OklahomaEngineering: The practical application of physical, mechanical, and mathematical principles. (Stedman, 25th ed)Bibliometrics: The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)IllinoisPublications: Copies of a work or document distributed to the public by sale, rental, lease, or lending. (From ALA Glossary of Library and Information Science, 1983, p181)Rehabilitation: Restoration of human functions to the maximum degree possible in a person or persons suffering from disease or injury.Research: Critical and exhaustive investigation or experimentation, having for its aim the discovery of new facts and their correct interpretation, the revision of accepted conclusions, theories, or laws in the light of newly discovered facts, or the practical application of such new or revised conclusions, theories, or laws. (Webster, 3d ed)Victoria: A state in southeastern Australia, the southernmost state. Its capital is Melbourne. It was discovered in 1770 by Captain Cook and first settled by immigrants from Tasmania. In 1851 it was separated from New South Wales as a separate colony. Self-government was introduced in 1851; it became a state in 1901. It was named for Queen Victoria in 1851. (From Webster's New Geographical Dictionary, 1988, p1295 & Room, Brewer's Dictionary of Names, p574)Australia: The smallest continent and an independent country, comprising six states and two territories. Its capital is Canberra.Mice, Knockout: Strains of mice in which certain GENES of their GENOMES have been disrupted, or "knocked-out". To produce knockouts, using RECOMBINANT DNA technology, the normal DNA sequence of the gene being studied is altered to prevent synthesis of a normal gene product. Cloned cells in which this DNA alteration is successful are then injected into mouse EMBRYOS to produce chimeric mice. The chimeric mice are then bred to yield a strain in which all the cells of the mouse contain the disrupted gene. Knockout mice are used as EXPERIMENTAL ANIMAL MODELS for diseases (DISEASE MODELS, ANIMAL) and to clarify the functions of the genes.Physicians: Individuals licensed to practice medicine.Attitude of Health Personnel: Attitudes of personnel toward their patients, other professionals, toward the medical care system, etc.Family Practice: A medical specialty concerned with the provision of continuing, comprehensive primary health care for the entire family.Search Engine: Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.Databases, Genetic: Databases devoted to knowledge about specific genes and gene products.Genome, Human: The complete genetic complement contained in the DNA of a set of CHROMOSOMES in a HUMAN. The length of the human genome is about 3 billion base pairs.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Internet: A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.Genes: A category of nucleic acid sequences that function as units of heredity and which code for the basic instructions for the development, reproduction, and maintenance of organisms.Genomics: The systematic study of the complete DNA sequences (GENOME) of organisms.Smell: The ability to detect scents or odors, such as the function of OLFACTORY RECEPTOR NEURONS.Stroke: A group of pathological conditions characterized by sudden, non-convulsive loss of neurological function due to BRAIN ISCHEMIA or INTRACRANIAL HEMORRHAGES. Stroke is classified by the type of tissue NECROSIS, such as the anatomic location, vasculature involved, etiology, age of the affected individual, and hemorrhagic vs. non-hemorrhagic nature. (From Adams et al., Principles of Neurology, 6th ed, pp777-810)Olfaction Disorders: Loss of or impaired ability to smell. This may be caused by OLFACTORY NERVE DISEASES; PARANASAL SINUS DISEASES; viral RESPIRATORY TRACT INFECTIONS; CRANIOCEREBRAL TRAUMA; SMOKING; and other conditions.Students: Individuals enrolled in a school or formal educational program.Blood Pressure: PRESSURE of the BLOOD on the ARTERIES and other BLOOD VESSELS.Taste Disorders: Conditions characterized by an alteration in gustatory function or perception. Taste disorders are frequently associated with OLFACTION DISORDERS. Additional potential etiologies include METABOLIC DISEASES; DRUG TOXICITY; and taste pathway disorders (e.g., TASTE BUD diseases; FACIAL NERVE DISEASES; GLOSSOPHARYNGEAL NERVE DISEASES; and BRAIN STEM diseases).Students, Medical: Individuals enrolled in a school of medicine or a formal educational program in medicine.Cyclosporine: A cyclic undecapeptide from an extract of soil fungi. It is a powerful immunosupressant with a specific action on T-lymphocytes. It is used for the prophylaxis of graft rejection in organ and tissue transplantation. (From Martindale, The Extra Pharmacopoeia, 30th ed).Pheniramine: One of the HISTAMINE H1 ANTAGONISTS with little sedative action. It is used in treatment of hay fever, rhinitis, allergic dermatoses, and pruritus.Myocardial Infarction: NECROSIS of the MYOCARDIUM caused by an obstruction of the blood supply to the heart (CORONARY CIRCULATION).Myocardial Reperfusion Injury: Damage to the MYOCARDIUM resulting from MYOCARDIAL REPERFUSION (restoration of blood flow to ischemic areas of the HEART.) Reperfusion takes place when there is spontaneous thrombolysis, THROMBOLYTIC THERAPY, collateral flow from other coronary vascular beds, or reversal of vasospasm.Creatine Kinase: A transferase that catalyzes formation of PHOSPHOCREATINE from ATP + CREATINE. The reaction stores ATP energy as phosphocreatine. Three cytoplasmic ISOENZYMES have been identified in human tissues: the MM type from SKELETAL MUSCLE, the MB type from myocardial tissue and the BB type from nervous tissue as well as a mitochondrial isoenzyme. Macro-creatine kinase refers to creatine kinase complexed with other serum proteins.Cyclosporins: A group of closely related cyclic undecapeptides from the fungi Trichoderma polysporum and Cylindocarpon lucidum. They have some antineoplastic and antifungal action and significant immunosuppressive effects. Cyclosporins have been proposed as adjuvants in tissue and organ transplantation to suppress graft rejection.Reperfusion Injury: Adverse functional, metabolic, or structural changes in ischemic tissues resulting from the restoration of blood flow to the tissue (REPERFUSION), including swelling; HEMORRHAGE; NECROSIS; and damage from FREE RADICALS. The most common instance is MYOCARDIAL REPERFUSION INJURY.Sperm Agglutination: Agglutination of spermatozoa by antibodies or autoantibodies.Spermatozoa: Mature male germ cells derived from SPERMATIDS. As spermatids move toward the lumen of the SEMINIFEROUS TUBULES, they undergo extensive structural changes including the loss of cytoplasm, condensation of CHROMATIN into the SPERM HEAD, formation of the ACROSOME cap, the SPERM MIDPIECE and the SPERM TAIL that provides motility.Recombinant Proteins: Proteins prepared by recombinant DNA technology.Vaccines, Contraceptive: Vaccines or candidate vaccines used to prevent conception.Infertility, Female: Diminished or absent ability of a female to achieve conception.Spermatogenesis: The process of germ cell development in the male from the primordial germ cells, through SPERMATOGONIA; SPERMATOCYTES; SPERMATIDS; to the mature haploid SPERMATOZOA.Testis: The male gonad containing two functional parts: the SEMINIFEROUS TUBULES for the production and transport of male germ cells (SPERMATOGENESIS) and the interstitial compartment containing LEYDIG CELLS that produce ANDROGENS.Northern IrelandIrelandCommerce: The interchange of goods or commodities, especially on a large scale, between different countries or between populations within the same country. It includes trade (the buying, selling, or exchanging of commodities, whether wholesale or retail) and business (the purchase and sale of goods to make a profit). (From Random House Unabridged Dictionary, 2d ed, p411, p2005 & p283)Pharmacies: Facilities for the preparation and dispensing of drugs.Marketing: Activity involved in transfer of goods from producer to consumer or in the exchange of services.Pharmacy: The practice of compounding and dispensing medicinal preparations.Antibodies, Monoclonal, Humanized: Antibodies from non-human species whose protein sequences have been modified to make them nearly identical with human antibodies. If the constant region and part of the variable region are replaced, they are called humanized. If only the constant region is modified they are called chimeric. INN names for humanized antibodies end in -zumab.Professional Role: The expected function of a member of a particular profession.Professional Competence: The capability to perform the duties of one's profession generally, or to perform a particular professional task, with skill of an acceptable quality.Health Personnel: Men and women working in the provision of health services, whether as individual practitioners or employees of health institutions and programs, whether or not professionally trained, and whether or not subject to public regulation. (From A Discursive Dictionary of Health Care, 1976)Pharmacology, Clinical: The branch of pharmacology that deals directly with the effectiveness and safety of drugs in humans.Pharmacology: The study of the origin, nature, properties, and actions of drugs and their effects on living organisms.

A contraceptive peptide vaccine targeting sulfated glycoprotein ZP2 of the mouse zona pellucida. (1/106)

In this study, we have mapped and characterized a B cell epitope of sulfated glycoprotein ZP2 (ZP2) as a step toward the development of a multi-epitope zona pellucida (ZP) vaccine. Recombinant polypeptides expressed by random deoxyribonuclease-digested fragments of ZP2 cDNA were screened for binding to IE-3, a monoclonal antibody to murine ZP2. Positive clones contained cDNA inserts encoding polypeptide corresponding to ZP2(103-134). When normal or ovariectomized female mice were immunized with three overlapping peptides that span this region of ZP2 (101-120, 111-130, 121-140), only ZP2(121-140) elicited IgG antibodies that reacted with mouse ovarian ZP, indicative of the presence of native B epitope and helper T cell epitope in ZP2(121-140). To more finely map the ZP2 B cell epitope, a random peptide display library was screened with the IE-3 antibody, and a consensus tetramer sequence VxYK that matched the ZP2(123-126) sequence VRYK was located. Competitive immunofluorescence analysis with single alanine-substituted VxYK peptides ranked the relative contribution of the three critical B cell epitope residues as Y > V > K. A chimeric peptide was constructed that contained the YRYK motif of ZP2 and a bovine RNase T cell epitope. Although (C57BL/6xA/J) F1 (B6AF1) female mice immunized with the chimeric peptide developed ZP antibody response, this peptide elicited antibody only in mice of the histocompatibility complex (MHC) H-2(k or b) haplotype. In contrast, ZP2(121-140) peptide elicited antibody in inbred mice with three additional mouse MHC haplotypes. Moreover, although ZP2(121-140) contained a T cell epitope, no oophoritis was observed after immunization of B6AF1 mice with ZP2(121-140) in complete Freund's adjuvant (CFA). In a preliminary trial, female B6AF1 mice immunized with ZP2(121-140) in CFA had reduced litter sizes as compared with mice injected with CFA alone.  (+info)

Antibodies to human ZP3 induce reversible contraception in transgenic mice with 'humanized' zonae pellucidae. (2/106)

The initial spermatozoon-egg interaction of mammalian fertilization is mediated by the zona pellucida, an extracellular matrix composed of three glycoproteins (ZP1, ZP2, ZP3). These proteins are sufficiently conserved between human and mouse to form chimeric zonae pellucidae, and genetically engineered mice in which the endogenous mouse ZP3 has been replaced by human ZP3 have 'humanized' zonae, but normal fertility. Administration of monoclonal antibodies to mouse ZP3 does not affect fertility in these animals, but administration of antibodies to human ZP3 results in long-term, reversible contraception. The antibodies coat the zonae pellucidae surrounding growing oocytes within the ovary and their presence in the zona matrix inhibits, but does not eliminate, sperm binding. The contraceptive effect is attributed to steric hindrance that decreases sperm binding and prevents penetration through the zona pellucida. The resumption of fertility is associated with the disappearance of antibodies from the zona matrix. No adverse effect on mating behaviour, ovarian histology or fetal development (if administered after fertilization) is detected in treated females. These results suggest that transgenic mice expressing human proteins will prove useful in assessing contraceptive efficacy of zona epitopes in the rational design of immunocontraception directed at the human zona pellucida.  (+info)

Design and evaluation of a ZP3 peptide vaccine in a homologous primate model. (3/106)

The concept of a safe, immunocontraceptive vaccine using the zona pellucida glycoprotein 3 (ZP3) as an immunogen has been marred by the appearance of ovarian dysfunction in several species. However, careful selection of epitopes on mouse ZP3 have demonstrated that it is possible to segregate contraceptive bone marrow-derived (B)-cell epitopes from the cytotoxic thymus-derived (T)-cell epitopes thought to be responsible for inducing ovarian disease. B-cell epitopes on marmoset ZP3 (mstZP3) were identified by epitope mapping studies. Using a panel of polyclonal antibodies against recombinant mstZP3, an immunodominant epitope mstZP3(301-320) was identified. A chimeric peptide was co-linearly synthesized incorporating this sequence with a promiscuous tetanus toxoid T-helper cell epitope. Using the common marmoset (Callithrix jacchus) as an animal model, we have compared the consequences of active immunization with homologous recombinant mstZP3 and mstZP3(301-320) chimeric peptide vaccine. Long-term infertility was achieved using mstZP3 but at the expense of ovarian function. In contrast, no disruption to ovarian function was observed following mstZP3(301-320) immunization. Antibodies to this peptide immunolocalized to the zona pellucida of both marmoset and human ovarian sections and inhibited human sperm-zona binding by approximately 60% in vitro. However, in-vivo studies indicated that targeting a single ZP3 epitope was insufficient to reliably and consistently achieve a contraceptive effect.  (+info)

Antigenic and immunogenic properties of totally synthetic peptide-based anti-fertility vaccines. (4/106)

In this study we describe the results of experiments in which a variety of totally synthetic luteinizing hormone releasing hormone (LHRH) vaccines were assembled and examined for their abilities to elicit antibody responses and induce sterility in mice. It is shown that totally synthetic vaccines consisting of a 15 residue-defined T cell epitope and the 10 residue LHRH epitope not only induced high titers of antibody but also induced sterility. This effect did not appear to correlate with antibody titer, antibody isotype or comparative antibody affinity, but may be related to the length of time for which antibodies are present to exert their influence.  (+info)

Immunological control of fertility: measurement of affinity of antibodies to human chorionic gonadotrophin. (5/106)

Four baboons were primed with diazotized beta human chorionic gonadotrophin and boosted with diazotized C-terminal beta human chorionic gonadotrophin peptide, and the changes in antibody amount and affinity determined using a double isotope modified Farr assay, using labelled human chorionic gonadotrophin as the antigen. The degree of cross-reaction with human luteinizing hormone was also determined. Although appreciable reactivity with luteinizing hormone was observed soon after immunization, this declined rapidly during the response. At the time intervals studied, there was a progressive increase in affinity of antibodies to human chorionic gonadotrophin until day 248 after priming. At day 313, in two of the animals, there was a decrease in affinity from 1.04 X 10(11) to 6.80 X 10(10) and 1.05 X 10(11) to 4.93 X 10(10) l/mol, whereas in the other two baboons there was a further increase in antibody affinity. At corresponding time intervals, there was a steady decrease in values of total antibody binding sites. To determine the overall effect of the maturation of affinity with a decrease in antibody amount on biological efficacy, the theoretical amount of chorionic gonadotrophin that would be neutralized was calculated. We computed that in all instances, over 99% of a peak concentration of chorionic gonadotrophin that could be in circulation in a pregnant baboon would be neutralized. This was in excellent agreement with results of mating experiments in these baboons. In over forty cycles studied, none of the matings resulted in a sustained pregnancy.  (+info)

Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstrating inhibition of sperm-egg binding. (6/106)

To circumvent autoimmune oophoritis after immunization with zona pellucida (ZP) glycoproteins, synthetic peptides encompassing B cell epitope(s) and devoid of oophoritogenic T cell epitopes as immunogens have been proposed. In this study, bonnet monkey (Macaca radiata) ZP glycoprotein-B (bmZPB) was expressed as polyhistidine fusion protein in Escherichia coli. Rabbit polyclonal antibodies against recombinant bmZPB (r-bmZPB) significantly inhibited human sperm-oocyte binding. To map B cell epitopes on ZPB, a panel of 7 murine monoclonal antibodies (mAbs) was generated against r-bmZPB. All 7 mAbs, when tested in an indirect immunofluorescence assay, reacted with bonnet monkey ZP, and only 6 recognized human zonae. Monoclonal antibodies MA-809, -811, -813, and -825 showed significant inhibition in the binding of human spermatozoa to human ZP in a hemizona assay. Epitope-mapping studies using multipin peptide synthesis strategy revealed that these 4 mAbs recognized a common epitope corresponding to amino acids (aa) 136-147 (DAPDTDWCDSIP). Competitive binding studies revealed that the synthetic peptide corresponding to the identified epitope (aa 136-147) inhibited the binding of MA-809, -811, -813, and -825 to r-bmZPB in an ELISA and to bonnet monkey ZP in an indirect immunofluorescence assay. The epitopic domain corresponding to aa 136-147 of bmZPB was completely conserved in human ZPB. These studies will further help in designing ZP-based synthetic peptide immunogens incorporating relevant B cell epitope for fertility regulation in humans.  (+info)

Identification of human sperm peptide sequence involved in egg binding for immunocontraception. (7/106)

Development of a vaccine based on sperm antigens represents a promising approach to contraception. The sperm-zona pellucida (ZP) interaction constitutes the most important event in the fertilization process, and the molecular sequences involved at this site may provide the most attractive candidates for immunocontraception. In the present study, using the phase peptide display technique, a novel dodecamer sequence, designated as YLP(12), was identified that is involved in sperm-ZP recognition/binding. The synthetic 12-mer peptide based on this sequence and its monovalent Fab' antibodies specifically and significantly (P < 0.05) inhibited human sperm-ZP binding. In Western blot and immunoprecipitation procedures, the YLP(12) peptide recognized the ZP3 component of solubilized human ZP proteins. In the Western blot procedure involving 10 different human tissue extracts, the anti-YLP(12) Fab' antibodies recognized a protein band of approximately 72 +/- 2 kDa only in the testis lane. The peptide sequence was localized on the acrosomal region of the human sperm cell. These findings indicate that the novel testis-specific 12-mer YLP(12) that is present in the acrosomal region and is involved in human sperm-ZP interaction may find applications in contraceptive vaccine development, as well as in diagnosis and treatment of male infertility mediated through sperm dysfunction.  (+info)

Immunological block to mammalian fertilization: survival and organ distribution of immunoglobulin which inhibits fertilization in vivo. (8/106)

Fertilization of golden hamster eggs was blocked both in vitro and in vivo by antibodies produced in rabbits against specific hamster ovarian antigens (HOA). Antibodies against HOA bound to surfaces of the hamster egg zona pellucida and prevented spermatozoa from attaching to the zona and entering eggs in vitro. Fertilization in animals could be blocked for four estrous cycles by a single intraperitoneal injection of anti-HOA immunoglobulin, but not by control immunoglobulin. The in vivo fate of anti-HOA immunoglobulin was analyzed by simultaneous injection of 125I-anti-HOA IgG and control 131I-IgG. Both anti-HOA IgG and control IgG appeared in a variety of organs (lung, kidney, spleen, liver, and uterus) shortly after injection, but disappeared rapidly with no detectable differences in organ half lives. However, in the ovary anti-HOA IgG (but not control IgG) persisted at high levels during the period of infertility. Quantitative precipitin analysis of organ homogenates indicated that a high percentage of anti-HOA IgG in the ovary (but not in the other organs tested) was immunologically indistinguishable from IgG indicating lack of radiolabel metabolism and reincorporation. The results are discussed in terms of the development of a specific immunological block to fertility.  (+info)

*List of MeSH codes (E02)

... contraception, barrier MeSH E02.875.194.300 --- contraception, immunologic MeSH E02.875.194.540 --- contraception, postcoital ... immunologic MeSH E02.095.520.450.440 --- graft enhancement, immunologic MeSH E02.095.520.450.521 --- lymphocyte depletion MeSH ...

*Sperm-associated antigen 1

Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, ...

*Reproductive immunology

Antibodies against hCG would prevent the maintenance of the uterus for a viable pregnancy therefore preventing contraception. ... They are protected by other means like immunologic tolerance and immunomodulation. Infertility after anti-sperm antibody ...

*Library of Congress Classification:Class R -- Medicine

Contraception RG138 Sterilization of women RG159-208 Functional and systemic disorders. Endocrine gynecology RG211-483 ... Developmental disabilities RC581-951 Specialties of internal medicine RC581-607 Immunologic diseases. Allergy RC620-627 ...

*Angioedema

Acquired angioedema (AAE) can be immunologic, nonimmunologic, or idiopathic. It is usually caused by allergy and occurs ... it can be exacerbated by pregnancy and use of hormonal contraception (exact frequency uncertain). It has been linked with ...

*Anakinra

Women of childbearing potential should use effective contraception methods. Pregnancy: animal studies showed no adverse effects ... including inflammatory and immunologic reactions. IL-1 additionally stimulates bone resorption and induces tissue damage like ...

*Pregnancy test

Immunologic pregnancy tests were introduced in 1960 when Wide and Gemzell presented a test based on in-vitro hemagglutination ... http://en.muvs.org/contraception/pregnancy-tests/duogynon-id1614 Bleavins MR, Carini C, Malle JR, Rahbari R (2010). Biomarkers ...

*Adverse effect

Due to the exceedingly high impact on public health of widely used medications, such as hormonal contraception and hormone ... "Silicone Breast Implants in Relation to Connective Tissue Diseases and Immunologic Dysfunction". Retrieved March 16, 2013. ... Liver damage from paracetamol Melasma and thrombosis associated with use of estrogen-containing hormonal contraception, such as ...

*Breastfeeding

This has been used as natural contraception, with greater than 98% effectiveness during the first six months after birth if ... Breastfeeding triggers biochemical reactions which allows for the enzymes, hormones, growth factors and immunologic substances ...
In the strictest sense immunocontraception is the use of an animals immune system to prevent it from fertilizing offspring. More generally the field of immunocontraception includes related technologies that prevent embryonic implantation. Typically immunocontraception involves the administration of a vaccine that induces an adaptive immune response which causes an animal to become temporarily infertile. Contraceptive vaccines have been used in numerous settings for the control of wildlife populations. However, experts in the field believe that major innovations are required before immunocontraception can become a practical form of contraception for human beings. Thus far immunocontraception has focused on mammals exclusively. There are several targets in mammalian sexual reproduction for immune inhibition. They can be organized into three categories. Gamete production Organisms that undergo sexual reproduction must first produce gametes, cells which have half the typical number of chromosomes ...
lmmunocontraception technology appears to have viable application in wildlife damage management. However, administration of these vaccines is presently performed by syringe injection or remote delivery by darts or bio-bullets. In order for immunocontraception to be successful for broad scale application to free-roaming animals, the vaccine must be delivered in an oral form. Recent advances in molecular biology, immunology, and pathology of mucosal infection gives us tools to develop effective oral vaccines. Oral immunocontraceptive vaccine encapsulated in adhesive liposomes or non-virulent live vectors holds promise as a practical approach for immunocontraception of free-roaming wildlife. Issues of safety, species specificity, regulatory constraints, and field application of the vaccine will need to be addressed.
... A BODEN RESEARCH CONFERENCE Immunological control of fertility: From gametes to gonads February 9th-11th, 1994 Thredbo Alpine Hotel, NSW, Australia Sponsored by Australian Academy of Science CRC for Biological Control of Vertebrate Pest Populations The Australian Society for Reproductive Biology Australasian Society for Immunology Fertility Society of Australia This meeting will bring together researchers interested in using gamete antigens as targets for immunocontraception. The meeting will discuss the current status of this research and aim to explore the problems associated with vaccine delivery and the targeting of immune responses in order to bring about successful immunocontraception. Organisers: Drs Mark Bradley & Michael Holland Overseas Invited speakers: N. Alexander; M. ORand; E. Goldberg; K. Tung; G. McGhee; J. Herr, J. Dean; B. Dunbar Topics to be discussed: Human immunocontraception; viral vectored Immunocontraception; Sperm and zona antigens as vaccine ...
TCC interviews Devin Kazakoff about non-lethal deer cull alternative Native PZP an immunocontraceptive that could be used in Victoria, B.C. and other region
Links of interest™:. Immunocontraception (Wikipedia): https://en.wikipedia.org/wiki/Immunocontraception. "Whenever an immune response is provoked, there is some risk of autoimmunity. Therefore immunocontraception trials typically check for signs of autoimmune disease.[17] One concern with zona pellucida vaccination, in particular, is that in certain cases it appears to be correlated with ovarian pathogenesis.[2] However, ovarian disease has not been observed in every trial of zona pellucida vaccination, and when observed, has not always been irreversible.[18]". Autoimmune disease (Wikipedia): https://en.wikipedia.org/wiki/Autoimmune_disease "Autoimmune diseases arise from an abnormal immune response of the body against substances and tissues normally present in the body (autoimmunity). . .". ZonaStat-H is the EPA restricted-use pesticide-PZP-for wild horses and burros the registrant calls "pests": http://www3.epa.gov/pesticides/chem_search/reg_actions/pending/fs_PC-176603_01-Jan-12.pdf. Tule ...
It is not illegal to issue a permit to chemically sterilize or perform an ovariectomy on deer in the State of Michigan. However, the MNDR does not allow either method and will not issue a permit unless accompanied by an accepted research proposal. The MDNR will consider a permit from A2 to perform surgical sterilization of deer or administer Porcine Zona Pallucida (PZP), an immunocontraceptive vaccine, if it is presented as a research proposal. That proposal may be narrower in scope than projects considered by MSU. The possibility of the City partnering with an entity other than a University to submit the permit and was deemed acceptable, if the MDNR agreed with the scope of the proposal. The MDNR was clear that a permit to conduct surgical sterilization or administer PZP would not be approved without a research proposal. The MDNR permit would be issued annually.. Surgical Sterilization/Immunocontraception: ...
June 5, 2008-A wildlife preserve in Africa has too many elephants, and theyve got a surprising solution for controlling their population.
White-tailed deer populations in suburban and urban areas have expanded dramatically in recent years and have produced widespread problems across the United States. Currently there are several methods to control the size and growth of deer populations. I modeled the use of immunocontraception on a hypothetical, urban deer population and found 60% of the does would need to be vaccinated with porcine zona pellucida (PZP) in order to stabilize the herd. I also found that the population would decrease after 70% of the females received the immunocontraceptive. The cost of administering the drug significantly out-weighs the price per dose of PZP, making the use of immunocontraceptives on urban white-tailed deer populations cost-inefficient.. Meredith Millis, 00 Des Moines, ...
OBJECTIVES. Overpopulation of companion animals is a complex societal, ethical, economic and humane problem in both developed as well as developing nations. It is estimated that in Spain each year are abandoned thousands of dogs, and millions are euthanized annually in the U.S. Methods to control overpopulation of companion animals have relied on spay-neuter programs. Alternative programs have focused on immunocontraception and subsequent return to fertility. However, effective immunosterilants will result in a permanent loss of fertility as well as sexual behaviour without adverse side effects related to the animals health and well being. Among others, immunization methods with GnRH and/or purified zona pellucida may be an alternative in order to reach the immunosterilization. The aim of this study was to elucidate the effects of immunization with porcine zona pellucida (pZP) on gonadal function in the bitch by measuring a) progesterone and estradiol levels, b) antibody titers and, c) sexual ...
Vaccines have been proposed as one of the strategies for population control. Immunocontraceptive vaccines can be designed to inhibit: (1) production of gametes (sperm and egg); (2) functions of gametes, leading to blocking of fertilization; and (3) gamete outcome (pregnancy). Immunization with gonadotropin‐releasing hormone coupled to different carriers has shown curtailment in the production of sperm with concomitant infertility in various species. Immunization of nonhuman primates and men with ovine follicle stimulating hormone has also resulted in reduced sperm output. Various spermatozoa‐specific proteins such as FA1, PH‐20, LDH‐C4, SP‐10, SP‐17, sp56, SPAG9, and Izumo have been proposed as candidate antigens to develop contraceptive vaccines, which have shown efficacy in inhibiting fertility in different animal models. Immunization with zona pellucida glycoproteins‐based immunogens also results in curtailment of fertility in a variety of species. However, ways to overcome the ...
A typical disease vaccine primes the immune system to be on the alert for an infection caused by organisms with properties similar to those of the vaccine. Antibodies to the disease may be few in number or absent until the infection occurs. The infection then serves as a booster that stimulates an immediate immune response, protecting the vaccinated animal. For an immunocontraceptive vaccine to be effective, however, it must continually produce a high contraceptive antibody titer, so the booster effect must come from a different, non-disease mechanism-the adjuvant.. NWRC has modified and tested a USDA-approved Johnes vaccine called Mycopar™. Mycopar™ is approved for use in food animals by APHIS. The new adjuvant, which NWRC scientists have named AdjuVac™, contains a small quantity of M. avium, a common, generally nonpathogenic bacterium found in many species of domesticated and wild animals. NWRC scientists are testing AdjuVac™ in numerous wildlife species and it appears to be an ...
The study is double blind. However the active control vaccine Tritanrix™-HepB/Hiberix™ will be administered in a single-blind manner. Blood samples will be collected for immunogenicity analyses. GSK Biologicals OPV vaccine will be administered concomitantly with the study vaccines at 2, 4 and 6 months of age according to local country regulation. The study will last approximately 5 months per ...
EXPANDED SUMMARY OF PZPS ADVERSE EFFECTS, INCLUDING REFERENCES. PZP - The Pesticide. Porcine zona pellucida (PZP aka ZonaStat-H or Native PZP) is an EPA-registered pesticide derived from the ovaries of slaughtered pigs. PZP is approved for use on wild horses "in areas where they have become a nuisance …." [20]. Some persons argue that, because PZP does not kill the mare, it is not really a "pesticide." Actually, PZP does kill. As will be documented in this report, its use is associated with stillborn foals. In the long term, PZP will weaken a herd immunologically, which could swiftly lead to its extinction. So, yes, PZP is a real pesticide.. PZP - an Anti-Vaccine. While touted as a "vaccine," PZP is actually a perversion of what a true vaccine is supposed to be. Instead of preventing disease, PZP causes disease - auto-immune disease. Thus, PZP is an anti-vaccine.. PZPs Mode of Action as Stated in the Pesticide Registration Is a Disproved Hypothesis. The registrant of PZP advised the ...
The American Journal of Reproductive Immunology (AJRI) is the official journal of the American Society for Reproductive Immunology. Its aim is the accurate and fast presentation of new data in reproductive immunology. The journal covers a variety of subspecialty topics, including fertility immunology, pregnancy immunology, immunogenetics, mucosal immunology, immunocontraception, endometriosis, recurrent spontaneous abortion, and autoantibodies.. 5 Year Impact Factor: 3.013 - Now Ranked in the Top 10 in Reproductive Biology ...
Synonyms for granny's bonnets in Free Thesaurus. Antonyms for granny's bonnets. 1 synonym for grannys bonnets: Aquilegia vulgaris. What are synonyms for granny's bonnets?
Have Them Delivered Direct To Your Home. Pharmacy Providing Mail Order Prescription Drugs. Cipro Effects On Fertility. A Large Assortment Of Drugs. #1 Online Pharmacy.
During reproductive life, only a selected few ovarian follicles mature and ovulate, while the vast majority of follicles undergo a degenerative process called atresia. Recent studies have indicated that follicular atresia is mediated through apoptosis of follicular granulosa cells. The objectives of the present study were to determine the time of onset of apoptosis in granulosa cells of preovulatory follicles and to evaluate the consequences of gonadotropin withdrawal on mitogen-activated protein (MAP) kinase activities. Bonnet monkeys (Macaca radiata) undergoing controlled ovarian stimulation cycles were utilized for stimulation of multiple follicles, and granulosa cells were retrieved from preovulatory follicles at 24, 48, 72, and 96 h after stopping gonadotropin treatment. Serum and follicular fluid estradiol concentrations were highest at 24 h but declined precipitously (P , 0.05) to reach the lowest concentrations at 96 h; however, progesterone concentrations during this period did not ...
Looking for online definition of Sperm antigen HE2 in the Medical Dictionary? Sperm antigen HE2 explanation free. What is Sperm antigen HE2? Meaning of Sperm antigen HE2 medical term. What does Sperm antigen HE2 mean?
A change in the elasticity and the resistance to dissolution of the mouse zona pellucida (ZP) was quantitatively evaluated at immature germinal vesicle (GV), mature metaphase II (MII) and fertilized pronuclear (PN) stages. Youngs modulus of the ZP was measured using a micro tactile sensor (MTS), a highly sensitive resonator-based sensor for a micro scale elasticity measurement. 0.25% alpha-chymotrypsin was used for the ZP dissolution assay. The results of measuring the ZP elasticity and the dissolution time clearly showed that the ZP softened during oocyte maturation and the ZP hardened after fertilization. The results indicate that the amount of the zona softening can be a criterion to evaluate oocyte quality for the selection of top quality mature oocyte before in vitro fertilization (IVF) treatment.. ...
Mukku, VR and Murty, GSRC and Srinath, BR and Ramasharma, K and Kotagi, SG and Moudgal, NR (1981) Regulation of Testosterone Rhythmicity by Gonadotropins in Bonnet Monkeys (Macaca radiata). In: Biology Of Reproduction, 24 (4). pp. 814-819. Rani, Sheela CS and Murty, GSRC and Moudgal, NR (1978) Effect of Chronic Neutralization of Endogenous FSH on Testicular Function in the Adult Male Bonnet Monkey - Assessment Using Biochemical Parameters. In: International Journal of Andrology, 1 (6). 489-500 . ...
ZP1 - ZP1 (untagged)-Human zona pellucida glycoprotein 1 (sperm receptor) (ZP1) available for purchase from OriGene - Your Gene Company.
Photography: all images copyright and courtesy of the artist and Kimberly-Klark, New York. The BLM is planning on gathering an estimated 262 wild horses from the Swasey HMA with up to 100 being released back onto the range following the gather. Approximately 49 mares will be treated with the fertility control drug Porcine Zona Pellucida (PZP-22); the remainder of the released horses will be studs. Approximately 162 excess wild horses, including wild horses gathered that are residing outside the HMA boundary, will be removed. 1. To save [them] from [an] alternative, or perhaps utter annihilation, the General Government kindly offers [them] a new home, and proposes to pay the whole expense of [their] removal and settlement. 2. -----. A: can you describe where your fear is coming from ...
After years of query, we found that hoof of mule, a compound with contraceptive effect, had been used more than a century ago by the nomadic populatio..
Buy Fashion Satin Bonnet Cap - Purple for ₦ 1,500 (22/01/2018) online at Jumia Nigeria✔ Best service✔ Enjoy payment on delivery✔
Purified Recombinant Human PZP Protein, His-tagged from Creative Biomart. Recombinant Human PZP Protein, His-tagged can be used for research.
Ever get a bee in your bonnet? One of those thoughts that just keeps buzzing around and wont let you go? Welcome to my world...
Ever get a bee in your bonnet? One of those thoughts that just keeps buzzing around and wont let you go? Welcome to my world...
The operating mechanism of a diaphragm valve is not exposed to the media within the pipeline. Sticky or viscous fluids cannot get into the bonnet to interfere with the operating ...
infant baby bonnet hats vintage photo prop newborn on.. infant baby bonnet pattern girl bonnets nike hats toddler boys girls summer peaked baseball beret sun hat cap,infant baby sun hats crochet bonnets for sale toddler boy beanies placeholder new summer cartoon mickey,infant baby nike hats petite bonnet w applique design add on sun winter,infant baby crochet hats nike deer knit bonnet with ears cartoon winter hat for 6,baby bonnets pattern three sizes six styles simplicity infant girl hat crochet nike hats,infant baby hats newborn girls bonnets personalized for sale girl,infant baby nike hats polo us off handmade girl flower hat bonnet newborn lace cap photography props studio photo headdress in to knit,infant baby polo hats bonnets for sale hat knitting pattern bonnet vintage fabric material sewing,infant baby hats to knit caps cotton warm solid color ball sun,new deer knit baby bonnet with ears cartoon winter infant hat plush lining kids cap for 6 months 1 hats polo sun.. .na ...
immunocytochemistry and for alkaline phosphatase activity using nitroblue tetrazolium chloride/5-bromo- 4-chloro- 3- indolyl phosphate toluidine solution. The cancer cell-lines were then inoculated with recombinant myxoma virus expressing a red fluorescent protein and collected after 48-hours. Cytopathic effects were assessed at 24-hour and 48- hour time points via fluorescent microscopy. Ability of the virus to replicate within the cancer cells was confirmed via Western immunoblot detection of late MYXV protein production. The findings of this study suggest that canine osteosarcoma and soft tissue sarcoma primary cell cultures are lacking antiviral mechanisms and susceptible to MYXV infection leading to oncolysis. Viral-mediated oncolysis of cancer cells isolated from canine tumorsKirsha B Fredrickson and Amy L MacNeillDepartment of Microbiology, Immunology and Pathology, Colorado State UniversityThe three classic arms of cancer therapy are surgical resection, chemotherapeutics, andradiation. ...
National Institute of Advanced Studies. Indian Institute of Science Campus. Bangalore-12. OPEN DEFENCE OF THESIS. Title: Other Voices: Gestural Communication of Wild Bonnet Macaques Macaca radiata in the Bandipur National Park, Southern India. Candidate: Ms.Shreejata Gupta. School of Natural & Engineering Sciences. Adviser: Prof. Anindya Sinha. Date: Thursday, 14 January, 2016. Time: 11: 30 am. Venue: Lecture Hall, NIAS. Abstract: Human language is probably one of the most mysterious and intriguing of all behavioural expressions that one encounters in the living world. Although language is mostly viewed as expressed through spoken words alone, a crucial component of human language comprises gestural acts. It has been hypothesised that gestural communication is an evolutionarily older phenomenon, which developed much earlier than did speech in the modern human lineage. This evokes several important questions pertaining to the phylogeny of gestures in nonhuman primate species as well as the ...
Discover Burro Schmidt Tunnel in Randsburg, California: This impressive tunnel was dug entirely by hand over the course of 36 years.
通过广泛的科研,我们知道,宫颈粘液对生育至关重要。它能保护并培养精子,使其保持生育能力。它还能充当精子的通道,使精子穿越你的生殖系统,接触卵子并使其受精。并且它还能作为过滤器,毁灭不完美的精子细胞。 通过广泛的科研,我们知道,宫颈粘液对生育至关重要。它能保护并培养精子,使其保持生育能力。它还能充当精...
For ladies that love their feathers! The base is a simple red straw bonnet and then we add thick red boa all around the crown to make it truly special. A great addition to your red hat collection! Brim measures 5 in the front.
Agaricales Bonnet Euagaric Federal German Mossy Nature Republic The: 1 assigned downloads, like Mycena metata mushrooms, Untergroeningen, Baden-Wuerttemberg, Germany, Europe from stock-photos
Ballouard, J. M., Provost, G., Barre, D., & Bonnet, X. (2012). Influence of a Field Trip on the Attitude of Schoolchildren toward Unpopular Organisms An Experience with Snakes. Journal of Herpetology, 46, 423-428.
The study done on rats that found Polysorbate 80 had effects on fertility involved giving 100 mg of Polysorbate 80 to rats that were 4-7 days old. I cant find an exact weight on rats of this age, but I can find that newborn rats weigh 6-8 g. If we even assume that the rats double their birthweight to 12-16 g by 4-7 days old, we are then looking at dosing that is at best 6 mg per GRAM of body weight.. That would be 6000 mg per kg (6g/kg). So dosing that is approximately 2000 times higher than what is given in the Vitamin K injection. I think it is a pretty far stretch to think that these two doses have the same effects. In the particular video I was recently watching, the speaker made a distinction between injected vs injested administration…which is a fair point. But Ill also point out that in the rat study on fertility I linked to above, the Polysorbate 80 was injected into the rats. As far as oral dosing goes, Polysorbate 80 has been used in food products for over 50 years, and was ...
Learn about the potential side effects of FA-8 (folic acid). Includes common and rare side effects information for consumers and healthcare professionals.
... publications Kumari S, Bonnet MC, Ulvmar MH, Wolk K, Karagianni N, Witte E, Uthoff-Hachenberg C, Renauld JC, Kollias G, Toftgard R, Sabat R, Pasparakis M, Haase I; Immunity. 2013 Nov 14;39(5):899-911. doi: 10.1016/j.immuni.2013.10.009. Epub 2013 Nov 7. ...
I get the whole "go green" concept, but I also like to pay my bills on time. I have a system for my paper statements. They go in a pile and I pay them all at once. Im just not seeing myself doing as great of a job with a non-paper system, so this really put a bee in my bonnet ...
OVENTROP-Surface-mounted bonnet, long model for dwelling station Regudis W-HTU Dimensions (W x H x D): 496 mm x 1100 mm x 160 mm Item no.: 1341295 EAN...
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3 exons from the ZP3 gene. The 5 end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3 end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008 ...
Population explosion is one of the problems of developing countries today. This topic has been evaluated from different standpoints. From a family point of view a variety of contraceptive devices and medications have been devised and used. At present, the available mean in men is only vasectomy (surgical and non-surgical) barrier method ...
Working Smarter and Together for Wild Horses and Burros. Suzanne Roy, director, American Wild Horse Preservation Campaign. American Wild Horse Preservation Campaign Established: 2004 Goal: Unified Platform/Voice 45+ Coalition Partners. Expanding Our Grassroots Network. Slideshow...
We know from extensive scientific research that cervical mucus is essential for fertility. It protects and nourishes the sperm so they retain their fe...
A class of substituted 2-cycloalkylaminoalkylphenols, preferably D,L-6-(N-.alpha.-pipecolinomethyl)-5-hydroxyindane, enantiomers thereof and acid addition salts thereof have been found to exhibit oral antifertility activity in male aves and mammals. These compounds may therefore be utilized to induce temporary or non-reversible sterility in treated subjects.
Anonymous at 11:32, Nikki recently posted (maybe 2 days ago) about how much better her hair is with a twist and curl. She wasnt getting the volume she wanted with a plain twist out. Nikki, you know what I find works great for generating heat and is super easy? A winter hat!! I tried to get your micro heat cap last year and, as you said, it was discontinued. The reviews on the other options werent really that great. So, I never got one. So, if I dont have time to sit under the bonnet dryer for a DC, I put on my plastic baggie, sometimes Ill put on a satin scarf or bonnet (but not always), and throw on my winter hat. When I take it off, my head is hot/warm like I had on the bonnet. I love being able to DC with my own body heat! So, just wanted to post so people know its an option ...
Dipping generously into mythology, the good M said that the Nanos move from Singur in West Bengal to his state was like Krishnas birth.
Cheap toys, candies, and other useless junk-you do not want those things inside your childs birthday goodie bag. When you are planning your babys birthday party, do not waste your money and time on party favours that would most likely end up in the bin. Skip the traditional goodie bags for your little ones
J. Lacau St Guily (Paris), D. Chevalier (Lille), D. Dehesdin (Rouen), J. L. Dulucq (Bordeaux), V. Woisard (Toulouse), F. Zerbib (Bordeaux), S. Abbou Bonnet (Sète), Ph. Le Grignou (Brest), A. Perdu (Lorient), D. Vouge (Strasbourg) ...
J. Lacau St Guily (Paris), D. Chevalier (Lille), D. Dehesdin (Rouen), J. L. Dulucq (Bordeaux), V. Woisard (Toulouse), F. Zerbib (Bordeaux), S. Abbou Bonnet (Sète), Ph. Le Grignou (Brest), A. Perdu (Lorient), D. Vouge (Strasbourg) ...
J. Lacau St Guily (Paris), D. Chevalier (Lille), D. Dehesdin (Rouen), J. L. Dulucq (Bordeaux), V. Woisard (Toulouse), F. Zerbib (Bordeaux), S. Abbou Bonnet (Sète), Ph. Le Grignou (Brest), A. Perdu (Lorient), D. Vouge (Strasbourg) ...
J. Lacau St Guily (Paris), D. Chevalier (Lille), D. Dehesdin (Rouen), J. L. Dulucq (Bordeaux), V. Woisard (Toulouse), F. Zerbib (Bordeaux), S. Abbou Bonnet (Sète), Ph. Le Grignou (Brest), A. Perdu (Lorient), D. Vouge (Strasbourg) ...
Betco floor machines are engineered for easy use rugged durability and long lasting reliability. Each model comes standard with a heavy duty 1.5 hp motor to take on all cleaning jobs from scrubbing to stripping or carpet bonnet cleaning.. ...
How disappointing it is to hear a view point from this great organization that is based on conjecture and not facts. Are you aware that the park has never conducted a single study to back their claims that the burros do damage? Not one. We have asked. Are you also aware that TPWD is not stopping with the burro? In fact, they are determined to kill ALL of our federally protected national heritage species the wild burro, along with ALL the native elk, and the globally critically endangered aoudad who are found on state-owned land. Add to the carnage the snaring and killing of all bobcat and cougar found near bighorn habitat, and you have a recipe for ecosystem collapse. The burro who did originate in North America also evolved with the fauna found on this continent, and is in fact known as natures gardener. They have simply refilled their niche. Why is that? Because they are a mono-gastric digester unlike the ruminants who comprise the other large ungulates in the region. Because they do not ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Big Bear Lake - A mountain landscape left parched and depleted of vegetation due to one of the driest winters on record may be to blame for an influx of wild burros into residential neighborhoods for food and water. An earlier influx left about 20 burros killed by vehicles on roads, and in 1997, a plan was established to capture burros in residential areas and have them corralled and put up for adoption through the Bureau of Land Managements Wild Horse and Burro Program. About 90 burros were captured and adopted by private parties through the program, which reduced the burro population in the mountains to a sustainable level,.... ...
ADDIS ABABA. - The African Union Commission in collaboration with the World Health Organisation and other key immunisation development partners, will today hold the first ever ministerial conference on immunisation in Africa, at its headquarters in the Ethiopian capital, Addis Ababa.. According to a statement issued by the AU Commisions directorate of information and communication, the conferences general objective will be, "to secure the commitment of governments and their partners to reach and sustain the required immunisation quality and coverage as stipulated in the GAVP and the Regional Strategic Plan for Immunisation 2014-2020 so as to eradicate, eliminate and control vaccine preventable diseases in the overall context of health system strengthening in Africa." ...
... - Heartbreaking Dawns uses only the finest natural ingredients to bring you this Caribbean style hot sauce. Combining the fiery scotch bonnet pepper with the bold foundation of papaya, mustard, turmeric, onion powder, granulated garlic and chives,
To evaluate one-year data on the contraceptive efficacy and safety of the 150/15 NES/EE CVR as the basis for regulatory approvals of this CVR as a new delivery system for contraception ...
Date: 21 Jan 94 13:40:55 GMT What follows is a chapter from Martin Lee and Bruce Shlains book, Acid Dreams_. The book is a terrific read. The following selection is chapter 1, which examines the development of the CIAs interest in the mysterious new drug, LSD. It is alternately funny, disgusting, and horrific. Lemme give you a preview of what follows. At first, the CIA thought LSD would make them virtual masters of the universe. Later, after sober second thought, they realized they might have to set their sights little lower, but they continued their enthusiasm for the drug (which Richard Helms called "dynamite"). The CIA realized that an adversary intelligence service could employ LSD "to produce anxiety or terror in medically unsophisticated subjects unable to distinguish drug-induced psychosis from actual insanity". The only way to be sure that an operative would not freak out under such circumstances would be to give him a taste of LSD (a mind control vaccine?) before he was sent on a ...
There is a growing need for data on contraceptive efficacy in obese women. This article details the current state of knowledge in this regard.
View the rock climbing photo titled Sangre en greatgarbanzo, in El Burro on Rockclimbing.com. Check out more photos or add comments.
You can use various methods of birth control options like: Pregnancy prevention, family planning, fertility control, contraception, etc. If you are a
This week I am over at Scientific American talking about a topic that just fascinates me, Charles Bonnet Syndrome. This is a condition that I happened to stumble upon while researching something else. I have never seen a patient with it but know of other eye docs who have and the stories that their patients…
Free OHV area maps, driving directions, regulations, fees and camping information for Bonnet Carre Spillway in Louisiana. (LA trails and MX tracks)
Engage in a deadly duel of the minds as FBI agent Nicole Bonnet finds herself tracking down a coldblooded serial killer who leaves playing cards near his victims.
The new compact 5008 MPV is Peugeot's fourth new offering this year. They're really putting their foot down at Peugeot. Despite the credit crunch, new registrations are up for the French manufacturer with the lion on the bonnet. Their success
In 2001, the New Scientist (4) published an article on a deadly virus created accidentally by an Australian research team trying to genetically engineer a contraceptive vaccine for mice."They spliced a gene for the protein interleukin-4 (IL-4) into the relatively harmless mousepox virus (ectromelia virus) in the hope that IL-4 would boost the immune system to make more antibodies. When the researchers injected this vaccine into mice, all the mice died. In fact, this synthetic virus was so lethal that it also killed half of all the mice that had been vaccinated against mousepox.The work published in the Journal of Virology (http://jvi.asm.org/content/75/3/1205.long) revealed that hte mice used were genetically resistant to the mousepox viruis in the first place. Genetic resistance to mousepox varies among inbred laboratory mice, and depends on natural killer (NK) cells and cytotoxic T-lymphocytes (CTL) responses to viral infection, both of which destroy cells that have been infected with virus so ...
In 2001, the New Scientist (4) published an article on a deadly virus created accidentally by an Australian research team trying to genetically engineer a contraceptive vaccine for mice."They spliced a gene for the protein interleukin-4 (IL-4) into the relatively harmless mousepox virus (ectromelia virus) in the hope that IL-4 would boost the immune system to make more antibodies. When the researchers injected this vaccine into mice, all the mice died. In fact, this synthetic virus was so lethal that it also killed half of all the mice that had been vaccinated against mousepox.The work published in the Journal of Virology (http://jvi.asm.org/content/75/3/1205.long) revealed that hte mice used were genetically resistant to the mousepox viruis in the first place. Genetic resistance to mousepox varies among inbred laboratory mice, and depends on natural killer (NK) cells and cytotoxic T-lymphocytes (CTL) responses to viral infection, both of which destroy cells that have been infected with virus so ...
www.MOLUNA.de The Antiprogestin Steroid RU 486 and Human Fertility Control [4202858] - Ru 486: An Antiprogestin Steroid With Contragestive Activity In Women.- Analogues Of Ru 486 For The Mapping Of The Progestin Receptor: Synthetic And Structural Aspects.- Pharmacological Profile Of Ru 486 In Animals.- The Use Of The Antiprogesterone Compound Ru 486 To Control Timing Of Parturition In Rats.- In Vivo Assessment
The animals seemed to realise they had working organs again - the 12 with the grafts tried to mate with female rabbits within one minute of being put into cages with them, and four of the female rabbits became pregnant.. Those with the scaffolding alone and no working tissue did not even try.. Atala is hoping the procedure will work with people, perhaps starting with adult men who have had damage to their organs.. "Patients with congenital anomalies, penile cancer, traumatic penile injury, and some types of organic erectile dysfunction could benefit from this technology in the future," the team write in the report.. The process takes six weeks from beginning to end, says Atala, and there is reason to believe a penis grafted onto a baby would grow with the child.. Atala hopes the approach will work with other organs. "We have made clitoral tissue in the past," he says. "We have extensive work going on with kidneys and livers.". The team started their experiments with replacement bladders grown ...
This paper presents a semirigid (SR) bonnet tool which has the advantages of high efficiency and determinacy for material removal on optical elements and also has the potential to be used on aspheric optics. It consists of three layers: a metal sheet, a rubber membrane, and a polishing pad, from inside to outside. It inherits the flexibility of a normal bonnet but has a higher stiffness. Finite element analysis was performed to determine that the stainless steel is the best-suited material for use as the metal sheet. An SR bonnet with a stainless-steel metal sheet was fabricated and tested. Its tool influence function (TIF) is Gaussian-like, and the TIF stability is more than 90%. The peak-to-valley of its uniform removal area is less than 0.1λ. Tool ripples are highly depressed and the surface profile is well preserved in the prepolishing test. In 12 min, ∼36 mm3 of material is removed ...
Before the roundup, the bureau estimated that there were about 2,300 wild horses and more than 200 burros living on the Twin Peaks range, which covers 789,852 acres. The agency felt that the population exceeded appropriate management levels by 1,800 horses and 200 burros. If left alone, the bureau felt that the increasingly unsustainable population would seriously degrade the surrounding environment ...
No child should ever need a chemo cap....I hope this pattern will bring a bit of a smile to your little one. I serged the hem of this hat to create a scalloped edge and added decorative stitching and lace trim . Comfy and soft, 100% cotton. Tried my best to make it both adorable and affordable.
DNAinfo New York: New Yorks leading neighborhood news source-covering entertainment, education, politics, crime, sports, and dining.
Tuesday I was in training all day at work and after I took the Man out for his birthday. he wanted to keep it low-key so we walked to The Painted Burro in Davis and had tacos and tequila drinks. It was a million degrees here on Tuesday so we chose that night to try out the new houses central air. Much to our delight it works! If it didnt work we might never be able to sleep again because our third floor bedroom seems to just absorb all of the heat in the world ...
An interior view of a bedroom in a building at Shakertown in Pleasant Hill, Ky. A woman wearing a dress, apron, scarf, and bonnet sits next to a fireplace in a rocking chair working on a blanket. The room is sparsely decorated with a bed, two small ...
Use Bio-Rads PrimePCR assays, controls, templates for your target gene. Every primer pair is optimized, experimentally validated, and performance guaranteed.
SINGAPORE: A man blocked a parking lot for the handicapped with his vehicle and later slammed his elbow onto the bonnet of a car that was entitled ...
MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLPGAQLPAAGGR 1 - 70 GNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGAEANHLHESDAQIENCNNILA 71 - 140 KERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEEILYNLGFGRDEPDIASKIPSRFFNSSSF 141 - 210 AKGIDIKVFLSAQMQRMEVENPNYALTSRFRQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKET 211 - 280 DPPPPLTRSNTANRLMKTLSKLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKK 281 - 350 ESSSMLATVKEEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD 351 - 420 FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAPHVPATYQLGL 421 - 490 TKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSCDSETTVTSLGEDLATPTAQD 491 - 560 QPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCNTIENTGTKQSTCSPGDHIIEITEVEEDLFP 561 - 630 AETVELLREASAESDVGKSSESEFTQYTTHHILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQM 631 - 700 KVCSLSNQRMGRSLLKSKDLLKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPS 701 - 770 FTYKYTPEEEQELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS 771 - 840 ...
Nejrozsáhlejší zpěvník s akordy na českém internetu. Obsahuje okolo 27000 písní všech žánrů. Možnost vytvořit a stáhnout vlastní zpěvník.
Nejrozsáhlejší zpěvník s akordy na českém internetu. Obsahuje okolo 27000 písní všech žánrů. Možnost vytvořit a stáhnout vlastní zpěvník.
In this paper we use mathematical modelling to consider the broad advantages and disadvantages of fertility control over lethal control for bovine tuberculosis in badger populations.. We use a deliberately simple model, attempting to capture only the key transmission processes. The model is parametrized with reference to the long-term Woodchester Park study. Estimates of mortality rate from this study suggest no significant extra mortality risk for animals with evidence of infection as indicated by the presence of anti-Mycobacterium bovis antibodies or M. bovis isolation.. We find that large reductions in prevalence are sometimes the consequence of only moderate reductions in population numbers. If we assume that the act of control does not in itself affect transmission rates, then as far as eradication is concerned, both fertility control and mortality control operate through the same epidemiological mechanism, the removal of susceptibles: if one is in principle capable of keeping a population ...
Passive administration of antibodies to 80kDa HSA and its peptides NT, 1, 2 and 4 resulted in agglutination of epididymal spermatozoa with loss of motility but had no effect on sperm count or weights of the reproductive organs. These animals failed to impregnate normal female rats. Passive administration of these antibodies to female rats also resulted in infertility. The presence of antibodies was detected by enzyme-linked immunosorbent assay in uterine secretions of animals treated with antipeptide antibody. The presence of agglutinated spermatozoa was observed in the post-coital vaginal smears of these animals. The immunized females were found to be ovulating normally and the number of corpora lutea were unaltered. Of the four antipeptide antibodies studied, antibodies to peptides NT and 1 were most effective in inhibiting fertility both in male as well as female rats. Hence, the antifertility studies were further confirmed by passive administration of 10 and 40 μg of purified ...
Patricia Donahoe and David Pepin of Massachusetts General Hospital in the U.S. are using a cell-based screening platform to develop a new class of hormonal contraceptive that works at the early stage of primordial follicle activation to prolong the contraceptive effect and reduce side effects, thereby promoting wider use particularly in the developing world. This early stage of follicle development in the ovary is suppressed by a hormone (Mullerian inhibiting substance or MIS) to regulate egg production. They considered that a drug that could mimic MIS could completely suppress ovulation and act as a powerful contraceptive. In contrast, most available hormonal contraceptives work once ovulation has begun, thereby requiring daily dosage, and share unwanted side effects including migraine and increased risk of some diseases. In Phase I, they designed a luciferase-based screening platform using engineered mammalian cells and screened 5,500 compounds from which they validated three candidate ...
Reproductive control in wildlife management has been assessed for several decades across multiple species. Its use has gained more attention as the public has become more interested in wildlife management decisions. For reproductive control agents to effectively reduce deer population size, they must decrease the reproductive rate to less than the mortality rate. In urban deer populations, mortality rates are generally very low (approximately 10%). Also, to control the growth of the deer population, it is necessary to treat 70%-90% of the female deer with a highly effective product to successfully reduce or halt population growth in a closed population without immigration or emigration (Rudolph, Porter, and Underwood 2000; Hobbs, Bowden, and Baker 2000). The science and understanding of fertility control are evolving. The most updated information about fertility control is summarized in appendix D. The terms fertility control and reproductive control are used synonymously in this ...
Yesterday I was chastised by an irate Jamaican for putting scotch bonnet chillies in my salsa that were destined for his salt fish and yam stew. This weeks newsletter is being tapped out in my increasingly decrepit 1973 converted bus at the 2011 WOMAD festival, where for four years weve sponsored the Taste the World stage. Here, after performing on the main stages, musicians come to play, tell stories and share their food in a more intimate atmosphere. It seems a lot of musicians like to sing as they cook, and while the foods always different, its not always as good as the music; Mongolian lamb dumplings and salt fish and yam stew were both wonderful (the Jamaican cook, Ripton Lindsay, got his scotch bonnets back in the end), but I didnt take seconds of Mongolian mutton stewed in fermented mares milk.. Food is as much a part of our culture as music, and has developed in a similar way; cooking skills are largely picked up in the home, building through repetition to feed our souls and our ...
The burro who lives in the treespotted field across the country highway from my house makes a sound so plaintive, so rich! Many a person, walking into or out of my home has had cause to stop still in their tracks, turn to me and say, "What is that thing?" I always say, "Thats the burro." What I really want to do is get the burro in full guffaw on video, but I cannot coax him into performing for the camera. When he does let forth the guttural plaint it is without fail an impromptu event, as I come or go from the house, thinking no burro-related thoughts--and out of the blue he splits the world with his madcap noise! On the few occasions I have walked across the road and up to his fence with my camera in hand, eye to eye with him in the dusty corner of the field in which he inexplicably makes home (the rest of the field is so green and shaded!, yet he stays in the barren, desolate far corner of this field, the corner closest my home), and when I begin to roll tape on the blue velvety eeyore in ...
What do I think? I think youre amazing! I especially love the very last one and the heart one. They are gorgeous and I love what you do with the ribbons. So much talent in your one little finger. I envy you!!!. ReplyDelete ...
German tuning company Pogea have managed to cram 301kW (no thats not a joke) under the bonnet of a Fiat 500 Abarth and renamed it the Pogea Ares
If you have possums, its important to understand their behavior. When you understand how possums live, possum removal is much easier.
The agency, which manages the burros, has launched a campaign it hopes will eventually steer the burros back into the desert to forage for grass and shrubs - and get them back into shape. The town of about 120 also boasts staged shootouts, tour bus holdups and shotgun weddings in a throwback to the Wild West. The dozen burros that roam the street lined with antique, craft and gift shops are descendants of domesticated donkeys that miners released when the federal government shut down the gold mines after World War II. The BLM also has drafted scripts for gunfighters and shop owners that tell tourists quite bluntly that the burros are fat and are being loved to death. The BLM says the burros that dont come into town are a lot healthier and dont have behavioral problems or pain caused by their hooves growing to a thickness that makes it hard for them to walk. The animals have been demanding, lately, kicking in the door to her gift shop and chewing at the door panel and on books because theyre not
Other Course Information A. Objectives To provide students with an advanced knowledge of the pathogenesis, the epidemiology and the immunology of vaccine-preventable diseases, highlighting the strengths and limitations of each type of vaccine. To facilitate understanding the principles of implementing immunization programs for emerging and tropical neglected diseases. To enable students to analyze new public health strategies concerning vaccine preventable diseases in developed and developing countries. B. Learning Outcomes 1. To know the characteristics of the main vaccines recommended by the Centers for Disease Control and Prevention as well as vaccines used for special populations. 2 To critically analyze new vaccines included in the Centers for Disease Control Vaccines List as well as new vaccines for neglected diseases. 3. To be able to analyze and design immunization programs and strategies. C. Major Topics 1.Vaccines as a Practical Tool in Public Health: Smallpox and Jenner, Polio and ...
Have you noticed how surveys frequently paint men as complete duckwits? Honestly, its puerile, sexist and thered be an outcry if it were the other way round. Still, it is January, so lets treat ourselves, eh? This time, its ignorance of body parts of which males stand accused. Not female bits, but their own. Specifically the dangly ones. The average chap knows more about car parts than he does about his meat and two veg, says a pharmacy study. Many can give you chapter and verse about the dipstick under the bonnet, but little about the one in their Y-fronts. Valve springs, yes; vas deferens, no. Evaporator, yes; epididymis, no. OK, I think weve exhausted that game now. Its hard enough to believe that a…. ...
Stainless Steel Severe Service Union Bonnet Needle Valve, 0.86 Cv, 3/8 in. Tube Fitting, Ball Stem, Grafoil Packing, Hydrostatic Test
Birth, Concentrations, Plasma, Temperature, Temperatures, Oxygen, Snake, Sodium, Water, Adult, Cavia, Cortisol, Guinea Pigs, Handling, Mammals, Parturition, Pigs, Pregnancy, Thermoregulation, Tissues

Sperm Antigens, Immunologic Infertility and Contraception | SpringerLinkSperm Antigens, Immunologic Infertility and Contraception | SpringerLink

Immunologic Infertility and Contraception. In: Talwar G.P. (eds) Immunological Approaches to Contraception and Promotion of ... Immunological Approaches to Contraception and Promotion of Fertility pp 151-154 , Cite as ... However, this study definitely showed the iso-antigenicity of human sperm in women and that the concept of an immunologic ... As early as the 1920s speculation arose concerning the possible role of immunologic reactions involving sperm in human ...
more infohttps://link.springer.com/chapter/10.1007/978-1-4684-5140-5_18

Contraceptive vaccines targeting factors involved in establishment of pregnancy.Contraceptive vaccines targeting factors involved in establishment of pregnancy.

A more specific method of contraception is needed. Contraceptive vaccines can provide most, if not all, the desired ... Current methods of contraception lack specificity and are accompanied with serious side effects. ... Contraception, Immunologic / methods*. Contraceptive Agents / immunology. Cytokines / immunology. Databases, Genetic. Embryo ... Current methods of contraception lack specificity and are accompanied with serious side effects. A more specific method of ...
more infohttp://www.biomedsearch.com/nih/Contraceptive-Vaccines-Targeting-Factors-Involved/21481058.html

List of MeSH codes (E02) - WikipediaList of MeSH codes (E02) - Wikipedia

... contraception, barrier MeSH E02.875.194.300 --- contraception, immunologic MeSH E02.875.194.540 --- contraception, postcoital ... immunologic MeSH E02.095.520.450.440 --- graft enhancement, immunologic MeSH E02.095.520.450.521 --- lymphocyte depletion MeSH ...
more infohttps://en.wikipedia.org/wiki/List_of_MeSH_codes_(E02)

Evaluation of two sperm antigens, rSMP-B and YWK-II, as targets for immunocontraception.  - PubMed - NCBIEvaluation of two sperm antigens, rSMP-B and YWK-II, as targets for immunocontraception. - PubMed - NCBI

Contraception, Immunologic/methods*. *Female. *Fertilization in Vitro/drug effects. *Humans. *Immune Sera/immunology ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/11358321

Is Absence of Spontaneous Agglutinates of Spermatozoa in Semen a Reliable Indicator of Non-Autosensization against Human Sperm...Is Absence of Spontaneous Agglutinates of Spermatozoa in Semen a Reliable Indicator of Non-Autosensization against Human Sperm...

Shulman, S., Zappi, E., Ahmed, U. and Davis, J.E. (1972) Immunologic Consequences of Vasectomy. Contraception, 5, 269-278. http ...
more infohttps://www.scirp.org/journal/paperinformation.aspx?paperid=71809

Welcome to CDC stacksWelcome to CDC stacks

Contraception, Immunologic Female HIV Infections Humans Male Spermatocidal Agents Vaccines * * Pubmed ID: ...
more infohttps://stacks.cdc.gov/view/cdc/64042

Welcome to CDC stacksWelcome to CDC stacks

Contraception, Immunologic Female HIV Infections Humans Male Spermatocidal Agents Vaccines * * Pubmed ID: ...
more infohttps://stacks.cdc.gov/view/cdc/64042/Email

Depot Contraception With and Without Lopinavir/Ritonavir - Full Text View - ClinicalTrials.govDepot Contraception With and Without Lopinavir/Ritonavir - Full Text View - ClinicalTrials.gov

Immunologic Deficiency Syndromes. Immune System Diseases. Ritonavir. Lopinavir. Medroxyprogesterone Acetate. HIV Protease ... Injectable contraception provides highly effective contraception without the need for daily pill taking, an important factor to ... Depot Contraception With and Without Lopinavir/Ritonavir. The safety and scientific validity of this study is the ... No current hormonal contraception (short acting methods eg oral contraceptive pills and patches can be removed at screening) ...
more infohttps://clinicaltrials.gov/show/NCT01231451?order=113

Depot Contraception With and Without Lopinavir/Ritonavir - Full Text View - ClinicalTrials.govDepot Contraception With and Without Lopinavir/Ritonavir - Full Text View - ClinicalTrials.gov

Immunologic Deficiency Syndromes. Immune System Diseases. Ritonavir. Lopinavir. Medroxyprogesterone Acetate. HIV Protease ... Injectable contraception provides highly effective contraception without the need for daily pill taking, an important factor to ... Depot Contraception With and Without Lopinavir/Ritonavir. The safety and scientific validity of this study is the ... No current hormonal contraception (short acting methods eg oral contraceptive pills and patches can be removed at screening) ...
more infohttps://clinicaltrials.gov/show/NCT01231451?order=255

SPAG8 Gene - GeneCards | SPAG8 Protein | SPAG8 AntibodySPAG8 Gene - GeneCards | SPAG8 Protein | SPAG8 Antibody

Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, ...
more infohttp://www.genecards.org/cgi-bin/carddisp.pl?gene=SPAG8

SPAG1 gene - Genetics Home Reference - NIHSPAG1 gene - Genetics Home Reference - NIH

Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, ...
more infohttps://ghr.nlm.nih.gov/gene/SPAG1

How to smell BS | YCPMicroHow to smell BS | YCPMicro

Analogous methods for male contraception (hormonal or immunologic approaches) I think are currently irreversible, and I dont ...
more infohttps://bio230fall2010.wordpress.com/2011/11/17/how-to-smell-bs/

Sperm-associated antigen 1 - WikipediaSperm-associated antigen 1 - Wikipedia

Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, ...
more infohttps://en.wikipedia.org/wiki/Sperm-associated_antigen_1

WHO HQ Library catalog › Details for: Vaccination against pregnancyWHO HQ Library catalog › Details for: Vaccination against pregnancy

Contraception, Immunologic -- methods , Vaccines , Family Planning and Human ReproductionNLM classification: WP 630 ...
more infohttps://kohahq.searo.who.int/cgi-bin/koha/opac-detail.pl?biblionumber=3826&shelfbrowse_itemnumber=4304

WHO HQ Library catalog › Details for: Vaccination against pregnancyWHO HQ Library catalog › Details for: Vaccination against pregnancy

Contraception, Immunologic -- methods , Vaccines , Family Planning and Human ReproductionNLM classification: WP 630 ...
more infohttps://kohahq.searo.who.int/cgi-bin/koha/opac-detail.pl?biblionumber=3826

Search Articles | University of Toronto LibrariesSearch Articles | University of Toronto Libraries

Contraception, Immunologic - methods , Protein Subunits - antagonists & inhibitors , Neoplasms - pathology , Chorionic ... recombinant antibodies , vaccines , contraception , immunotherapy , Cancer , Contraception , Vaccines , Recombinant antibodies ...
more infohttps://query.library.utoronto.ca/index.php/search/q?kw=SubjectTerms:Invasiveness&sort=PublicationDate:asc

SPAG1 - ddPCR Probe - Digital PCR | PrimePCR | Bio-RadSPAG1 - ddPCR Probe - Digital PCR | PrimePCR | Bio-Rad

Improved diagnosis and treatment of immunologic infertility as well as identification of proteins for targeted contraception ...
more infohttps://www.bio-rad.com/en-us/prime-pcr-assays/assay/dhsacpe5033993-primepcr-ddpcr-expression-probe-assay-spag1-human

Trastuzumab in Treating Patients With Stage IIIB or Stage IV Non-small Cell Lung Cancer That Overexpresses HER2Trastuzumab in Treating Patients With Stage IIIB or Stage IV Non-small Cell Lung Cancer That Overexpresses HER2

Fertile patients must use effective contraception. - HIV negative. - No concurrent immunologic disease (e.g., autoimmune ...
more infohttp://www.knowcancer.com/cancer-trials/NCT00004883/

Immunologic tolerance | definition of immunologic tolerance by Medical dictionaryImmunologic tolerance | definition of immunologic tolerance by Medical dictionary

What is immunologic tolerance? Meaning of immunologic tolerance medical term. What does immunologic tolerance mean? ... Looking for online definition of immunologic tolerance in the Medical Dictionary? immunologic tolerance explanation free. ... immunological contraception. *immunological contraception. *immunological contraception. *Immunological deficiency. * ... immunologic tolerance. Also found in: Dictionary, Thesaurus, Legal, Encyclopedia.. Related to immunologic tolerance: oral ...
more infohttp://medical-dictionary.thefreedictionary.com/immunologic+tolerance

Jared Baeten | University of Washington - Department of Global HealthJared Baeten | University of Washington - Department of Global Health

... collaborative studies of immunologic and virologic factors that influence HIV-1 transmission. He also directs the UW/Fred Hutch ... studies exploring use of hormonal contraception as a risk factor for HIV-1 (including co-chairing the ECHO Study), and d) ...
more infohttps://globalhealth.washington.edu/faculty/jared-baeten

Public Health Service Task Force Recommendations for the Use of
Antiretroviral Drugs in Pregnant Women Infected with HIV-1 for...Public Health Service Task Force Recommendations for the Use of Antiretroviral Drugs in Pregnant Women Infected with HIV-1 for...

Data from follow-up of PACTG 076 infants from birth through age 18-36 months do not indicate any differences in immunologic, ... services that continue after pregnancy for their own medical care and for assistance with family planning and contraception. ... Such considerations include gestational age of the fetus; the womans clinical, immunologic, and virologic status; and the ... HIV-1-infected pregnant women must receive standard clinical, immunologic, and virologic evaluation. Recommendations for ...
more infohttps://www.cdc.gov/mmwr/preview/mmwrhtml/00053202.htm

Boron Neutron Capture Therapy Using Boronophenylalanine-Fructose Complex in Treating Patients With Metastatic MelanomaBoron Neutron Capture Therapy Using Boronophenylalanine-Fructose Complex in Treating Patients With Metastatic Melanoma

Fertile patients must use effective contraception. PRIOR CONCURRENT THERAPY:. Biologic therapy. - No concurrent immunologic or ...
more infohttp://www.knowcancer.com/cancer-trials/NCT00085059/
  • A study of 59 women on DMPA contraception plus an unboosted PI (nelfinavir) or an NNRTI (efavirenz or nevirapine) measured DMPA levels and compared them with 16 women on either no therapy or NRTIs only (no potential for drug interaction). (clinicaltrials.gov)
  • Throughout the world, the most common form of reversible contraception is the intrauterine device (IUD), used by 85 million to 100 million women. (aafp.org)