view larger version & data in a new window ...
more infohttp://tolweb.org/images/Copepoda/6246

Global diversity of copepods (Crustacea: Copepoda) in freshwater | SpringerLinkGlobal diversity of copepods (Crustacea: Copepoda) in freshwater | SpringerLink

Copepoda: les Harpacticoïdes souterrains des eaux douces continentales. In Botosaneanu, L. (ed.), Stygofauna Mundi, E.J.Brill, ... Phylogeny and biogeography of the genus Pseudectinosoma and description of P. janineae sp.n. (Crustacea, Copepoda, ... Global diversity of copepods (Crustacea: Copepoda) in freshwater. *Geoff A. Boxshall. 1. & ... Boxshall, G.A., Defaye, D. Global diversity of copepods (Crustacea: Copepoda) in freshwater. Hydrobiologia 595, 195-207 (2008 ...
more infohttps://link.springer.com/article/10.1007/s10750-007-9014-4

Cyclopidae (Crustacea, Copepoda) from the upper Paraná River floodplain, BrazilCyclopidae (Crustacea, Copepoda) from the upper Paraná River floodplain, Brazil

LANSAC-TOHA, F. A.; VELHO, L. F. M.; HIGUTI, J. and TAKAHASHI, E. M.. Cyclopidae (Crustacea, Copepoda) from the upper Paraná ...
more infohttp://www.scielo.br/scielo.php?script=sci_abstract&pid=S1519-69842002000100015&lng=en&nrm=iso&tlng=en

Copepoda: Calanoida: Diaptomidae | NHBS Field Guides & Natural HistoryCopepoda: Calanoida: Diaptomidae | NHBS Field Guides & Natural History

Buy Copepoda: Calanoida: Diaptomidae (9789051030891): Key to the genera Heliodiaptomus, Allodiaptomus, Neodiaptomus, ... Copepoda: Calanoida: Diaptomidae Key to the genera Heliodiaptomus, Allodiaptomus, Neodiaptomus, Phyllodiaptomus, Eodiaptomus, ...
more infohttps://www.nhbs.com/copepoda-calanoida-diaptomidae-book?bkfno=43742

Description of the postembryonic stages of Boeckella poopoensis (Crustacea, Copepoda, Centropagidae)Description of the postembryonic stages of Boeckella poopoensis (Crustacea, Copepoda, Centropagidae)

Feeding of copepodite and adult stages of Eudiaptomus gracilis (Sars, G.O., 1863) (Copepoda, Calanoida) on mixed plastic beads ... West Australian freshwater calanoids (Copepoda) I. Three new species of Boeckella with a description of the developmental ... Biology of Boeckella poopoensis Marsh, 1906 (Copepoda, Calanoida) in natural conditions in temporary saline lakes of the ... Copepoda: Calanoida). Journal of Marine and Freshwater Research 10(1):131-137. [ Links ] ...
more infohttp://www.scielo.br/scielo.php?script=sci_arttext&pid=S0073-47212018000100210&lng=&nrm=iso&tlng=

Choniomyzon libiniae, sp. n. (Crustacea, Copepoda, Nicothoidae) from São Sebastião, SP, BrazilChoniomyzon libiniae, sp. n. (Crustacea, Copepoda, Nicothoidae) from São Sebastião, SP, Brazil

n. (Crustacea, Copepoda, Nicothoidae) from São Sebastião, SP, Brazil Dataset homepage. Citation. Björnberg T (2003). ... n. (Crustacea, Copepoda, Nicothoidae) from São Sebastião, SP, Brazil. Zootaxa 603: 1-12, DOI: 10.5281/zenodo.158250 Taxonomic ... n. (Crustacea, Copepoda, Nicothoidae) from São Sebastião, SP, Brazil. Plazi.org taxonomic treatments database. Checklist ...
more infohttps://www.gbif.org/dataset/ecb036b5-8388-44ce-b1c1-1ca9666c91d5

Actualización de bases de datos de invertebrados (Rotifera, Cladocera y Copepoda) y pecesActualización de bases de datos de invertebrados (Rotifera, Cladocera y Copepoda) y peces

Vásquez Yeomans L, Ramos Rivera P (2017). Actualización de bases de datos de invertebrados (Rotifera, Cladocera y Copepoda) y ... Actualización de bases de datos de invertebrados (Rotifera, Cladocera y Copepoda) y peces Dataset homepage ...
more infohttps://www.gbif.org/dataset/805a8972-f762-11e1-a439-00145eb45e9a

Albionella fabricii n. sp. (Copepoda: Lernaeopodidae) from the gills of Centroscyllium fabricii from the Northwest Atlantic |...Albionella fabricii n. sp. (Copepoda: Lernaeopodidae) from the gills of Centroscyllium fabricii from the Northwest Atlantic |...

Hansen, A.V. (1923) Crustacea Copepoda. 2. Copepoda Parasita and Hemiparasita. Danish Ingolf-Expedition, 3, 1-92.Google Scholar ... Copepoda: Lernaeopodidae) parasitic on Triakis maculata (Kner & Steindachner) from the Chilean coast, South Pacific. Systematic ... Kabata, Z. (1979) Parasitic Copepoda of British fishes. London: The Ray Society, 468 pp.Google Scholar ... Copepoda: Lernaeopodidae) from the gills of Centroscyllium fabricii from the Northwest Atlantic. ...
more infohttps://link.springer.com/article/10.1007%2FBF00010002

Copepoda-Their Status and Ecology in the Red Sea | Springer for Research & DevelopmentCopepoda-Their Status and Ecology in the Red Sea | Springer for Research & Development

The subclass Copepoda is an important driving force in linking the lower trophic to higher trophic levels in aquatic ecosystems ... The subclass Copepoda is an important driving force in linking the lower trophic to higher trophic levels in aquatic ecosystems ... Nicholls AG (1944) Littoral Copepoda from the Red Sea. Ann Mag Nat Hist 11:487-503CrossRefGoogle Scholar ... Al-Aidaroos A.M., El-Sherbiny M.M., Mantha G. (2019) Copepoda-Their Status and Ecology in the Red Sea. In: Rasul N., Stewart I ...
more infohttps://rd.springer.com/chapter/10.1007%2F978-3-319-99417-8_25

Copepoda | Definition of Copepoda in English by Oxford DictionariesCopepoda | Definition of Copepoda in English by Oxford Dictionaries

Definition of Copepoda - a large class of small aquatic crustaceans, many of which occur in plankton and some of which are ... The Copepoda are an incredibly numerous group of crustaceans.. * However, cladistic analysis indicates that the Cycloidea ... Hemoglobins have been described in a select number of crustacean groups, including the Branchiopoda, Ostracoda, Copepoda, ... Monstrilloid copepods represent one of the ten orders of Copepoda currently recognized. ...
more infohttps://en.oxforddictionaries.com/definition/copepoda

Description of Naupliar Stages in Acartia Steueri Smirnov (Copepoda: Calanoida)  »  Brill OnlineDescription of Naupliar Stages in Acartia Steueri Smirnov (Copepoda: Calanoida) » Brill Online

Soh H. Y. , Suh H-L. 2000 "A new species of Acartia (Copepoda, Calanoida) from the Yellow Sea." Journal of Plankton Research ... Ferrari F. D. , Dahms H-U. 2007 "Post-embryonic development of the Copepoda." Crustaceana Monographs Vol 8 1 226 ... Yoon W. D. , Shim M. B. , Choi J. K. 1998 "Description of the developmental stages in Acartia bifilosa Giesbrecht (Copepoda: ... Onoue Y. , Toda T. , Ban S. 2004 "Morphological features and hatching patterns of eggs in Acartia steueri (Crustacea, Copepoda ...
more infohttp://booksandjournals.brillonline.com/content/journals/10.1651/08-2982.1

ELIMINATION OF DENGUE BY COMMUNITY PROGRAMS USING MESOCYCLOPS(COPEPODA) AGAINST AEDES AEGYPTI IN CENTRAL VIETNAM | The American...ELIMINATION OF DENGUE BY COMMUNITY PROGRAMS USING MESOCYCLOPS(COPEPODA) AGAINST AEDES AEGYPTI IN CENTRAL VIETNAM | The American...

f ELIMINATION OF DENGUE BY COMMUNITY PROGRAMS USING MESOCYCLOPS(COPEPODA) AGAINST AEDES AEGYPTI IN CENTRAL VIETNAM * VU SINH ... Copepoda. Thorp JH, Covich AP, eds. Ecology and Classification of North American Freshwater Invertebrates. New York: Academic ... Control of Aedes vectors of dengue in three provinces of Vietnam by use of Mesocyclops (Copepoda) and community-based methods ... National progress in dengue vector control in Vietnam; survey for Mesocyclops (Copepoda), Micronecta (Corixidae) and fish as ...
more infohttp://www.ajtmh.org/content/journals/10.4269/ajtmh.2005.72.67

A case of persisting massive infection of Scomberomorus commerson, a commercially exploited scombrid fish, with Cybicola...A case of persisting massive infection of Scomberomorus commerson, a commercially exploited scombrid fish, with Cybicola...

Copepoda (Crustacea) parasitic on fishes: Problems and perspectives. Advances in Parasitology, 19, 1-71. CrossrefGoogle Scholar ... Parasitic Copepoda. Proceedings of the Symposium on scombroid fishes held at Mandapam Camp from January 12-15, 1962. Part III. ... Parasitic Copepoda from Australian waters. Records of the Australian Museum, 25, 149-234Google Scholar ... South African parasitic Copepoda. Annals of the South African Museum, 62, 69-130Google Scholar ...
more infohttps://www.degruyter.com/view/j/ap.2016.61.issue-4/ap-2016-0116/ap-2016-0116.xml?format=INT

The discovery of Lepeophtheirus acutus Heegaard, 1943 (Copepoda: Caligidae) from two new elasmobranch hosts in the...The discovery of Lepeophtheirus acutus Heegaard, 1943 (Copepoda: Caligidae) from two new elasmobranch hosts in the...

Crustacea Copepoda. II. Copepoda Parasita and Hemiparasita. Danish Ingolf-Expedition, 3, 1-92, pls. 1-5Google Scholar ... Copepoda and Branchiura. In: (Eds L. Margolis, and Z. Kabata) Guide to the parasites of fishes of Canada. Part II - Crustacea. ... Copepoda: Caligidae), a parasite of fishes from the Pacific coast of North America. Journal of the Fisheries Research Board of ... Parasitic Copepoda from Gulf of Mexico fish. Occasional Papers of the Marine Laboratory of Louisiana State University, 9, 1-19 ...
more infohttps://www.degruyter.com/view/j/ap.2018.63.issue-3/ap-2018-0055/ap-2018-0055.xml

Control of aedes vectors of dengue in three provinces of Vietnam by use of Mesocyclops (Copepoda) and community-based methods...Control of aedes vectors of dengue in three provinces of Vietnam by use of Mesocyclops (Copepoda) and community-based methods...

f Control of aedes vectors of dengue in three provinces of Vietnam by use of Mesocyclops (Copepoda) and community-based methods ...
more infohttp://www.ajtmh.org/content/journals/10.4269/ajtmh.2002.66.40

A new species of the genus Leptochela (Decapoda, Caridea, Pasiphaeidae) from the Yellow Sea in: Studies on Decapoda and...A new species of the genus Leptochela (Decapoda, Caridea, Pasiphaeidae) from the Yellow Sea in: Studies on Decapoda and...

Studies on Decapoda and Copepoda in Memory of Michael Türkay. Series:*Crustaceana Monographs, Volume: 22 ... A new species of the genus Typhlamphiascus (Copepoda, Harpacticoida, Miraciidae) from the South China Sea ...
more infohttps://brill.com/view/book/edcoll/9789004366435/B9789004366435_033.xml?language=en

Two new species of the genus Syngastes (Copepoda, Harpacticoida, Tegastidae) from South Korea in: Crustaceana Volume 89 Issue 4...Two new species of the genus Syngastes (Copepoda, Harpacticoida, Tegastidae) from South Korea in: Crustaceana Volume 89 Issue 4...

Three new species of Syngastes (Tegastidae, Harpacticoida, Copepoda) from Western Australia. In: WalkerD. I.WellsF. E. (eds.) ... Copepoda Harpacticoidea from the Californian Pacific coast. K. Sven. Vetensk.-Akad. Handl.10: 1-560. ... The family Tegastidae Sars (Copepoda, Harpacticoida) from the Indian Ocean. Trav. Mus. Natl. Hist. Nat. Grigore Antipa18: 73-87 ... Report on the Copepoda collected by Professor Herdman at Ceylon in 1902. In: W. A. Herdman (ed.) Report to the Government of ...
more infohttps://brill.com/abstract/journals/cr/89/4/article-p431_3.xml

Variety of Life: CopepodaVariety of Life: Copepoda

Copepoda (11) Coraciiformes (1) Coraciimorphae (3) Corticata (211) Corvides (10) Corvoidea (9) Cosmochthonioidea (1) Cossoninae ... Copepoda Email ThisBlogThis!Share to TwitterShare to FacebookShare to Pinterest ... Copepoda incertae sedis:. Linaresia Zulueta 1908 H01. Benthomisophria palliata Sars 1909 IFS01. Lernaeocera IFS01. ,--L. ... The Copepoda are an abundant group of minute aquatic crustaceans, including both free-living and parasitic lineages. The body ...
more infohttp://taxondiversity.fieldofscience.com/2011/08/copepoda.html

Life-cycle and population dynamics of Rhincalanus gigas (Copepoda: Calanoida) in the Scotia Sea  - NERC Open Research ArchiveLife-cycle and population dynamics of Rhincalanus gigas (Copepoda: Calanoida) in the Scotia Sea - NERC Open Research Archive

2007 Life-cycle and population dynamics of Rhincalanus gigas (Copepoda: Calanoida) in the Scotia Sea. Marine Ecology Progress ... Life-cycle and population dynamics of Rhincalanus gigas (Copepoda: Calanoida) in the Scotia Sea ...
more infohttp://nora.nerc.ac.uk/id/eprint/11970/

Reproduction, growth and secondary production of Pseudocalanus elongatus Boeck (Copepoda, Calanoida) in the southern North Sea ...Reproduction, growth and secondary production of Pseudocalanus elongatus Boeck (Copepoda, Calanoida) in the southern North Sea ...

Reproduction, growth and secondary production of Pseudocalanus elongatus Boeck (Copepoda, Calanoida) in the southern North Sea ... Copepoda, Calanoida) in the southern North Sea , Journal of Plankton Research, 30 (5), pp. 511-528 . doi: 10.1093/plankt/fbn016 ...
more infohttp://epic.awi.de/17507/

Copepods: Copepoda - Behavior And Reproduction - Nauplius, Female, Water, and Appendages
	  	   - JRank Articles
	  	Copepods: Copepoda - Behavior And Reproduction - Nauplius, Female, Water, and Appendages - JRank Articles

Copepods: Copepoda - Copepods And People [next] [back] Copepods: Copepoda - Habitat Citing this material. Please include a link ... Other Free Encyclopedias » Animal Life Resource » Mollusks, Crustaceans, and Related Species » Copepods: Copepoda - Physical ...
more infohttp://animals.jrank.org/pages/1862/Copepods-Copepoda-BEHAVIOR-REPRODUCTION.html
  • The sea lice (Copepoda: Caligidae) of Moreton Bay (Queensland, Australia) with descriptions of thirteen new species. (degruyter.com)
  • The host specificity of Lepeophtheirus pectoralis (Müller, 1776) (Copepoda: Caligidae). (degruyter.com)