A contactin subtype that is predominantly expressed in the CEREBELLUM; HIPPOCAMPUS; NEOCORTEX; and HYPOTHALAMUS.
A family of immunoglobulin-related cell adhesion molecules that are involved in NERVOUS SYSTEM patterning.
A contactin subtype that plays a role in axon outgrowth, axon fasciculation, and neuronal migration.
Surface ligands that mediate cell-to-cell adhesion and function in the assembly and interconnection of the vertebrate nervous system. These molecules promote cell adhesion via a homophilic mechanism. These are not to be confused with NEURAL CELL ADHESION MOLECULES, now known to be expressed in a variety of tissues and cell types in addition to nervous tissue.
Regularly spaced gaps in the myelin sheaths of peripheral axons. Ranvier's nodes allow saltatory conduction, that is, jumping of impulses from node to node, which is faster and more energetically favorable than continuous conduction.
A voltage-gated sodium channel subtype that mediates the sodium ion permeability of excitable membranes. Defects in the SCN2A gene which codes for the alpha subunit of this sodium channel are associated with benign familial infantile seizures type 3, and early infantile epileptic encephalopathy type 11.
Hexameric extracellular matrix glycoprotein transiently expressed in many developing organs and often re-expressed in tumors. It is present in the central and peripheral nervous systems as well as in smooth muscle and tendons. (From Kreis & Vale, Guidebook to the Extracellular Matrix and Adhesion Proteins, 1993, p93)
A subclass of receptor-like protein tryosine phosphatases that contain an extracellular fibronectin III-like domain along with a carbonic anhydrase-like domain.
A voltage-gated sodium channel subtype found in neuronal tissue that mediates the sodium ion PERMEABILITY of excitable membranes.
A BRAIN-specific hyalectin that may play a role in terminally differentiating NEURONS. It is found highly overexpressed in primary BRAIN TUMORS and in experimental models of GLIOMA.
Nerve fibers that are capable of rapidly conducting impulses away from the neuron cell body.
In tissue culture, hairlike projections of neurons stimulated by growth factors and other molecules. These projections may go on to form a branched tree of dendrites or a single axon or they may be reabsorbed at a later stage of development. "Neurite" may refer to any filamentous or pointed outgrowth of an embryonal or tissue-culture neural cell.
The lipid-rich sheath surrounding AXONS in both the CENTRAL NERVOUS SYSTEMS and PERIPHERAL NERVOUS SYSTEM. The myelin sheath is an electrical insulator and allows faster and more energetically efficient conduction of impulses. The sheath is formed by the cell membranes of glial cells (SCHWANN CELLS in the peripheral and OLIGODENDROGLIA in the central nervous system). Deterioration of the sheath in DEMYELINATING DISEASES is a serious clinical problem.
A compound that contains a reduced purine ring system but is not biosynthetically related to the purine alkaloids. It is a poison found in certain edible mollusks at certain times; elaborated by GONYAULAX and consumed by mollusks, fishes, etc. without ill effects. It is neurotoxic and causes RESPIRATORY PARALYSIS and other effects in MAMMALS, known as paralytic SHELLFISH poisoning.
A class of nerve fibers as defined by their structure, specifically the nerve sheath arrangement. The AXONS of the myelinated nerve fibers are completely encased in a MYELIN SHEATH. They are fibers of relatively large and varied diameters. Their NEURAL CONDUCTION rates are faster than those of the unmyelinated nerve fibers (NERVE FIBERS, UNMYELINATED). Myelinated nerve fibers are present in somatic and autonomic nerves.
Ion channels that specifically allow the passage of SODIUM ions. A variety of specific sodium channel subtypes are involved in serving specialized functions such as neuronal signaling, CARDIAC MUSCLE contraction, and KIDNEY function.
The non-neuronal cells of the nervous system. They not only provide physical support, but also respond to injury, regulate the ionic and chemical composition of the extracellular milieu, participate in the BLOOD-BRAIN BARRIER and BLOOD-RETINAL BARRIER, form the myelin insulation of nervous pathways, guide neuronal migration during development, and exchange metabolites with neurons. Neuroglia have high-affinity transmitter uptake systems, voltage-dependent and transmitter-gated ion channels, and can release transmitters, but their role in signaling (as in many other functions) is unclear.
Surface ligands, usually glycoproteins, that mediate cell-to-cell adhesion. Their functions include the assembly and interconnection of various vertebrate systems, as well as maintenance of tissue integration, wound healing, morphogenic movements, cellular migrations, and metastasis.
Direct contact of a cell with a neighboring cell. Most such junctions are too small to be resolved by light microscopy, but they can be visualized by conventional or freeze-fracture electron microscopy, both of which show that the interacting CELL MEMBRANE and often the underlying CYTOPLASM and the intervening EXTRACELLULAR SPACE are highly specialized in these regions. (From Alberts et al., Molecular Biology of the Cell, 2d ed, p792)
A nerve which originates in the lumbar and sacral spinal cord (L4 to S3) and supplies motor and sensory innervation to the lower extremity. The sciatic nerve, which is the main continuation of the sacral plexus, is the largest nerve in the body. It has two major branches, the TIBIAL NERVE and the PERONEAL NERVE.
The 5th and largest cranial nerve. The trigeminal nerve is a mixed motor and sensory nerve. The larger sensory part forms the ophthalmic, mandibular, and maxillary nerves which carry afferents sensitive to external or internal stimuli from the skin, muscles, and joints of the face and mouth and from the teeth. Most of these fibers originate from cells of the TRIGEMINAL GANGLION and project to the TRIGEMINAL NUCLEUS of the brain stem. The smaller motor part arises from the brain stem trigeminal motor nucleus and innervates the muscles of mastication.
The basic cellular units of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the NERVOUS SYSTEM.
A class of large neuroglial (macroglial) cells in the central nervous system. Oligodendroglia may be called interfascicular, perivascular, or perineuronal (not the same as SATELLITE CELLS, PERINEURONAL of GANGLIA) according to their location. They form the insulating MYELIN SHEATH of axons in the central nervous system.
A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.
Multi-subunit proteins which function in IMMUNITY. They are produced by B LYMPHOCYTES from the IMMUNOGLOBULIN GENES. They are comprised of two heavy (IMMUNOGLOBULIN HEAVY CHAINS) and two light chains (IMMUNOGLOBULIN LIGHT CHAINS) with additional ancillary polypeptide chains depending on their isoforms. The variety of isoforms include monomeric or polymeric forms, and transmembrane forms (B-CELL ANTIGEN RECEPTORS) or secreted forms (ANTIBODIES). They are divided by the amino acid sequence of their heavy chains into five classes (IMMUNOGLOBULIN A; IMMUNOGLOBULIN D; IMMUNOGLOBULIN E; IMMUNOGLOBULIN G; IMMUNOGLOBULIN M) and various subclasses.
Crystallizable fragments composed of the carboxy-terminal halves of both IMMUNOGLOBULIN HEAVY CHAINS linked to each other by disulfide bonds. Fc fragments contain the carboxy-terminal parts of the heavy chain constant regions that are responsible for the effector functions of an immunoglobulin (COMPLEMENT fixation, binding to the cell membrane via FC RECEPTORS, and placental transport). This fragment can be obtained by digestion of immunoglobulins with the proteolytic enzyme PAPAIN.
Neuroglial cells of the peripheral nervous system which form the insulating myelin sheaths of peripheral axons.
The developmental entity of a fertilized chicken egg (ZYGOTE). The developmental process begins about 24 h before the egg is laid at the BLASTODISC, a small whitish spot on the surface of the EGG YOLK. After 21 days of incubation, the embryo is fully developed before hatching.
A class of drugs that act by inhibition of sodium influx through cell membranes. Blockade of sodium channels slows the rate and amplitude of initial rapid depolarization, reduces cell excitability, and reduces conduction velocity.
An enzyme group that specifically dephosphorylates phosphotyrosyl residues in selected proteins. Together with PROTEIN-TYROSINE KINASE, it regulates tyrosine phosphorylation and dephosphorylation in cellular signal transduction and may play a role in cell growth control and carcinogenesis.
Adherence of cells to surfaces or to other cells.
CELL LINE derived from the ovary of the Chinese hamster, Cricetulus griseus (CRICETULUS). The species is a favorite for cytogenetic studies because of its small chromosome number. The cell line has provided model systems for the study of genetic alterations in cultured mammalian cells.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action during the developmental stages of an organism.
Sensory ganglia located on the dorsal spinal roots within the vertebral column. The spinal ganglion cells are pseudounipolar. The single primary branch bifurcates sending a peripheral process to carry sensory information from the periphery and a central branch which relays that information to the spinal cord or brain.
Cell surface proteins that bind signalling molecules external to the cell with high affinity and convert this extracellular event into one or more intracellular signals that alter the behavior of the target cell (From Alberts, Molecular Biology of the Cell, 2nd ed, pp693-5). Cell surface receptors, unlike enzymes, do not chemically alter their ligands.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
A family of conserved cell surface receptors that contain EPIDERMAL GROWTH FACTOR repeats in their extracellular domain and ANKYRIN repeats in their cytoplasmic domains. The cytoplasmic domain of notch receptors is released upon ligand binding and translocates to the CELL NUCLEUS where it acts as transcription factor.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Diseases characterized by loss or dysfunction of myelin in the central or peripheral nervous system.
Large, noncollagenous glycoprotein with antigenic properties. It is localized in the basement membrane lamina lucida and functions to bind epithelial cells to the basement membrane. Evidence suggests that the protein plays a role in tumor invasion.
The span of viability of a cell characterized by the capacity to perform certain functions such as metabolism, growth, reproduction, some form of responsiveness, and adaptability.
An enzyme that catalyzes the conversion of UDP-galactose and N-acylsphingosine to D-galactosylceramide and UDP.
The inability to generate oral-verbal expression, despite normal comprehension of speech. This may be associated with BRAIN DISEASES or MENTAL DISORDERS. Organic mutism may be associated with damage to the FRONTAL LOBE; BRAIN STEM; THALAMUS; and CEREBELLUM. Selective mutism is a psychological condition that usually affects children characterized by continuous refusal to speak in social situations by a child who is able and willing to speak to selected persons. Kussmal aphasia refers to mutism in psychosis. (From Fortschr Neurol Psychiatr 1994; 62(9):337-44)
Severe distortions in the development of many basic psychological functions that are not normal for any stage in development. These distortions are manifested in sustained social impairment, speech abnormalities, and peculiar motor movements.
A slowly progressive autoimmune demyelinating disease of peripheral nerves and nerve roots. Clinical manifestations include weakness and sensory loss in the extremities and enlargement of peripheral nerves. The course may be relapsing-remitting or demonstrate a step-wise progression. Protein is usually elevated in the spinal fluid and cranial nerves are typically spared. GUILLAIN-BARRE SYNDROME features a relatively rapid progression of disease which distinguishes it from this condition. (Adams et al., Principles of Neurology, 6th ed, p1337)
Diseases characterized by injury or dysfunction involving multiple peripheral nerves and nerve roots. The process may primarily affect myelin or nerve axons. Two of the more common demyelinating forms are acute inflammatory polyradiculopathy (GUILLAIN-BARRE SYNDROME) and POLYRADICULONEUROPATHY, CHRONIC INFLAMMATORY DEMYELINATING. Polyradiculoneuritis refers to inflammation of multiple peripheral nerves and spinal nerve roots.
An acute inflammatory autoimmune neuritis caused by T cell- mediated cellular immune response directed towards peripheral myelin. Demyelination occurs in peripheral nerves and nerve roots. The process is often preceded by a viral or bacterial infection, surgery, immunization, lymphoma, or exposure to toxins. Common clinical manifestations include progressive weakness, loss of sensation, and loss of deep tendon reflexes. Weakness of respiratory muscles and autonomic dysfunction may occur. (From Adams et al., Principles of Neurology, 6th ed, pp1312-1314)
Cyclical movement of a body part that can represent either a physiologic process or a manifestation of disease. Intention or action tremor, a common manifestation of CEREBELLAR DISEASES, is aggravated by movement. In contrast, resting tremor is maximal when there is no attempt at voluntary movement, and occurs as a relatively frequent manifestation of PARKINSON DISEASE.
Removal of plasma and replacement with various fluids, e.g., fresh frozen plasma, plasma protein fractions (PPF), albumin preparations, dextran solutions, saline. Used in treatment of autoimmune diseases, immune complex diseases, diseases of excess plasma factors, and other conditions.
A medical specialty concerned with the study of the structures, functions, and diseases of the nervous system.

Molecular cloning and developmental expression of a zebrafish axonal glycoprotein similar to TAG-1. (1/102)

TAG-1 is a mammalian cell adhesion molecule of the immunoglobulin superfamily that is expressed transiently by a subset of neurons and serves as a fertile substrate for neurite outgrowth in vitro (Furley, A.H., Morton, S.B., Manalo, D., Karagogeos, S., Dodd, H., Jessell, T.M., 1990 The axonal glycoprotein TAG-1 is an immunoglobulin superfamily member with neurite outgrowth promoting activity. Cell 61, 157-170). In order to examine the in vivo function of this molecule, we have cloned a zebrafish tag1-like cDNA and analyzed its expression patterns. tag1 Is expressed transiently by specific subsets of neurons when they are projecting their axons or when they are migrating. The specific and dynamic pattern of expression of zebrafish tag1 is consistent with its proposed role in axon guidance and cell migration.  (+info)

Nr-CAM promotes neurite outgrowth from peripheral ganglia by a mechanism involving axonin-1 as a neuronal receptor. (2/102)

Nr-CAM is a neuronal cell adhesion molecule (CAM) belonging to the immunoglobulin superfamily that has been implicated as a ligand for another CAM, axonin-1, in guidance of commissural axons across the floor plate in the spinal cord. Nr-CAM also serves as a neuronal receptor for several other cell surface molecules, but its role as a ligand in neurite outgrowth is poorly understood. We studied this problem using a chimeric Fc-fusion protein of the extracellular region of Nr-CAM (Nr-Fc) and investigated potential neuronal receptors in the developing peripheral nervous system. A recombinant Nr-CAM-Fc fusion protein, containing all six Ig domains and the first two fibronectin type III repeats of the extracellular region of Nr-CAM, retains cellular and molecular binding activities of the native protein. Injection of Nr-Fc into the central canal of the developing chick spinal cord in ovo resulted in guidance errors for commissural axons in the vicinity of the floor plate. This effect is similar to that resulting from treatment with antibodies against axonin-1, confirming that axonin-1/Nr-CAM interactions are important for guidance of commissural axons through a spatially and temporally restricted Nr-CAM positive domain in the ventral spinal cord. When tested as a substrate, Nr-Fc induced robust neurite outgrowth from dorsal root ganglion and sympathetic ganglion neurons, but it was not effective for tectal and forebrain neurons. The peripheral but not the central neurons expressed high levels of axonin-1 both in vitro and in vivo. Moreover, antibodies against axonin-1 inhibited Nr-Fc-induced neurite outgrowth, indicating that axonin-1 is a neuronal receptor for Nr-CAM on these peripheral ganglion neurons. The results demonstrate a role for Nr-CAM as a ligand in axon growth by a mechanism involving axonin-1 as a neuronal receptor and suggest that dynamic changes in Nr-CAM expression can modulate axonal growth and guidance during development.  (+info)

The zebrafish detour gene is essential for cranial but not spinal motor neuron induction. (3/102)

The zebrafish detour (dtr) mutation generates a novel neuronal phenotype. In dtr mutants, most cranial motor neurons, especially the branchiomotor, are missing. However, spinal motor neurons are generated normally. The loss of cranial motor neurons is not due to aberrant hindbrain patterning, failure of neurogenesis, increased cell death or absence of hh expression. Furthermore, activation of the Hh pathway, which normally induces branchiomotor neurons, fails to induce motor neurons in the dtr hindbrain. Despite this, not all Hh-mediated regulation of hindbrain development is abolished since the regulation of a neural gene by Hh is intact in the dtr hindbrain. Finally, dtr can function cell autonomously to induce branchiomotor neurons. These results suggest that detour encodes a component of the Hh signaling pathway that is essential for the induction of motor neurons in the hindbrain but not in the spinal cord and that dtr function is required for the induction of only a subset of Hh-mediated events in the hindbrain.  (+info)

Pathological missense mutations of neural cell adhesion molecule L1 affect homophilic and heterophilic binding activities. (4/102)

Mutations in the gene for neural cell adhesion molecule L1 (L1CAM) result in a debilitating X-linked congenital disorder of brain development. At the neuronal cell surface L1 may interact with a variety of different molecules including itself and two other CAMs of the immunoglobulin superfamily, axonin-1 and F11. However, whether all of these interactions are relevant to normal or abnormal development has not been determined. Over one-third of patient mutations are single amino acid changes distributed across 10 extracellular L1 domains. We have studied the effects of 12 missense mutations on binding to L1, axonin-1 and F11 and shown for the first time that whereas many mutations affect all three interactions, others affect homophilic or heterophilic binding alone. Patient pathology is therefore due to different types of L1 malfunction. The nature and functional consequence of mutation is also reflected in the severity of the resultant phenotype with structural mutations likely to affect more than one binding activity and result in early mortality. Moreover, the data indicate that several extracellular domains of L1 are required for homophilic and heterophilic interactions.  (+info)

Novel genes expressed in the developing medial cortex. (5/102)

Two cDNAs, M1 and M2, recently isolated by the differential display method from embryonic rat cerebral hemisphere were characterized and their patterns of spatiotemporal expression analysed in developing rat forebrain by in situ hybridization histochemistry and correlative immunocytochemistry. Neither gene bears any sequence homology to other known genes. Both genes are particularly expressed in medial regions of the cerebral hemisphere and M2 in the roof of the adjacent diencephalon. M1 expression is highly localized and confined to the neuroepithelium of the hippocampal rudiment from embryonic day (E) 12 onward. Its location corresponds to the fimbrial anlage, and immunocytochemical localization of M1 protein indicates its expression in radial glial cells. M2 expression at E12 is more extensive in the medial cerebral wall, extending into the preoptic region and beyond the hippocampus into dorsal hemisphere and into the dorsal diencephalon, with caudal extension along the dorsal midline and in the zona limitans intrathalamica. Later, M2 expression is found in association with the corpus callosum, hippocampal commissure, fimbria, optic nerve, stria medullaris, mamillothalamic tract and habenulopeduncular tract. M1 and M2 expression domains corresponding to the locations of fiber tracts are present prior to the arrival of the earliest axons, as identified by neuron specific markers. These findings suggest M1 and/or M2 genes are involved in early regional specification of the hippocampus and related structures in paramedian regions of the forebrain, and that cell populations expressing these genes in advance of developing axonal pathways may be involved in the early specification of tract location.  (+info)

Extension of long leading processes and neuronal migration in the mammalian brain directed by the chemoattractant netrin-1. (6/102)

Long distance cell migration occurs throughout the developing CNS, but the underlying cellular and molecular mechanisms are poorly understood. We show that the directed circumferential migration of basilar pontine neurons from their origin in the neuroepithelium of the dorsal hindbrain to the ventral midline involves the extension of long (>1 mm) leading processes, which marker analyses suggest are molecularly distinct from axons. In vivo analysis of knockout mice implicates the axonal chemoattractant netrin-1, functioning via its receptor Deleted in Colorectal Cancer (DCC), in attracting the leading process to the ventral midline. Direct evidence for this chemoattractant mechanism is provided, using explant cultures and time-lapse analysis in vitro. Our results demonstrate the attraction of migrating neurons in the mammalian brain by an axon guidance molecule and the chemotactic responsiveness of their leading processes.  (+info)

A direct interaction of axonin-1 with NgCAM-related cell adhesion molecule (NrCAM) results in guidance, but not growth of commissural axons. (7/102)

An interaction of growth cone axonin-1 with the floor-plate NgCAM-related cell adhesion molecule (NrCAM) was shown to play a crucial role in commissural axon guidance across the midline of the spinal cord. We now provide evidence that axonin-1 mediates a guidance signal without promoting axon elongation. In an in vitro assay, commissural axons grew preferentially on stripes coated with a mixture of NrCAM and NgCAM. This preference was abolished in the presence of anti-axonin-1 antibodies without a decrease in neurite length. Consistent with these findings, commissural axons in vivo only fail to extend along the longitudinal axis when both NrCAM and NgCAM interactions, but not when axonin-1 and NrCAM or axonin-1 and NgCAM interactions, are perturbed. Thus, we conclude that axonin-1 is involved in guidance of commissural axons without promoting their growth.  (+info)

The crystal structure of the ligand binding module of axonin-1/TAG-1 suggests a zipper mechanism for neural cell adhesion. (8/102)

We have determined the crystal structure of the ligand binding fragment of the neural cell adhesion molecule axonin-1/TAG-1 comprising the first four immunoglobulin (Ig) domains. The overall structure of axonin-1(Ig1-4) is U-shaped due to contacts between domains 1 and 4 and domains 2 and 3. In the crystals, these molecules are aligned in a string with adjacent molecules oriented in an anti-parallel fashion and their C termini perpendicular to the string. This arrangement suggests that cell adhesion by homophilic axonin-1 interaction occurs by the formation of a linear zipper-like array in which the axonin-1 molecules are alternately provided by the two apposed membranes. In accordance with this model, mutations in a loop critical for the formation of the zipper resulted in the loss of the homophilic binding capacity of axonin-1.  (+info)

The precise sub-compartmental profile of Kv1 channels at AIS and along axons is critical for the shaping of neuronal signaling. In the present study, we showed that two CAMs associated with Kv1, TAG-1 and Caspr2, are distinctly targeted along the axon in hippocampal neurons. TAG-1 strongly colocalizes with Kv1.2 channels at the AIS whereas Caspr2 is evenly distributed along the axon, in contrast to their colocalization at juxtaparanodes. Live imaging of Caspr2 and TAG-1 vesicular transport revealed that they are sorted together in the same axonal transport vesicles. Thus, we hypothesize that their differential distribution may result from diffusion and/or trapping mechanisms induced by selective partnerships. We identified two molecular determinants of Caspr2 that regulate its axonal positioning. First, we showed that deletion of the LNG2-EGF1 extracellular modules in Caspr2Δ2 induces its restricted localization at the AIS and strengthened its association with TAG-1. Second, we demonstrated ...
A homologue of the axonally secreted protein axonin-1 is an integral membrane protein of nerve fiber tracts involved in neurite fasciculation.
If you are a society or association member and require assistance with obtaining online access instructions please contact our Journal Customer Services team ...
N,N,9-Trimethyl-9H-purin-6-amine | C8H11N5 | CID 221105 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more.
An interaction of growth cone axonin-1 with the floor-plate NgCAM-related cell adhesion molecule (NrCAM) was shown to play a crucial role in commissural axon guidance across the midline of the spinal cord. We now provide evidence that axonin-1 mediates a guidance signal without promoting axon elongation. In an in vitro assay, commissural axons grew preferentially on stripes coated with a mixture of NrCAM and NgCAM. This preference was abolished in the presence of anti-axonin-1 antibodies without a decrease in neurite length. Consistent with these findings, commissural axons in vivo only fail to extend along the longitudinal axis when both NrCAM and NgCAM interactions, but not when axonin-1 and NrCAM or axonin-1 and NgCAM interactions, are perturbed. Thus, we conclude that axonin-1 is involved in guidance of commissural axons without promoting their growth. ...
The 0 time samples had been no fracture controls. Every single bar is definitely the mRNA expression degree for your indicated gene for your common SEM of three DNA microarrays in arbitrary units of fluorescence. mRNA from two rats of Inhibitors,Modulators,Libraries the identical age and time after fracture were pooled for each array. Gene identifications are proven with their GenBank accession number. Axonal glycoprotein is also called con tactin 2. Over two thirds in the detectable genes over the rat U34A microarray have a transform in mRNA expression degree following fracture. Most of these genes were not acknowledged to participate in the healing method of bone ahead of the advent of microarray engineering. This reflects adjustments in both the types of cells on the fracture web-site likewise as adjustments during the action of your existing cells.. Between the cells affected by directly fracture are nerve fibers. Protein and mRNA of genes connected to neuronal functioning are observed in ...
Pertubation of neurite fasciculation with species-specific anti-NgCAM antibodies. Cultured mouse DRG explants were infected with the adenoviral vector AdCMV
Complete information for CNTN6 gene (Protein Coding), Contactin 6, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for CNTN2 gene (Protein Coding), Contactin 2, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
CNTN1 - CNTN1 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human contactin 1 (CNTN1), available for purchase from OriGene - Your Gene Company.
Rabbit polyclonal antibody raised against recombinant CNTN1. Recombinant protein corresponding to amino acids of human CNTN1. (PAB23744) - Products - Abnova
Rabbit polyclonal antibody raised against recombinant CNTN5. Recombinant protein corresponding to amino acids of human CNTN5. (PAB23771) - Products - Abnova
Contactin 1, Polyclonal, Invitrogen™ 100μL; Unconjugated Contactin 1, Polyclonal, Invitrogen™ Primary Antibodies Ci to Cx
کانتکتین ۱ (انگلیسی: Contactin 1) یک پروتئین است که در انسان توسط ژن «CNTN۱» کُدگذاری می‌شود. پروتئینی که توسط این ژن ساخته می‌شود، در واقع، عضوی از اَبَرخانوادهٔ ایمنوگلوبولین‌هاست.[۲][۳] کانتکتین ۱، یک پروتئین غشاء عصبی متصل به گلیکوزیل‌فسفاتیدیل‌اینوزیتول است که در اتصال سلولی نقش دارد. احتمال دارد این پروتئین در تشکیل اتصالات آکسونی در جریان رشد و تکامل دستگاه عصبی نقش داشته باشد. دو گونه پیرایش آران‌ای مختلف برای این ژن یافت شده‌است که ایزوفرم‌های پروتئینی مختلفی را می‌سازند.[۳] ...
Axo-glial interactions result in a highly segregated distribution of membrane proteins, defining distinct domains of the axolemma. The mechanisms leading to the enrichment of Na+ channels and associated proteins at the nodes of Ranvier, as well as those involved in the formation of paranodal axo-glial junctions, have been extensively investigated (for review see Girault and Peles, 2002). In contrast, hardly anything is known about the basis for the accumulation of specific proteins, including potassium channels, at juxtaparanodes. The present work demonstrates the critical role of TAG-1 for the enrichment of axonal proteins Caspr2 and Kv1.1/Kv1.2 in juxtaparanodal regions, and points out unexpected molecular similarities in axo-glial interactions at paranodes and juxtaparanodes.. Despite the lack of major ultrastructural or functional alterations of myelinated fibers in TAG-1-deficient mice, a detailed analysis revealed that the normal distribution of the known molecular components of the ...
Monoclonal antibodies against a tumor-associated antigen (TAG-72) with mucin-like properties have been generated. MAb B72.3 was used to identify and help characterize this antigen. B72.3 has been successfully used for the localization of tumor metastases in situ after i.v. administration. MAb B72.3 has also been used in conjunction with CC49, another anti-TAG-72 MAb, to measure TAG-72 levels in sera and effusions. TAG-72 can be found in the fluids of patients with adenocarcinomas from many different sites. This CA 72-4 double determinant radioimmunoassay in conjunction with assays for carcinoembryonic antigen can identify patients with malignancies with greater sensitivity than either assay alone.
Expression of CNTN2 (AXT, TAG-1, TAX, TAX1) in heart muscle tissue. Antibody staining with HPA001397 and HPA012497 in immunohistochemistry.
CNTN6 Polyclonal Antibody (CAB14275)OverviewTitle:CNTN6 Polyclonal Antibody (CAB14275)Size:100µLCode:CAB14275Host Species:RabbitPurification:Affinity purificationIsotype:IgGBackgroundThe protein encoded by this gene is a member of the immunoglobulin ...
Click here to close Hello! We notice that you are using Internet Explorer, which is not supported by Xenbase and may cause the site to display incorrectly. We suggest using a current version of Chrome, FireFox, or Safari. ...
View mouse Cntnap4 Chr8:112570043-112882717 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity. May be involved in synaptogenesis.
Expression of CNTN2 (AXT, TAG-1, TAX, TAX1) in tonsil tissue. Antibody staining with HPA001397 and HPA012497 in immunohistochemistry.
Two experiments were carried out to address the question of whether PTPα and contactin associate in a cis or trans conformation. First, anticontactin precipitates were prepared from lysates of COS cells expressing either PTPα or contactin, or from cells coexpressing both PTPα and contactin ( Fig. 5 A, lanes 1-3), as well as from another sample made by mixing lysates from the cells expressing either contactin or PTPα ( Fig. 5 A, lane 4). Anticontactin immunoprecipitates prepared from coexpressing cells contained PTPα, but those from mixed cell lysates did not ( Fig. 5 A, bottom, lanes 7 and 8). The lack of detectable association of PTPα and contactin in the mixed lysates suggests that interaction cannot take place in a trans conformation. Still, this may require a particular presentation of these cell surface molecules in growing cells that cannot form in solubilized cell lysates. Therefore, contactin-expressing cells were trypsinized 24 h after transfection and replated in dishes ...
Contactins mediate cell surface interactions during nervous system development. Involved in the formation of paranodal axo-glial junctions in myelinated peripheral nerves and in the signaling between axons and myelinating glial cells via its association with CNTNAP1. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Interaction with TNR induces a repulsion of neurons and an inhibition of neurite outgrowth (By similarity).
Gurung, S., Asante, E., Hummel, D., Williams, A., Feldman-Schultz, O., Halloran, M., Sittaramane, V. and Chandrasekhar, A., (2018) Distinct roles for the cell adhesion molecule Contactin2 in the development and function of neural circuits in zebrafish. Mechanisms of Development : 152: 1-12.. Kassim, Y. M., Al-Shakarji, N. M., Asante, E., Chandrasekhar, A. and Palaniappan, K., (2018) Dissecting branchiomotor neuron circuits in zebrafish - Toward high-throughput automated analysis of jaw movements. IEEE International Symposium on Biomedical Imaging (ISBI): 943-947.. Chandrasekhar, A., Guo, S., Masai, I., Nicolson, T. and Wu, C-F., (2017) Zebrafish: from genes and neurons to circuits, behavior and disease. Journal of Neurogenetics : 31: 59-60.. Allen, J., Bhattacharyya, K., Asante, E., Almadi, B., Davis, J., Schafer, K., Cox, J., Voigt, M., Viator, J. and Chandrasekhar, A., (2017) Role of branchiomotor neurons in controlling food intake of zebrafish larvae. Journal of Neurogenetics : 31: ...
The cell adhesion molecule L1 (L1CAM) was originally identified as a neural adhesion molecule essential for neurite outgrowth and axon guidance. Many studies have now shown that L1CAM is overexpressed in human carcinomas and associated with poor prognosis. So far, L1CAM-mediated cellular signaling h …
Mouse Monoclonal Anti-TAG-72 Antibody (B72.3 + CC49) [PE]. Validated: Flow. Tested Reactivity: Human, Rat, Bovine, and more. 100% Guaranteed.
Mouse Monoclonal Anti-TAG-72 Antibody (B72.3 + CA72/733) [DyLight 405]. Validated: WB, Flow, ICC/IF, IHC-Fr, IHC-P. Tested Reactivity: Human, Rat, Bovine, and more. 100% Guaranteed.
I have heard it said that fasciculations appear in ALS some time after the muscle has been damaged due to denervation. As a result, I have been told that an ALS sufferer would experience profound weakn...
I have about 3 twitches a day in my tongue. I asked a neurologist if this could be the start of als, or if its too infrequent. He just said als fasciculations could start more infrequent and slowly becomming more frequent. Does anyone know anything about this ...
archive,tag,tag-articles,tag-21,bridge-core-1.0.4,ajax_fade,page_not_loaded,,qode_grid_1300,qode_popup_menu_push_text_top,qode-content-sidebar-responsive,qode-theme-ver-18.0.7,qode-theme-bridge,disabled_footer_bottom,wpb-js-composer js-comp-ver-5.7,vc_ ...
archive,tag,tag-chronic-pain,tag-254,edgt-core-1.0,kolumn-ver-1.0,edgtf-smooth-scroll,edgtf-smooth-page-transitions,ajax,edgtf-theme-skin-dark,edgtf-blog-installed,edgtf-header-standard,edgtf-fixed-on-scroll,edgtf-default-mobile-header,edgtf-sticky-up-mobile-header,edgtf-animate-drop-down,wpb-js-composer js-comp-ver-4.9.2,vc_ ...
Question - I have been getting random twitching all over body. What should I do?. Ask a Doctor about diagnosis, treatment and medication for Fasciculation, Ask a Neurologist
Contactin 6 / NB-3 (mouse aa160-172) Antibody (internal region), Peptide-affinity purified goat antibody validated in E (AF3868a), Abgent
Th TNR CN-GM. FCT: Trp ∓ Kll fld bcs cts cnnt b trppd fstr thn th xpnntll brd t f cntrl.. FCT: Trp ∓ Strlz (TNR) s n vn bggr bjct flr bcs ths mn-md clgcl dsstrs cnnt b trppd fstr thn th xpnntll brd t f cntrl, nd th ls cntn th crll nnhlt ll ntv wldlf (frm th smllst f pr p t th tp prdtrs tht r strvd t dth), nd th cts cntn t sprd mn ddl dsss tht th crr td - FR WHCH THR R N VCCNS GNST THM. Mn f whch r vn lstd s btrrrsm gnts. (Sch s Tlrm nd Th Plg - s, ppl hv lrd dd frm ct-trnsmttd plg n th S. N fls nr rts vn rqrd. Th cts thmslvs crr nd trnsmt th plg ll n thr wn.). FCT: THR S BSLTL _NTHNG_ HMN BT TNR. Nrl vr lst TNRd ct ds n nhmn dth b rd-kll, frm ct nd nml ttcks, nvrnmntl psns, strvtn, dhdrtn, frzng t dth, nfctns, prsts, tc. nd f vr vr lck hmnl sht t dth r r-trppd nd drwnd (th tw mst cmmn mthds mpld n ll frms nd rnchs t prtct thr gsttng lvstcks ffsprng nd vlbl ntv wldlf dng frm cts Txplsmss prsts). Ths dsnt bgn t cnt th thsnds f dfnslss ntv nmls tht cts skn lv nd dsmbwl lv fr thr dl nd hrl ...
Hello all, Are fasciculations and cramps good or bad signs? We seemed to have mixed views re fasciculations and cramps. Some of us even viewed them as a sign of rapid progress. The pathophysiological explanation is simple: Fasciculations indicate that there is attempt at nerve reconnection to muscles. On the other hand cramps is that connection attempt is happening to some degree, but in a rough way. In my 9yrs of observation, i have suffered violent periodical episodes of cramps and
These are definitely fasciculations. Has been verified by others on this board and an online doctor. The thing is, lately two spots have been going at once giving it that dreaded wormy look (at least to me). I have been reassuring myself by the mere fact that these terrible tongue movements go away when my tongue is completely relaxed, but have just recently discovered this thing called contraction fasciculations: fasciculations occurring in contracted muscle. Although, its hard for me to know anything anymore. I hear tongue fascics must be examined at rest for two possible reasons 1) some tongues fasciculate on protrusion and 2) its hard to see fascics on protrusion. So, I dont know which is true. All I know is that I can invoke my tongue twitches by moving the muscle which means they have FPs or something? I dont know. Im just really struggling....AGAIN ...
Nrcam - mouse gene knockout kit via CRISPR, 1 kit. |dl||dt|Kit Component:|/dt||dd|- |strong|KN311224G1|/strong|, Nrcam gRNA vector 1 in |a href=http://www.origene.com/CRISPR-CAS9/Detail.
Click on a genes description to view its network relationships with genes known to be involved in regulation of axon extension ...
Click on a genes description to view its network relationships with genes known to be involved in negative regulation of axon extension ...
Well-structured soils are generally considered to have bimodal pore structure, including textural pores between soil particles and structural pores between soil aggregates. Bimodal pore structure has previously been inferred indirectly from the soil water retention curve (SWRC) but our understanding of the precise 3-D pore geometry that regulates this curve is limited. The objective of this study was to investigate the bimodal pore structure of a paddy soil under different fertilization regimes using both SWRC and X-ray micro-Computed Tomography (micro-CT), an imaging approach with the aim of comparing the two methods. Undisturbed soil aggregates and soil cores were collected from the surface layer of a long-term unfertilized control (CK), inorganically fertilized (NPK), and organically and inorganically fertilized (NPKOM) paddy soils. The aggregates and cores were scanned using micro-CT and pore structure analyzed. The SWRCs were measured on the same CT-scanned soil cores. Three widely used ...
Yoshihara Y, Kawasaki M, Tamada A; et al. (1996). «Overlapping and differential expression of BIG-2, BIG-1, TAG-1, and F3: four members of an axon-associated cell adhesion molecule subgroup of the immunoglobulin superfamily.». J. Neurobiol. 28 (1): 51-69. PMID 8586965. doi:10.1002/neu.480280106 ...
Read Pioneer neurons: A basis or limiting factor of lophotrochozoa nervous system diversity?, Russian Journal of Developmental Biology on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
Reactome is pathway database which provides intuitive bioinformatics tools for the visualisation, interpretation and analysis of pathway knowledge.
Invitrogen Anti-Contactin 5 Polyclonal, Catalog # PA5-58814. Tested in Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC) and Immunohistochemistry (IHC) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.2 mg/mL).
C. elegans TAG-135 protein; contains similarity to Pfam domain PF00400 (WD domain, G-beta repeat)contains similarity to Interpro domain IPR001680 (WD-40 repeat ...
C. elegans TAG-135 protein; contains similarity to Pfam domain PF00400 (WD domain, G-beta repeat)contains similarity to Interpro domain IPR001680 (WD-40 repeat ...
MPLPPRSLQVLLLLLLLLLLLPGMWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVYVGAVNR 1 - 70 IYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQF 71 - 140 LRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSSRRLMANE 141 - 210 EDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTS 211 - 280 KIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVK 281 - 350 PPKESALCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVT 351 - 420 IEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVAQEGSPILRDL 421 - 490 VLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRRDACERADEPQRFAADL 491 - 560 LQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSFEDFTESESVLEDGRIHCRSPSAREVAPITR 561 - 630 GQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNVADCAFLEGRV 631 - 700 NVSEDCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNS 701 - 770 SYSYEGNDVSDLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLR 771 - 840 ...
Familial spastic paraplegia (FSP or SPG) is a genetically heterogeneous group of upper motor neuron syndromes. To date, two distinct loci for X-linked recessive type (SPG1 and SPG2), three loci for autosomal dominant type (FSP1, FSP2 and FSP3), and one locus for autosomal recessive type have been reported. SPG1 and SPG2 have been mapped to Xq28 and Xq21-q22, respectively. SPG1 shows a mutation in the gene for neural cell adhesion molecule L1 (LICAM), which is an axonal glycoprotein involved in neuronal migration and differentiation. Different mutations of the same L1 gene also cause. MASA (mental retardation, aphasia, spastic paraplegia, adducted thumbs) syndrome and X-linked hydrocephalus. SPG2 shows mutations in one of the major myelin proteins, the proteolipid protein (PLP) gene, and is allelic to Pelizaeus-Merzbacher disease. Thus, mutations in two functionally distinct genes manifest the phenotype of X-linked spastic paraparesis. Three dominantly inherited spastic paraplegia genes have been ...
Facial branchiomotor (fbm) neurones undergo a complex migration in the segmented mouse hindbrain. They are born in the basal plate of rhombomere (r) 4, migrate caudally through r5, and then dorsally and radially in r6. To study how migrating cells adapt to their changing environment and control their pathway, we have analysed this stereotyped migration in wild-type and mutant backgrounds. We show that during their migration, fbm neurones regulate the expression of genes encoding the cell membrane proteins TAG-1, Ret and cadherin 8. Specific combinations of these markers are associated with each migratory phase in r4, r5 and r6. In Krox20 and kreisler mutant mouse embryos, both of which lack r5, fbm neurones migrate dorsally into the anteriorly positioned r6 and adopt an r6-specific expression pattern. In embryos deficient for Ebf1, a gene normally expressed in fbm neurones, part of the fbm neurones migrate dorsally within r5. Accordingly, fbm neurones prematurely express a combination of markers ...
JNeurosci Print ISSN: 0270-6474 Online ISSN: 1529-2401. The ideas and opinions expressed in JNeurosci do not necessarily reflect those of SfN or the JNeurosci Editorial Board. Publication of an advertisement or other product mention in JNeurosci should not be construed as an endorsement of the manufacturers claims. SfN does not assume any responsibility for any injury and/or damage to persons or property arising from or related to any use of any material contained in JNeurosci.. ...
Directory. Start here to access encyclopedic information about the worm genome and its genes, proteins, and other encoded features… Find out more. ...
Directory. Start here to access encyclopedic information about the worm genome and its genes, proteins, and other encoded features… Find out more. ...
People living with ALS will often experience muscle twitching as the signal from the nerves to the muscles become more disrupted.
Contactin-associated protein-like 2 is a protein that in humans is encoded by the CNTNAP2 gene. Since the most recent reference ... "Entrez Gene: CNTNAP2 contactin associated protein-like 2". Ashley, Euan A. (16 August 2016). "Towards precision medicine". ... Nakabayashi K, Scherer SW (April 2001). "The human contactin-associated protein-like 2 gene (CNTNAP2) spans over 2 Mb of DNA at ... "Recessive symptomatic focal epilepsy and mutant contactin-associated protein-like 2". The New England Journal of Medicine. 354 ...
Contactin-associated protein-like 4 is a protein that in humans is encoded by the CNTNAP4 gene. This gene product belongs to ... "Entrez Gene: CNTNAP4 contactin associated protein-like 4". Human CNTNAP4 genome location and CNTNAP4 gene details page in the ...
"Recessive Symptomatic Focal Epilepsy and Mutant Contactin-Associated Protein-like 2". New England Journal of Medicine. 354 (13 ... AP (1 July 2014). "Measles outbreak complicates 2 big Amish events". USA Today. Retrieved 6 February 2015. "209850 AUTISM". ...
Molecular cytogenetic analysis and resequencing of Contactin Associated Protein-Like 2 in autism spectrum disorders. Am J Hum ... 2007;12(1):2-22. doi:10.1038/sj.mp.4001896. PMID 17033636. Sykes NH, Lamb JA. Autism: the quest for the genes. Expert Rev Mol ... 2008;93(2):120-9. doi:10.1016/j.ygeno.2008.09.015. PMID 18950700. Wang K, Zhang H, Ma D et al. Common genetic variants on ... 3.0.CO;2-V. PMID 11091361. Rossel M, Capecchi MR. Mice mutant for both Hoxa1 and Hoxb1 show extensive remodeling of the ...
Of the patients with Contactin-2 antibodies, 4/5 had antibodies against other antigens as well. Signs and symptoms depend on ... 2010). "Antibodies to Kv1 potassium channel-complex proteins leucine-rich, glioma inactivated 1 protein and contactin- ... 19 had antibodies reacting with Contactin-associated protein 2 (CASPR 2), 5 had antibodies against Contactin-2 and 18 (19%) had ... 70 (2): 229-34. doi:10.1001/jamaneurol.2013.592. PMC 3895328 . PMID 23407760. Lai M, Huijbers MG, Lancaster E, Graus F, ...
Contactin, also known as F3 or F11, associates with beta 1 as shown via co-immunoprecipitation. Fibronectin-like (FN-like) ... A disintegrin and metalloproteinase (ADAM) 10 sheds beta 2's ectodomain possibly inducing neurite outgrowth. Beta 3 and beta 1 ... Shah BS, Rush AM, Liu S, Tyrrell L, Black JA, Dib-Hajj SD, Waxman SG (August 2004). "Contactin associates with sodium channel ... "Contactin associates with Na+ channels and increases their functional expression". J. Neurosci. 21 (19): 7517-25. PMID 11567041 ...
... members also bind "heterophilically" to members of the contactin or CNTN1 family. L1 family members bind to many ... such as AP-2. NrCAM and neurofascin both have class 1 PDZ domain binding motifs at their COOH termini. NrCAM can bind to SAP102 ...
2001). «Contactin associates with Na+ channels and increases their functional expression.». J. Neurosci. 21 (19): 7517-25. PMID ... 2001). «Mobilization of the cell adhesion glycoprotein F3/contactin to axonal surfaces is activity dependent.». Eur. J. ... Berglund EO, Ranscht B (1994). «Molecular cloning and in situ localization of the human contactin gene (CNTN1) on chromosome ... Berglund EO, Ranscht B (1994). «Molecular cloning and in situ localization of the human contactin gene (CNTN1) on chromosome ...
2004). "Contactin associates with sodium channel Nav1.3 in native tissues and increases channel density at the cell surface". J ... 90 (2): 225-35. doi:10.1016/j.ygeno.2007.04.006. PMC 2637551 . PMID 17544618. SCN3A protein, human at the US National Library ... 106 (2): 275-85. doi:10.1016/S0306-4522(01)00212-3. PMID 11566500. Weiss LA, Escayg A, Kearney JA, et al. (2003). "Sodium ... 451 (2): 380-7. doi:10.1007/s00424-005-1478-3. PMC 1351366 . PMID 16052353. Kimura K, Wakamatsu A, Suzuki Y, et al. (2006). " ...
1997). "Induction of neurite outgrowth through contactin and Nr-CAM by extracellular regions of glial receptor tyrosine ... 4 (2): 141-50. doi:10.1093/dnares/4.2.141. PMID 9205841. Wang B, Williams H, Du JS, et al. (1998). "Alternative splicing of ... 13 (2): 198-207. doi:10.1038/sj.ejhg.5201315. PMID 15523497. Ishiguro H, Liu QR, Gong JP, et al. (2006). "NrCAM in addiction ... 63 (2): 159-71. doi:10.1006/mvre.2001.2380. PMID 11866539. Pavlou O, Theodorakis K, Falk J, et al. (2002). "Analysis of ...
Contactin-associated protein like (CASPR2), associated with a broader spectrum of central and peripheral nervous system ... In some patients VGKC Abs are detected by radioimmunoassay, in the absence of LGI1, CASPR2, or contactin 2 Ab specificity. In ... contactin 2, has been identified, usually in patients with concomitant anti-LGI1 or anti-CASPR2 Abs and with no specific ... glioma inactivated protein and contactin-associated protein like, that are associated with voltage-gated potassium channels. ...
کانتکتین ۱ (انگلیسی: Contactin 1) یک پروتئین است که در انسان توسط ژن «CNTN۱» کُدگذاری می‌شود. پروتئینی که توسط این ژن ساخته ... Contactin 1. ». در دانشنامهٔ ویکی‌پدیای انگلیسی، بازبینی‌شده در ۲۸ آوریل ۲۰۱۸. ... Berglund EO, Ranscht B (Jun 1994). "Molecular cloning and in situ localization of the human contactin gene (CNTN1) on ... Berglund EO, Ranscht B (Jun 1994). "Molecular cloning and in situ localization of the human contactin gene (CNTN1) on ...
81 (2): 558-67. doi:10.1128/JVI.01820-06. PMC 1797456 . PMID 17079330. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen ... Kamei Y, Takeda Y, Teramoto K, Tsutsumi O, Taketani Y, Watanabe K (Oct 2000). "Human NB-2 of the contactin subgroup molecules: ... domains in brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BIG2)". Proceedings of the National Academy of Sciences ...
294 (2): 254-60. doi:10.1016/S0006-291X(02)00456-4. PMID 12051703. Li H, Adamik R, Pacheco-Rodriguez G, Moss J, Vaughan M (Feb ... Kamei Y, Takeda Y, Teramoto K, Tsutsumi O, Taketani Y, Watanabe K (Oct 2000). "Human NB-2 of the contactin subgroup molecules: ... Brefeldin A-inhibited guanine nucleotide-exchange protein 2 is a protein that in humans is encoded by the ARFGEF2 gene. ADP- ... "Entrez Gene: ARFGEF2 ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)". Yamaji R, Adamik R ...
CNTN4: Contactin 4. *COL7A1: Collagen, type VII, alpha 1 (epidermolysis bullosa, dystrophic, dominant and recessive) ... 978-1-136-84407-2. .. *^ a b c Genome Decoration Page, NCBI. Ideogram data for Homo sapience (850 bphs, Assembly GRCh38.p3). ... ZBED2: encoding protein Zinc finger BED-type containing 2. *ZNF9: zinc finger protein 9 (a cellular retroviral nucleic acid ... Tom Strachan; Andrew Read (2 April 2010). Human Molecular Genetics. Garland Science. p. 45. ISBN ...
... such as F3/contactin. In the nematode C. elegans, two genes encode homologous proteins, glp-1 and lin-12. There has been at ... 34 (2): 435-44. doi:10.1016/0092-8674(83)90377-X. PMID 6616618. Austin J, Kimble J (Nov 1987). "glp-1 is required in the germ ... 74 (2): 331-45. doi:10.1016/0092-8674(93)90424-O. PMID 8343960. Ellisen LW, Bird J, West DC, Soreng AL, Reynolds TC, Smith SD, ... 43 (3 Pt 2): 567-81. doi:10.1016/0092-8674(85)90229-6. PMID 3935325. Kidd S, Kelley MR, Young MW (Sep 1986). "Sequence of the ...
... glioma inactivated 1 protein and contactin-associated protein-2 in limbic encephalitis, Morvan's syndrome and acquired ... 6 (2): 59-66. doi:10.1007/s10048-005-0216-5. PMID 15827762. Chernova OB, Somerville RP, Cowell JK (December 1998). "A novel ... controls in vitro invasiveness and expression of matrix metalloproteinases in glioma cells through the ERK1/2 pathway". The ...
... beta1 subunit-mediated modulation of Nav1.2 currents and cell surface density is dependent on interactions with contactin and ... 81 (1-2): 187-90. doi:10.1016/S0169-328X(00)00145-5. PMID 11000491. Kasai N, Fukushima K, Ueki Y, et al. (2001). "Genomic ... 8 (2): 186-94. doi:10.1038/sj.mp.4001241. PMID 12610651. Yu FH, Westenbroek RE, Silos-Santiago I, et al. (2003). "Sodium ... 63 (1): 191-2. doi:10.1212/01.wnl.0000132844.20654.c1. PMID 15249644. SCN2A protein, human at the US National Library of ...
2009). "Molecular genetic analysis of a cell adhesion molecule with homology to L1CAM, contactin 6, and contactin 4 candidate ... 3.0.CO;2-L. PMID 10508992. CHL1 protein, human at the US National Library of Medicine Medical Subject Headings (MeSH) Human ... 38 (2): 445-51. doi:10.1042/BST0380445. PMID 20298200. Gerhard DS, Wagner L, Feingold EA, et al. (2004). "The status, quality, ... 73 (2-3): 269-74. doi:10.1016/j.schres.2004.06.001. PMID 15653271. Manderson EN, Birch AH, Shen Z, et al. ( ...
A Pitt-Hopkins like phenotype has been assigned to autosomal recessive mutations of the contactin associated protein like 2 ( ... Mol Syndromol 2(3-5):171-180 Megan Lane (8 August 2011). "Who was Peter the Wild Boy?". BBC News Magazine. BBC. Retrieved 2011- ... gene on the short arm of chromosome 2 (2p16.3). Diagnosis is made by showing a mutation in the TCF4 gene. Around 50% of those ...
CASPR2 and Contactin-2, within neurons, glia and the nerve-muscle junction in the pathogenesis of above-mentioned diseases. She ...
Contactin 4 COL7A1: Collagen, type VII, alpha 1 (epidermolysis bullosa, dystrophic, dominant and recessive) CRBN: Cereblon ... ISBN 978-1-136-84407-2. Genome Decoration Page, NCBI. Ideogram data for Homo sapience (850 bphs, Assembly GRCh38.p3). Last ... Tom Strachan; Andrew Read (2 April 2010). Human Molecular Genetics. Garland Science. p. 45. ... alpha 2/delta subunit 3 CCR5: chemokine (C-C motif) receptor 5 CGGBP1: CGG triplet repeat binding protein 1 CMTM7: CKLF like ...
Molecular cytogenetic analysis and resequencing of contactin associated protein-like 2 in autism spectrum disorders. Am J Hum ... Sci Transl Med 2, 56ra80 (Nov 3, 2010). O. Penagarikano, B. S. Abrahams, E. I. Herman, K. D. Winden, A. Gdalyahu, H. Dong, L. I ...
... www.bbspy.co.uk/cbb11/news/0123/more-outside-contact-in-viewers-venom-task-opinions-celeb-bb-2013 [2] "Vanessa Feltz, Danielle ... Lee, Ben (2 February 2015). "Celebrity Big Brother: Live Bombshell to include shock eviction". Digital Spy. Retrieved 26 ... http://www.bbspy.co.uk/cbb11/news/0123/more-outside-contact-in-viewers-venom-task-opinions-celeb-bb-2013 http:// ... 2009 22 March - Jade Goody, Big Brother 3, Big Brother Panto and Celebrity Big Brother 5, Bigg Boss 2 housemate. (b. 1981) 2011 ...
Contactin-3 is a protein that in humans is encoded by the CNTN3 gene. GRCh38: Ensembl release 89: ENSG00000113805 - Ensembl, ... "Entrez Gene: CNTN3 contactin 3 (plasmacytoma associated)". Human CNTN3 genome location and CNTN3 gene details page in the UCSC ... 34 (2): 226-8. doi:10.1006/geno.1996.0271. PMID 8661054. Yoshihara Y, Kawasaki M, Tamada A, Nagata S, Kagamiyama H, Mori K (Mar ... 7 (2): 143-50. doi:10.1093/dnares/7.2.143. PMID 10819331. Connelly MA, Grady RC, Mushinski JF, Marcu KB (1994). "PANG, a gene ...
... , also known as CNTN1, is a protein which in humans is encoded by the CNTN1 gene. The protein encoded by this gene ... "Entrez Gene: CNTN1 contactin 1". Sakurai T, Lustig M, Nativ M, Hemperly JJ, Schlessinger J, Peles E, Grumet M (Feb 1997). " ... Berglund EO, Ranscht B (Jun 1994). "Molecular cloning and in situ localization of the human contactin gene (CNTN1) on ... "Contactin associates with Na+ channels and increases their functional expression". The Journal of Neuroscience. 21 (19): 7517- ...
... contactin 6, and contactin 4 candidate chromosome 3p26pter tumor suppressor genes in ovarian cancer". International Journal of ... Contactin 6 is a protein in humans that is encoded by the CNTN6 gene. The protein encoded by this gene is a member of the ... Contactin 6". Manderson EN, Birch AH, Shen Z, Mes-Masson AM, Provencher D, Tonin PN (May 2009). "Molecular genetic analysis of ... 3.0.CO;2-D. PMID 9486763. Walsh FS, Doherty P (November 1991). "Glycosylphosphatidylinositol anchored recognition molecules ...
Contactin-2 is a protein that in humans is encoded by the CNTN2 gene. The protein encoded by this gene is a member of the ... "Entrez Gene: CNTN2 contactin 2 (axonal)". Traka M, Goutebroze L, Denisenko N, Bessa M, Nifli A, Havaki S, Iwakura Y, Fukamauchi ... 2 (9): 1461-2. doi:10.1093/hmg/2.9.1461. PMID 8242070. Rader C, Stoeckli ET, Ziegler U, Osterwalder T, Kunz B, Sonderegger P ( ... 30 (2): 141-8. doi:10.1006/geno.1995.9892. PMID 8586412. Milev P, Maurel P, Häring M, Margolis RK, Margolis RU (Jun 1996). "TAG ...
Contactin-4 is a protein that in humans is encoded by the CNTN4 gene. The protein encoded by this gene is a member of the ... 2006). "The contactin 4 gene locus at 3p26 is a candidate gene of SCA16". Neurology. 67 (7): 1236-41. doi:10.1212/01.wnl. ... 2004). "Disruption of contactin 4 (CNTN4) results in developmental delay and other features of 3p deletion syndrome". Am. J. ... "A novel splice variant of the cell adhesion molecule contactin 4 ( CNTN4) is mainly expressed in human brain". J Hum Genet. 47 ...
Gollan L, Salomon D, Salzer JL, Peles E (2004). "Caspr regulates the processing of contactin and inhibits its binding to ... 2002). "Neurofascin is a glial receptor for the paranodin/Caspr-contactin axonal complex at the axoglial junction". Curr. Biol ... 119 (2): 257-72. doi:10.1016/j.cell.2004.10.004. PMID 15479642. Hortsch M (1996). "The L1 family of neural cell adhesion ... 154 (2): 427-34. doi:10.1083/jcb.200102086. PMC 2150779 . PMID 11470829. Jenkins SM, Kizhatil K, Kramarcy NR, et al. (2002). " ...
... such as tenascin R and the cell-adhesion molecules neurofascin and contactin. Contactin is also present at nodes in the CNS and ... At CNS nodes, the axonal proteins also include contactin; however, Schwann cell microvilli are replaced by astrocyte perinodal ... 2 (3): 165-174. doi:10.1017/S1740925X06000275. PMC 1855224. PMID 17460780.. *^ Voas MG, Lyons DA, Naylor SG, Arana N, Rasband ... doi:10.1016/S0896-6273(00)80323-2. PMID 9208851. Archived from the original on 2007-12-18. Retrieved 2007-12-07.. ...
... to be a gas or aerosol providing a harmless way of rendering characters temporarily unconscious without physical contact - in ... 34 (2): 315-352. doi:10.1023/A:1010371321083. Rauzon, Mark J. (November 19, 2006). "Live Ammo: The Pacific Project exposed U.S ... ISBN 978-0-674-04513-2. Valero, Marc (April 6, 2014). "What happened in the 1950s at Avon Park Air Force Range?". Archived from ...
... such as tenascin R and the cell-adhesion molecules neurofascin and contactin. Contactin is also present at nodes in the CNS and ... At CNS nodes, the axonal proteins also include contactin; however, Schwann cell microvilli are replaced by astrocyte perinodal ... doi:10.1016/S0896-6273(00)80323-2. PMID 9208851.. *^ a b c d Salzer J. L. (1997). "Clustering sodium channels at the node of ... 2 (3): 165-174. doi:10.1017/S1740925X06000275. PMC 1855224. PMID 17460780.. *^ Voas MG, Lyons DA, Naylor SG, Arana N, Rasband ...
Schuko is an abbreviation for the German word Schutzkontakt, which means "Protective contact" - in this case "protective" ... Danish Section 107-2-D1 earthed (Type K)[edit]. Danish 107-2-D1, standard DK 2-1a, with round power pins and half round earth ... NEMA 2‐15 and 2‐20[edit]. Main article: NEMA connector. These unearthed plugs with two flat parallel blades are intended for ... 5. udgave af Stærkstrømsbekendtgørelsen afsnit 107-2-D1 "Stikpropper og stikkontakter for danske systemer" (in Danish), DK: Sik ...
... as well as the neuronal molecules contactin and Thy-1 (CD90). Quite surprisingly, the alpha toxin of C. septicum is not related ... doi:10.1016/0002-9343(79)90483-2. Liechti, ME; Schob, O; Kacl, GM; Caduff, B (2003). "Clostridium septicum aortitis in a ...
This extracellular region is similar to the cell adhesion molecule contactin and other cell adhesion molecules. It is believed ... 14 (2): 123-8. doi:10.1016/j.seizure.2004.12.007. PMID 15694566. Spampanato J, Kearney J, de Haan G, McEwen D, Escayg A, Aradi ... 53 (1-2): 107-17. doi:10.1016/S0920-1211(02)00259-0. PMID 12576172. Barela A, Waddy S, Lickfett J, Hunter J, Anido A, Helmers S ... 48 (1-2): 15-23. doi:10.1016/S0920-1211(01)00313-8. PMID 11823106. Ito M, Yamakawa K, Sugawara T, Hirose S, Fukuma G, Kaneko S ...
"Contactin-4 mediates axon-target specificity and functional development of the accessory optic system". Neuron. 86 (4): 985-999 ... 52 (2): 247-254. doi:10.1016/j.neuron.2006.07.028. ISSN 0896-6273. PMC 2647846 . PMID 17046688. Huberman, Andrew D.; Manu, ...
... beta1 subunit-mediated modulation of Nav1.2 currents and cell surface density is dependent on interactions with contactin and ... 2 (6): 745-9. doi:10.1093/hmg/2.6.745. PMID 8394762. "Entrez Gene: SCN1B sodium channel, voltage-gated, type I, beta". ... 154 (2): 427-34. doi:10.1083/jcb.200102086. PMC 2150779 . PMID 11470829. Fahmi AI, Patel M, Stevens EB, et al. (2002). "The ... 451 (2): 380-7. doi:10.1007/s00424-005-1478-3. PMC 1351366 . PMID 16052353. Thomas EA, Xu R, Petrou S (2007). "Computational ...
In order to form a paranodal junction, Caspr and contactin form a complex with neurofascin 155. It has been shown that ... neurofascin 155 protein clusters then bring Caspr and contactin into the membrane to form the complex, which allows the ... Type 2 Natural killer T cells are able to recognize sulfatide/ CD1d tetramers, and as a result, they are activated by different ... 426 (2): 157-162. doi:10.1016/j.abb.2004.02.005. PMID 15158666. Whitfield, P. D.; Sharp, P. C.; Johnson, D. W.; Nelson, P.; ...
2016). Molecular Architecture of Contactin-associated Protein-like 2 (CNTNAP2) and Its Interaction with Contactin 2 (CNTN2). J ... 2G,H). The AIS:axon ratio for Kv1.2 was 2.23±0.15 (n=26) and 2.81±0.24 (n=15) in neurons transfected with TAG-1-Ig and TAG-1-Fn ... 2. Deletion of the Ig or FnIII domains of TAG-1 prevents its enrichment at the AIS in cultured hippocampal neurons. Neurons at ... 2A-C). The AIS:axon ratio was significantly reduced for the TAG-1-Ig and TAG-1-Fn deletion mutants (1.38±0.08 and 1.14±0.09, ...
Contactin-2 is a protein that in humans is encoded by the CNTN2 gene. The protein encoded by this gene is a member of the ... "Entrez Gene: CNTN2 contactin 2 (axonal)". Traka M, Goutebroze L, Denisenko N, Bessa M, Nifli A, Havaki S, Iwakura Y, Fukamauchi ... 2 (9): 1461-2. doi:10.1093/hmg/2.9.1461. PMID 8242070. Rader C, Stoeckli ET, Ziegler U, Osterwalder T, Kunz B, Sonderegger P ( ... 30 (2): 141-8. doi:10.1006/geno.1995.9892. PMID 8586412. Milev P, Maurel P, Häring M, Margolis RK, Margolis RU (Jun 1996). "TAG ...
Browse our Contactin-2/TAG1 Lysate catalog backed by our Guarantee+. ... Our Contactin-2/TAG1 Lysates can be used in a variety of model species. Use the list below to choose the Contactin-2/TAG1 ... Each Contactin-2/TAG1 Lysate is fully covered by our Guarantee+, to give you complete peace of mind and the support when you ... Alternate Names for Contactin-2/TAG1 Lysates. Contactin-2/TAG1 lysate, CNTN2 lysate, Axonal glycoprotein TAG-1 lysate, axonin-1 ...
Contactin-associated protein like 5-2Add BLAST. 1268. Amino acid modifications. Feature key. Position(s). DescriptionActions. ... sp,Q0V8T8,CTP5B_MOUSE Contactin-associated protein like 5-2 OS=Mus musculus OX=10090 GN=Cntnap5b PE=2 SV=1 ... RHFWN…LEMSS → P in isoform 2. CuratedAdd BLAST. 58. Sequence databases. Select the link destinations:. EMBL nucleotide sequence ... PS50026, EGF_3, 2 hits. PS01285, FA58C_1, 1 hit. PS01286, FA58C_2, 1 hit. PS50022, FA58C_3, 1 hit. PS51406, FIBRINOGEN ...
A 180-kDa polyprotein was selectively precipitated by the patient serum (figure 1C) and identified as contactin-associated ... Here we have identified a potentially pathogenic antibody against the neuronal membrane protein contactin-associated protein 2 ... Antibodies to Kv1 potassium channel-complex proteins leucine-rich, glioma inactivated 1 protein and contactin-associated ... which resulted in the identification of contactin-associated protein 2 (CASPR2) as a major antigen. CASPR2 antibodies were then ...
Recombinant Contactin 2 (Axonal) (CNTN2) Protein (His tag). Species: Human. Source: Escherichia coli (E. coli). Order product ... Contactin 2 (Axonal) (CNTN2) (AA 877-1040) protein (His tag) Protein CNTN2 Origin: Human Source: Escherichia coli (E. coli) ... Contactin 2 (Axonal) (CNTN2) (AA 802-1008) protein (T7 tag,His tag) Protein ... Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.. Expiry Date. 12 months. ...
... and Contactin-Associated Protein-Like 2 (CNTNAP2) in particular, have been widely cited as autism risk genes based on findings ...
Contactin 4 / Big-2 (mouse aa160-172) Antibody (internal region), Peptide-affinity purified goat antibody validated in WB, E ( ... Contactin-4, Brain-derived immunoglobulin superfamily protein 2, BIG-2, CNTN4. Format 0.5 mg/ml in Tris saline, 0.02% sodium ... Contactin 4 / Big-2 (mouse aa160-172) Antibody (internal region) is for research use only and not for use in diagnostic or ... IgG F(ab)2. IgG F(c). IgG F(ab). IgM. IgA. IgG1. IgG2b. Transferrin. IgG2a. IgG3. IgG2c. ...
Plagge, A; Sendtner-Voelderndorff, L; Sirim, P; Freigang, J; Rader, C; Sonderegger, P; Brümmendorf, T (2001). The contactin- ... The contactin-related protein FAR-2 defines purkinje cell clusters and labels subpopulations of climbing fibers in the ... which is related to F11/F3/contactin and axonin-1/TAG-1. This protein is expressed by subpopulations of Purkinje cells in the ... which is related to F11/F3/contactin and axonin-1/TAG-1. This protein is expressed by subpopulations of Purkinje cells in the ...
Contactin-3 is a protein that in humans is encoded by the CNTN3 gene. GRCh38: Ensembl release 89: ENSG00000113805 - Ensembl, ... "Entrez Gene: CNTN3 contactin 3 (plasmacytoma associated)". Human CNTN3 genome location and CNTN3 gene details page in the UCSC ... 34 (2): 226-8. doi:10.1006/geno.1996.0271. PMID 8661054. Yoshihara Y, Kawasaki M, Tamada A, Nagata S, Kagamiyama H, Mori K (Mar ... 7 (2): 143-50. doi:10.1093/dnares/7.2.143. PMID 10819331. Connelly MA, Grady RC, Mushinski JF, Marcu KB (1994). "PANG, a gene ...
contactin 2. Enable Javascript to view the expand/collapse boxes.. Open All Close All ... This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion ...
Contactin expression in cultured OPCs 1-4 d after transfection with control and contactin (F3) siRNAs. Note that the contactin ... Contactin is required for L1- and laminin-induced Fyn activation. A, Expression of contactin and Fyn and the level of Fyn ... Contactin expression in oligodendrocytes. A, Western blot for contactin expression in OPCs at the time of plating or after ... B, Survival of OPCs transfected with contactin or control siRNA duplexes and analyzed as in Figure 4. Note that contactin ...
No effect of genetic deletion of contactin-associated protein (CASPR) on axonal orientation and synaptic plasticity.. Pillai AM ... No Effect of Genetic Deletion of Contactin-Associated Protein (CASPR) on Axonal Orientation and Synaptic Plasticity ... No Effect of Genetic Deletion of Contactin-Associated Protein (CASPR) on Axonal Orientation and Synaptic Plasticity ... No Effect of Genetic Deletion of Contactin-Associated Protein (CASPR) on Axonal Orientation and Synaptic Plasticity ...
Contactins mediate cell surface interactions during nervous system development. Involved in the formation of paranodal axo- ... IPR036992. Contactin-1. IPR003961. FN3_dom. IPR036116. FN3_sf. IPR007110. Ig-like_dom. IPR036179. Ig-like_dom_sf. IPR013783. Ig ... IPR036992. Contactin-1. IPR003961. FN3_dom. IPR036116. FN3_sf. IPR007110. Ig-like_dom. IPR036179. Ig-like_dom_sf. IPR013783. Ig ... Cluster: Contactin-1. 140. Q12860-3. UPI000B541AE2. UPI000643459F. UPI0002C47707. UPI00054040F8. UPI0003F17F70. UPI000703EA1B. ...
Cntnap4 interacts with 174 markers (Mir1a-1, Mir1a-2, Mir7-1, ...) View All ...
Contactin 2, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene ... View all 6 R&D Systems CNTN2 (Contactin-2/TAG1) Products. *View all R&D Systems CNTN2 (Contactin-2/TAG1) Proteins and Enzymes* ... 2. ^. 3a. ·. 3b. ^. 4a. ·. 4b. ^. 5a. ·. 5b. ·. 5c. ^. 6a. ·. 6b. ^. 7a. ·. 7b. ^. 8. ^. 9a. ·. 9b. ·. 9c. ^. 10. ^. 11. ^. 12a ... CNTN2 (Contactin 2) is a Protein Coding gene. Diseases associated with CNTN2 include Epilepsy, Familial Adult Myoclonic, 5 and ...
contactin associated protein like 2. Enable Javascript to view the expand/collapse boxes.. Open All Close All ...
Anti-contactin-1-associated neuropathy does not meet morphological criteria of demyelinating neuropathy and therefore, might ... Methods We used ELISA to detect autoantibodies against contactin-1. Specificity of the autoantibodies was confirmed by ... Results High reactivity to contactin-1 by ELISA was found in four patients with chronic inflammatory demyelinating ... Interpretation We conclude that anti-contactin-1-related neuropathy constitutes a presumably autoantibody-mediated form of ...
KDs: contactin 4-APP, 17 nM; contactin 4-APLP1, 28 nM; contactin 3-APP, 22 nM; contactin 3-APLP1, 35 nM; and contactin 5-APLP1 ... Our studies show that APP binds both contactin 3 and 4. APLP1 was found to bind contactins 3 and 4, and also contactin 5. These ... On contactin 4, the APP-binding site localizes to the FN-like domains, which could leave the Ig domains of contactin free to ... APP and APLP1 bind to specific contactin family members. (A) AP fusion proteins were tested for binding to contactin-Fc fusion ...
View our 9 Contactin-1 products for your research including Contactin-1 Primary Antibodies, Proteins and Enzymes, cDNA Clones, ... Contactin-1: Products. Contactin-1 (also known as Contactin in human, F3 in rodent, and F11 in chicken), Contactin-2 (TAX-1 in ... and Contactin-6 (NB-3) form the contactin subgroup of cell adhesion molecules within the immunoglobulin superfamily. Contactin- ... human, TAG1 in rat, and Axonin-1 in chicken), Contactin-4 (BIG-1), Contactin-5 (NB-2), ...
код GND: 4076388-2. ідэнтыфікатар LCNAF: sh85107666. ідэнтыфікатар BNF: 11936447p. ідэнтыфікатар NDL: 00572676. BNCF: 51. ... 3LFM FAT Mass and Obesity Associated (Fto) Protein.png 5 911 × 3 325; 2,94 MB. ... 2ph1 pdb gallery nucleotide binding-protein-2 (MinD homolog).svg 1 101 × 745; 302 KB. ... 2cs4 PDB n-terminal domain chromosome 12 ORF 2.png 454 × 420; 123 KB. ...
... contactin-associated protein 2; DNER, δ-Notch-like epidermal growth factor-related receptor; DPPX, dipeptidyl peptidase-like ... contactin-associated protein; CRMP-5, collapsin response mediator protein 5; DPPX, dipeptidyl-peptidase-like protein-6 ... 500-1,000 mg/m2/mo (IV) 1-2 mg/kg/d (PO) (dosage is based on kidney function). IV or PO. Monthly (IV) Daily (PO). Nausea, vomit ... 1,000 mg Repeat in 2 wk or 375 mg/m2 × 4 doses. IV. Every 6 mo. Based on CD19. Infusion reactions, rash, pruritus, edema, ...
Contactin 2 and contactin-associated protein 2 antibodies in patients with multiple sclerosis and clinically isolated syndrome ... Contactin 2 and contactin-associated protein 2 antibodies in patients with multiple sclerosis and clinically isolated syndrome ... Contactin 2 and contactin-associated protein 2 antibodies in patients with multiple sclerosis and clinically isolated syndrome ... Kate Nation interviewed on BBC Radio 2 * Awards Go To Early Career Neuroscientists * Oxford Neuroscientists At The Cheltenham ...
Contactin-2 is a synaptic and axonal membrane protein that interacts with proteins involved in the pathology of AD such as ... Lower levels of contactin-2 were specifically found in and around amyloid plaques in AD hippocampus and temporal cortex. Taken ... Contactin-2 was measured in CSF from two cohorts (selected from the Amsterdam Dementia Cohort), comprising samples from ... Therefore, we aimed to investigate the levels of contactin-2 in the CSF and evaluate its relationship with disease pathology. ...
The identification of leucine-rich, glioma inactivated 1 protein and contactin-associated protein-2 as the major targets of ... Of the 19 patients with contactin-associated protein-antibody-2, 10 had neuromyotonia or Morvans syndrome, compared with only ... to contactin-associated protein-2 in 19 sera, to leucine-rich, glioma inactivated 1 protein in 55 sera and to contactin-2 in ... Tag-1/contactin-2 that associates with contactin-associated protein-2. Antibodies to Kv1 subunits were found in three sera, ...
Invitrogen Anti-Contactin 5 Polyclonal, Catalog # PA5-58814. Tested in Western Blot (WB), Immunofluorescence (IF), ... Cite Contactin 5 Polyclonal Antibody. The following product was used in this experiment: Contactin 5 Polyclonal Antibody from ... Immunofluorescent staining of Contactin 5 in human cell line U-2 OS shows positivity in cytoplasm. Samples were probed using a ... Immunohistochemical staining of Contactin 5 in human kidney tissue shows strong cytoplasmic positivity in tubular cells. ...
Contactin-associated protein-like 2. (CNTNAP2) gene, 241. Convergent adaptive evolution, 2, 47, 48, 59, 60. 102, 107, 126, 135- ... 2 Terrestrial Apes and Phylogenetic Trees--Juan Luis Arsuaga 27-46 * 3 Phylogenomic Evidence of Adaptive Evolution in the ...
Show all anti-Contactin Associated Protein-Like 2 (CNTNAP2) Antikörper with Pubmed References. * Mammalian Monoclonal CNTNAP2 ... novel protein similar to H.sapiens contactin associated protein , contactin associated protein 2 , contactin-associated protein ... Mouse (Murine) Contactin Associated Protein-Like 2 (CNTNAP2) Interaktionspartner * Cntnap2 KO rats exhibited severe motor ... anti-Contactin Associated Protein-Like 2 (CNTNAP2) Antikörper. CNTNAP2 encodes a member of the neurexin family which functions ...
Contactin-2 expression in the cardiac Purkinje fiber network. Circ Arrhythm Electrophysiol. 2010;3(2):186-194.. View this ... contactin 2 (1:40, AF4439; R&D Systems), CaMKII (1:50, ab22609; Abcam;), pCaMKII (1:500, ab32678; Abcam), RyR2 (1:100, AB9080; ... Figure 2. lmmunolocalization of PCP4 within the ventricular conduction system and cardiac ganglia. (A-D) Immunofluorescence ... Mutant mice. Cntn2-EGFP BAC transgenic (2), α-MHC-Cre (30), floxed tdTomato (31), and Pcp4-null (32) mutant mice (provided by ...
All patients were negative for the VGKC-complex-associated proteins LGI1, CASPR2 and contactin-2. The authors concluded that a ... 1999;9(2):361-368.. *Tagawa Y, Yuki N, Ohnishi A, et al. Parameters for monitoring treatment effects in CIDP with anti-MAG/SGPG ... In 2 of these a single ON followed by a long disease-free interval preceded development of CRION for years, suggesting the ... 2003;207(1-2):43-49.. *Garces-Sanchez M, Dyck PJ, Kyle RA, et al. Antibodies to myelin-associated glycoprotein (anti-Mag) in ...
Contactin 2 * Neural Cell Adhesion Molecule L1 * Nerve Growth Factor * Calcitonin Gene-Related Peptide ...
  • Contactin-2 is a protein that in humans is encoded by the CNTN2 gene. (wikipedia.org)
  • CNTN2 (Contactin 2) is a Protein Coding gene. (genecards.org)
  • The most highly enriched transcript in Purkinje fibers encoded Contactin-2 ( Cntn2 ), a cell adhesion molecule critical for neuronal patterning and ion channel clustering. (scialert.net)
  • Contactin 1 antibody LS-C116853 is an unconjugated rabbit polyclonal antibody to Contactin 1 (CNTN1 / gp135) from human, rat, bovine and other species. (lsbio.com)
  • Three cell adhesion molecules, contactin-1 (CNTN1) and contactin-associated protein-1 (CASPR1) in the axons, and neurofascin155 (NF155) in the myelin are responsible for the adhesion and the formation of septate-like junctions (also known as transverse bands) (FIG. 1). (docme.ru)
  • An important gene associated with Autism 15 is CNTNAP2 (Contactin Associated Protein Like 2). (malacards.org)
  • Several converging lines of evidence, including data from the Geschwind lab, point to the possible involvement of Contactin Associated Protein-Like 2 (CNTNAP2/CASPR2) in autism. (autismspeaks.org)
  • 2001). «Mobilization of the cell adhesion glycoprotein F3/contactin to axonal surfaces is activity dependent. (wikipedia.org)
  • Investigators identified an antibody in the serum of MS patients that targeted a brain protein - contactin-2/transiently expressed axonal glycoprotein (TAG-1) - that seems to trigger gray matter demyelination, and they think it could be a useful new model for targeted therapies for multiple sclerosis. (lww.com)
  • Tobias Derfuss, MD, and his colleagues at the Max Planck Institute of Neurobiology in Germany, identified an antibody in the serum of MS patients that targeted a brain protein - contactin-2/transiently expressed axonal glycoprotein (TAG-1). (lww.com)
  • Here we have identified a potentially pathogenic antibody against the neuronal membrane protein contactin-associated protein 2 (CASPR2) in nine of 88 (10%) patients with unexplained ataxia. (bmj.com)
  • The following product was used in this experiment: Contactin 5 Polyclonal Antibody from Thermo Fisher Scientific, catalog # PA5-58814, RRID AB_2640053. (thermofisher.com)
  • This complex is stable to isolation from brain lysates or transfected cells through immunoprecipitation and to antibody-induced coclustering of PTPα and contactin within cells. (rupress.org)
  • Immunofluorescent staining of human cell line U-2 OS with CNTN5 polyclonal antibody (Cat # PAB23771) at 1-4 ug/mL dilution shows positivity in cytoplasm. (abnova.com)
  • The European team said that the finding suggests that a contactin-2 specific T-cell response contributes to the gray matter pathology that occurs in MS. The investigators mined human brain tissue from MS patients and controls looking for antibody reactivity against select glycoproteins. (lww.com)
  • One strong-binding serum was selected for immunoprecipitation and mass spectrometry, which resulted in the identification of contactin-associated protein 2 (CASPR2) as a major antigen. (bmj.com)
  • CASPR2 antibodies were then found by a cell-based assay in 9/88 (10%) ataxia patients, compared to 3/144 (2%) multiple sclerosis or dementia controls (p=0.011). (bmj.com)
  • Polysomnography is useful in patients with antibodies that are associated with sleep disorders, including those with the following antibodies CASPR2, DPPX, IgLON5, anti-Ma2, AQP4, and ANNA-2 antibodies. (medscape.com)
  • Of the antibodies isolated, three antibodies (C6, A7, and C9) targeted Contactin-Associated Protein-like 2 (Caspr2), a protein critical to normal brain development. (army.mil)
  • In the last few years, antibodies to neuronal surface antigens have been demonstrated in patients with immunotherapy-responsive forms of limbic encephalitis and related disorders, 1 2 raising the possibility that other CNS disorders may also result from autoantibodies to cell-surface proteins. (bmj.com)
  • This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. (nih.gov)
  • Co-precipitation from these tissues and tandem mass spectrometry led to the identification of two associated proteins: contactin 4 and NgCAM. (biologists.org)
  • Functional assays revealed regulatory effects of both APP and contactin 4 on NgCAM-dependent growth of cultured retinal axons, demonstrating specific functional interactions among these proteins. (biologists.org)
  • These studies identify novel binding and functional interactions among proteins of the APP, contactin and L1CAM families, with general implications for mechanisms of APP action in neural development and disease. (biologists.org)
  • Contactin-2 is a synaptic and axonal membrane protein that interacts with proteins involved in the pathology of AD such as amyloid precursor protein (APP) and beta-secretase 1 (BACE1). (biomedcentral.com)
  • Antibodies to Kv1 potassium channel-complex proteins leucine-rich, glioma inactivated 1 protein and contactin-associated protein-2 in limbic encephalitis, Morvan's syndrome and acquired neuromyotonia. (ox.ac.uk)
  • Phyllanthus inhibits A549 metastasis by suppressing ERK1/2 and hypoxia pathways that led to suppression of various critical proteins for A549 invasion and migration. (biomedcentral.com)
  • Results from the European study suggest that "immune-mediated inflammation targeted at the protein contactin-2 on or near gray matter endothelial cells opens the blood-brain barrier or alters endothelial cells in the gray matter, permitting effectors of demyelination (such as antibodies to myelin proteins) to gain access to gray matter," Drs. Trapp and Rudick wrote in their editorial. (lww.com)
  • The Abs are directed against membrane receptors and ion channel-associated proteins that are expressed on the surface of neurons in the CNS, such as N -methyl D-aspartate receptors and leucine-rich, glioma inactivated 1 protein and contactin-associated protein like 2, that are associated with voltage-gated potassium channels. (springer.com)
  • Sophisticated approaches have recently led to the identification of novel autoantigens associated with Multiple Sclerosis (MuS), e.g. neurofascin, contactin, CNPase, and other T-cell receptor membrane anchored proteins. (mcponline.org)
  • We first demonstrate that the Ig superfamily molecule contactin is associated in oligodendrocytes with integrins, extracellular matrix receptors that regulate target-dependent survival by amplification of growth factor signaling. (jneurosci.org)
  • 1995). «The carbonic anhydrase domain of receptor tyrosine phosphatase beta is a functional ligand for the axonal cell recognition molecule contactin. (wikipedia.org)
  • Identification and characterization of the human cell adhesion molecule contactin. (wikipedia.org)
  • An essential role of the neuronal cell adhesion molecule contactin in development of the Xenopus primary sensory system . (xenbase.org)
  • Contactin is a glycosylphosphatidylinositol-anchored immunoglobulin-like neuronal cell adhesion molecule that has been implicated in cellular interaction during development of the vertebrate central nervous system . (xenbase.org)
  • Contactin-2 triggers an immune response in which T-cells and antibodies turn against this molecule," reports Meinl. (uni-muenchen.de)
  • C ontactin-1 (also known as Contactin in human, F3 in rodent, and F11 in chicken), Contactin-2 (TAX-1 in human, TAG1 in rat, and Axonin-1 in chicken), Contactin-4 (BIG-1), Contactin-5 (NB-2), and Contactin-6 (NB-3) form the contactin subgroup of cell adhesion molecules within the immunoglobulin superfamily. (rndsystems.com)
  • The protein encoded by this gene is a member of the immunoglobulin superfamily, and contactin family, which mediate cell surface interactions during nervous system development. (thermofisher.com)
  • Disruption of Contactin 4 (CNTN4) results in developmental delay and other features of 3p deletion syndrome. (semanticscholar.org)
  • The transmembrane and catalytic nature of PTPα indicate that it likely forms the transducing element of the complex, and we postulate that the role of contactin is to assemble a phosphorylation-competent system at the cell surface, conferring a dynamic signal transduction capability to the recognition element. (rupress.org)
  • Here we report evidence for an essential role of contactin in development of the Xenopus nervous system . (xenbase.org)
  • This protein is expressed by subpopulations of Purkinje cells in the chicken cerebellum and FAR-2-positive clusters of these neurons alternate with FAR-2-negative clusters in both tangential dimensions of the cerebellar cortex. (uzh.ch)
  • In contrast, the presence of L1-Fc, the extracellular portion of a contactin ligand expressed on axons, enhanced survival and additionally promoted myelination in cocultures of neurons and oligodendrocytes. (jneurosci.org)
  • Contactin mRNA is detectable by in situ hybridization in subsets of neurons in the brain , primary sensory neurons in the spinal cord , and cells along the trigeminal nerves of tailbud embryos. (xenbase.org)
  • Most prominently, cell bodies and peripheral and spinal axons of primary sensory neurons, Rohon-Beard (RB) cells, are strongly contactin positive. (xenbase.org)
  • Injection of the contactin overexpression vector into one blastomere of two-cell stage embryos leads to misdirected elongation of the peripheral axons of RB neurons in the injected half. (xenbase.org)
  • Overexpression of antisense transcript causes depletion of contactin mRNA accumulation and abnormal development of RB neurons. (xenbase.org)
  • G) A pair of RB neurons (small arrows), an EM neuron with peripheral axon (large arrow), and dorsal fascicles (arrowheads) are strongly contactin positive. (xenbase.org)
  • An international group headed by medical scientist Professor Edgar Meinl of LMU Munich has now discovered a possible connection: The protein Contactin-2 is produced both in the myelin sheathing and by neurons in the gray matter - and is attacked by misdirected immune factors. (uni-muenchen.de)
  • Results High reactivity to contactin-1 by ELISA was found in four patients with chronic inflammatory demyelinating polyradiculoneuropathy and in none of the patients with Guillain-Barré syndrome, which was confirmed by cell binding assays in all four patients. (bmj.com)
  • furthermore, detection of contactin-associated protein-2 antibodies should help identify the risk of an underlying tumour and a poor prognosis in future patients. (ox.ac.uk)
  • FAR-2 is binding to the Ig superfamily protein NgCAM/L1, but not to the related receptor NrCAM, and it is also interacting with the modular ECM protein tenascin-R. These results suggest that FAR-2 may contribute to the formation of somatotopic maps of cerebellar afferents during the development of the nervous system. (uzh.ch)
  • 1997). «Induction of neurite outgrowth through contactin and Nr-CAM by extracellular regions of glial receptor tyrosine phosphatase beta.» . (wikipedia.org)
  • Finally, the other classifications are based on less normal characteristics such as two-pore channels, and transient receptor potential channels (2). (novusbio.com)
  • We demonstrate that PTPα, an RPTP that dephosphorylates and activates src family kinases, forms a novel membrane-spanning complex with the neuronal GPI-anchored receptor contactin. (rupress.org)
  • In sciatic nerve, the expression of contactin, receptor protein tyrosine phosphatase β, and the Na + -channel β 1 subunit, paranodal caspr and nodal ankyrin G was unaltered in 2-month type 1 diabetic BB/Wor rats but significantly decreased after 8 months of diabetes. (diabetesjournals.org)
  • nuclear receptor subfamily 2, group E, m. (broadinstitute.org)
  • Contactin-1 and -2 are differentially expressed in a number of neuronal tissues during development and interact with several ligands including Nr-CAM, L1, NCAM, neurocan, phosphacan, and tenascin. (rndsystems.com)
  • Specificity of the autoantibodies was confirmed by immunoblot assay, binding to contactin-1-transfected human embryonic kidney cells, binding to paranodes of murine teased fibres and preabsorption experiments. (bmj.com)
  • Expression of contactin during Xenopus embryonic development. (xenbase.org)
  • No effect of genetic deletion of contactin-associated protein (CASPR) on axonal orientation and synaptic plasticity. (nih.gov)
  • Biochemical characterizations of the paranodal axoglial SJs have identified several molecular components that include Caspr and contactin (Cont) on the axonal side and neurofascin 155 kDa (NF155) isoform on the glial side. (nih.gov)
  • Caspr (contactin-associated protein) is a part of the neurexin family. (novusbio.com)
  • 10 The other cases have been comprised of translocations in the 22q13 region, 2 11-13 ring chromosome 22 1 2 14-16 and mosaics. (bmj.com)
  • FAR-2 is a novel neural member of the Ig superfamily, which is related to F11/F3/contactin and axonin-1/TAG-1. (uzh.ch)
  • Antibodies to Kv1 subunits were found in three sera, to contactin-associated protein-2 in 19 sera, to leucine-rich, glioma inactivated 1 protein in 55 sera and to contactin-2 in five sera, four of which were also positive for the other antibodies. (ox.ac.uk)
  • The responses to immunomodulatory therapies, defined by changes in modified Rankin scores, were good except in the patients with tumours, who all had contactin-associated-2 protein antibodies. (ox.ac.uk)
  • Insomnia and Dysautonomia with Contactin-Associated Protein 2 and Leucine-Rich Glioma Inactivated Protein 1 Antibodies: A "Forme Fruste" of Morvan Syndrome? (annals.org)
  • Memory B-cells, in particular, were used to generate the antibodies because 1) they have the ability to bind to human fetal brain cells, and 2) they persist in humans for years, which is critical because the blood may have been obtained from the mother years after pregnancy. (army.mil)
  • We further characterized the expression of contactin-2 in postmortem AD human brain ( n = 14) versus nondemented controls ( n = 9). (biomedcentral.com)
  • In an animal model, autoresponsive T-cells responded to TAG-1, the animal protein analogous to human Contactin-2. (uni-muenchen.de)
  • We conclude, therefore, that a novel integrin/contactin complex coordinates signals from extracellular matrix and the axonal surface to regulate both oligodendrocyte survival and myelination by controlling Fyn activity. (jneurosci.org)
  • Immunohistochemical analysis revealed that contactin-2 is expressed in the extracellular matrix. (biomedcentral.com)
  • Regulation of CNS myelination by the extracellular matrix (ECM) is incompletely understood, but in vitro and in vivo studies indicate an important role of the ECM component laminin-2 (Lm2, comprising the α2β1γ1 chains), also known as merosin. (biologists.org)
  • Methods We used ELISA to detect autoantibodies against contactin-1. (bmj.com)
  • cohort 2, n = 70) using an analytically validated commercial enzyme-linked immunosorbent assay (ELISA). (biomedcentral.com)
  • Homology modeling using axonin-1 as a template reveals that the four aminoterminal Ig domains of FAR-2 form a compact U-shaped structure, which is likely to contain functionally important ligand-binding sites. (uzh.ch)
  • Total RNA was isolated from the embryos at each stage indicated and contactin transcript was amplified using specific primers. (xenbase.org)
  • An arrow and an arrowhead in (E) represent contactin-positive cell bodies of a RB neuron and an EM neuron, respectively. (xenbase.org)
  • Interactions between contactin, ankyrin G , and the β-subunits are critical to Na + -channel α-subunit enrichment and localization at the node ( 16 - 18 ) ( Fig. 1 ). (diabetesjournals.org)
  • 2000). «Ataxia and abnormal cerebellar microorganization in mice with ablated contactin gene expression. (wikipedia.org)
  • The contactin-related protein FAR-2 defines purkinje cell clusters and labels subpopulations of climbing fibers in the developing cerebellum. (uzh.ch)
  • Furthermore, FAR-2 is also expressed by one type of Purkinje cell afferents, namely, the climbing fibers, and different subpopulations of these axons show distinct levels of FAR-2 expression. (uzh.ch)
  • Expression of a contactin family member within the CCS may provide a mechanistic basis for patterning of the conduction system network and the organization of ion channels within Purkinje cells. (scialert.net)
  • Taken together, these data reveal that the contactin-2 changes observed in tissues are reflected in CSF, suggesting that decreased contactin-2 CSF levels might be a biomarker reflecting synaptic or axonal loss. (biomedcentral.com)
  • 2001). «Contactin associates with Na+ channels and increases their functional expression. (wikipedia.org)
  • Contactins mediate cell surface interactions during nervous system development. (uniprot.org)
  • In vitro binding studies revealed direct interactions among multiple members of the APP and contactin protein families. (biologists.org)
  • Among the remarkable advances in neurology in the last 2-3 decades has been identification of highly specific autoantibodies and their molecular targets. (aacc.org)
  • Molecular cytogenetic analysis and resequencing of contactin associated protein-like 2 in autism spectrum disorders. (semanticscholar.org)
  • Gabriela O. Paiva-Silva and colleagues at the Instituto Nacional de Ciência e Tecnologia em Entomologia Molecular in Brazil demonstrated that the redox-sensitive transcription factor nuclear factor erythroid 2-related factor 2, or Nrf2, coordinates multiple stress responses in the midgut of the mosquito Aedes aegypti. (asbmb.org)
  • In the course of their investigations, they identified Contactin-2 as a new autoantigen - a molecular structure that belongs to the body but which provokes an immune response. (uni-muenchen.de)
  • To explore the molecular abnormalities underlying the degeneration of the node of Ranvier, a characteristic aberration of type 1 diabetic neuropathy, we examined in type 1 BB/Wor and type 2 BBZDR/Wor rats changes in expression of key molecules that make up the nodal and paranodal apparatus of peripheral nerve. (diabetesjournals.org)
  • We offer Contactin-2/TAG1 Lysates for use in common research applications: Western Blot. (novusbio.com)
  • Each Contactin-2/TAG1 Lysate is fully covered by our Guarantee+, to give you complete peace of mind and the support when you need it. (novusbio.com)
  • Our Contactin-2/TAG1 Lysates can be used in a variety of model species. (novusbio.com)
  • Choose from our Contactin-2/TAG1 Lysates. (novusbio.com)
  • Autism has traditionally been conceptualised as a qualitatively distinct behavioural syndrome, characterised by impairments in social interaction and communication coupled with restricted, repetitive or stereotyped patterns of behaviour, interests and activities [1] , [2] . (plos.org)
  • Patterns of contactin mRNA expression in tailbud embryos, revealed by whole-mount in situ hybridization. (xenbase.org)
  • The cDNA clone is shipped in a 2-D bar-coded Matrix tube as dried plasmid DNA. (origene.com)
  • Levels of the APP processing fragment, CTFα, were modulated by both contactin 4 and NgCAM. (biologists.org)
  • In the developing retinotectal system, APP, contactin 4 and NgCAM are expressed in the retina and tectum in suitable locations to interact. (biologists.org)
  • Lower levels of contactin-2 were specifically found in and around amyloid plaques in AD hippocampus and temporal cortex. (biomedcentral.com)