Clostridium beijerinckii: A species of gram-positive bacteria in the family Clostridiaceae, capable of solventogenesis, and isolated from SOIL, infected WOUNDS, fermenting OLIVES, and spoiled CANDY.Butanols: Isomeric forms and derivatives of butanol (C4H9OH).Clostridium: A genus of motile or nonmotile gram-positive bacteria of the family Clostridiaceae. Many species have been identified with some being pathogenic. They occur in water, soil, and in the intestinal tract of humans and lower animals.Acetone: A colorless liquid used as a solvent and an antiseptic. It is one of the ketone bodies produced during ketoacidosis.Neocallimastix: A genus of fungi in the family Neocallimasticaceae, order NEOCALLIMASTIGALES. They contain polyflagellate zoospores and grow on a range of simple and complex carbohydrates in the rumen of sheep and cattle.Gram-Positive Asporogenous Rods, Irregular: A group of irregular rod-shaped bacteria that stain gram-positive and do not produce endospores.Solvents: Liquids that dissolve other substances (solutes), generally solids, without any change in chemical composition, as, water containing sugar. (Grant & Hackh's Chemical Dictionary, 5th ed)Fermentation: Anaerobic degradation of GLUCOSE or other organic nutrients to gain energy in the form of ATP. End products vary depending on organisms, substrates, and enzymatic pathways. Common fermentation products include ETHANOL and LACTIC ACID.Clostridium difficile: A common inhabitant of the colon flora in human infants and sometimes in adults. It produces a toxin that causes pseudomembranous enterocolitis (ENTEROCOLITIS, PSEUDOMEMBRANOUS) in patients receiving antibiotic therapy.Clostridium Infections: Infections with bacteria of the genus CLOSTRIDIUM.Clostridium botulinum: A species of anaerobic, gram-positive, rod-shaped bacteria in the family Clostridiaceae that produces proteins with characteristic neurotoxicity. It is the etiologic agent of BOTULISM in humans, wild fowl, HORSES; and CATTLE. Seven subtypes (sometimes called antigenic types, or strains) exist, each producing a different botulinum toxin (BOTULINUM TOXINS). The organism and its spores are widely distributed in nature.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Synthetic Biology: A field of biological research combining engineering in the formulation, design, and building (synthesis) of novel biological structures, functions, and systems.1-Butanol: A four carbon linear hydrocarbon that has a hydroxy group at position 1.Clostridium acetobutylicum: A species of gram-positive bacteria in the family Clostridiaceae, used for the industrial production of SOLVENTS.Metabolic Engineering: Methods and techniques used to genetically modify cells' biosynthetic product output and develop conditions for growing the cells as BIOREACTORS.IllinoisXyloseCarbohydrate Metabolism: Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.D-Xylulose Reductase: An enzyme that plays a role in the PENTOSES and GLUCURONATES interconversion pathway by catalyzing the oxidation of XYLITOL to D-xylulose. This enzyme has been found to be specific for NAD+.Catabolite Repression: Process by which micro-organisms adapt quickly to a preferred rapidly-metabolizable intermediate through the inhibition or repression of genes related to CATABOLISM of less preferred source(s).Aldose-Ketose Isomerases: Enzymes that catalyze the interconversion of aldose and ketose compounds.Humic Substances: Organic matter in a state of advanced decay, after passing through the stages of COMPOST and PEAT and before becoming lignite (COAL). It is composed of a heterogenous mixture of compounds including phenolic radicals and acids that polymerize and are not easily separated nor analyzed. (E.A. Ghabbour & G. Davies, eds. Humic Substances, 2001).Vocational Education: Education for specific trades or occupations.Manuscripts as Topic: Compositions written by hand, as one written before the invention or adoption of printing. A manuscript may also refer to a handwritten copy of an ancient author. A manuscript may be handwritten or typewritten as distinguished from a printed copy, especially the copy of a writer's work from which printed copies are made. (Webster, 3d ed)Universities: Educational institutions providing facilities for teaching and research and authorized to grant academic degrees.Republic of Korea: The capital is Seoul. The country, established September 9, 1948, is located on the southern part of the Korean Peninsula. Its northern border is shared with the Democratic People's Republic of Korea.Research Personnel: Those individuals engaged in research.Manuscripts, MedicalUnited StatesNational Institutes of Health (U.S.): An operating division of the US Department of Health and Human Services. It is concerned with the overall planning, promoting, and administering of programs pertaining to health and medical research. Until 1995, it was an agency of the United States PUBLIC HEALTH SERVICE.Orthodontics: A dental specialty concerned with the prevention and correction of dental and oral anomalies (malocclusion).Students: Individuals enrolled in a school or formal educational program.Microalgae: A non-taxonomic term for unicellular microscopic algae which are found in both freshwater and marine environments. Some authors consider DIATOMS; CYANOBACTERIA; HAPTOPHYTA; and DINOFLAGELLATES as part of microalgae, even though they are not algae.Chlorella: Nonmotile unicellular green algae potentially valuable as a source of high-grade protein and B-complex vitamins.Hydrogen-Ion Concentration: The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Biofuels: Hydrocarbon-rich byproducts from the non-fossilized BIOMASS that are combusted to generate energy as opposed to fossilized hydrocarbon deposits (FOSSIL FUELS).Saturn: The sixth planet in order from the sun. It is one of the five outer planets of the solar system. Its twelve natural satellites include Phoebe and Titan.Health Facility Moving: The relocation of health care institutions or units thereof. The concept includes equipment relocation.Atmosphere: The gaseous envelope surrounding a planet or similar body. (From Random House Unabridged Dictionary, 2d ed)Culture Media: Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.Chlorella vulgaris: A species of green microalgae in the family Chlorellaceae. It is used as a model organism for PHOTOSYNTHESIS, and as a food supplement (DIETARY SUPPLEMENTS).Chlorophyta: A phylum of photosynthetic EUKARYOTA bearing double membrane-bound plastids containing chlorophyll a and b. They comprise the classical green algae, and represent over 7000 species that live in a variety of primarily aquatic habitats. Only about ten percent are marine species, most live in freshwater.ParisPatents as Topic: Exclusive legal rights or privileges applied to inventions, plants, etc.QuinaldinesElectrolysis: Destruction by passage of a galvanic electric current, as in disintegration of a chemical compound in solution.Renewable Energy: Forms of energy that are constantly and rapidly renewed by natural processes such as solar, ocean wave, and wind energy. (from McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Fossil Fuels: Any combustible hydrocarbon deposit formed from the remains of prehistoric organisms. Examples are petroleum, coal, and natural gas.Hydrogen: The first chemical element in the periodic table. It has the atomic symbol H, atomic number 1, and atomic weight [1.00784; 1.00811]. It exists, under normal conditions, as a colorless, odorless, tasteless, diatomic gas. Hydrogen ions are PROTONS. Besides the common H1 isotope, hydrogen exists as the stable isotope DEUTERIUM and the unstable, radioactive isotope TRITIUM.Solar Energy: Energy transmitted from the sun in the form of electromagnetic radiation.Batch Cell Culture Techniques: Methods for cultivation of cells, usually on a large-scale, in a closed system for the purpose of producing cells or cellular products to harvest.Bioelectric Energy Sources: Electric power supply devices which convert biological energy, such as chemical energy of metabolism or mechanical energy of periodic movements, into electrical energy.Anaerobiosis: The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)Microsomes, Liver: Closed vesicles of fragmented endoplasmic reticulum created when liver cells or tissue are disrupted by homogenization. They may be smooth or rough.Cytochrome P-450 Enzyme System: A superfamily of hundreds of closely related HEMEPROTEINS found throughout the phylogenetic spectrum, from animals, plants, fungi, to bacteria. They include numerous complex monooxygenases (MIXED FUNCTION OXYGENASES). In animals, these P-450 enzymes serve two major functions: (1) biosynthesis of steroids, fatty acids, and bile acids; (2) metabolism of endogenous and a wide variety of exogenous substrates, such as toxins and drugs (BIOTRANSFORMATION). They are classified, according to their sequence similarities rather than functions, into CYP gene families (>40% homology) and subfamilies (>59% homology). For example, enzymes from the CYP1, CYP2, and CYP3 gene families are responsible for most drug metabolism.ButanonesAlcohol Dehydrogenase: A zinc-containing enzyme which oxidizes primary and secondary alcohols or hemiacetals in the presence of NAD. In alcoholic fermentation, it catalyzes the final step of reducing an aldehyde to an alcohol in the presence of NADH and hydrogen.Stereoisomerism: The phenomenon whereby compounds whose molecules have the same number and kind of atoms and the same atomic arrangement, but differ in their spatial relationships. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 5th ed)Butadienes: Four carbon unsaturated hydrocarbons containing two double bonds.Biotransformation: The chemical alteration of an exogenous substance by or in a biological system. The alteration may inactivate the compound or it may result in the production of an active metabolite of an inactive parent compound. The alterations may be divided into METABOLIC DETOXICATION, PHASE I and METABOLIC DETOXICATION, PHASE II.Pentanols: Isomeric forms and derivatives of pentanol (C5H11OH).Clostridium botulinum type A: Subtype of CLOSTRIDIUM BOTULINUM that produces BOTULINUM TOXINS, TYPE A which is neurotoxic to humans and animals.Metagenomics: The genomic analysis of assemblages of organisms.Metagenome: A collective genome representative of the many organisms, primarily microorganisms, existing in a community.Bayes Theorem: A theorem in probability theory named for Thomas Bayes (1702-1761). In epidemiology, it is used to obtain the probability of disease in a group of people with some characteristic on the basis of the overall rate of that disease and of the likelihood of that characteristic in healthy and diseased individuals. The most familiar application is in clinical decision analysis where it is used for estimating the probability of a particular diagnosis given the appearance of some symptoms or test result.Algorithms: A procedure consisting of a sequence of algebraic formulas and/or logical steps to calculate or determine a given task.Sequence Analysis, DNA: A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.Genome: The genetic complement of an organism, including all of its GENES, as represented in its DNA, or in some cases, its RNA.Genome, Bacterial: The genetic complement of a BACTERIA as represented in its DNA.Computational Biology: A field of biology concerned with the development of techniques for the collection and manipulation of biological data, and the use of such data to make biological discoveries or predictions. This field encompasses all computational methods and theories for solving biological problems including manipulation of models and datasets.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Artificial Intelligence: Theory and development of COMPUTER SYSTEMS which perform tasks that normally require human intelligence. Such tasks may include speech recognition, LEARNING; VISUAL PERCEPTION; MATHEMATICAL COMPUTING; reasoning, PROBLEM SOLVING, DECISION-MAKING, and translation of language.Sphingomonas: A genus of gram-negative, aerobic, rod-shaped bacteria characterized by an outer membrane that contains glycosphingolipids but lacks lipopolysaccharide. They have the ability to degrade a broad range of substituted aromatic compounds.ArchivesBiological Science Disciplines: All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Aldehyde Dehydrogenase: An enzyme that oxidizes an aldehyde in the presence of NAD+ and water to an acid and NADH. This enzyme was formerly classified as EC 1.1.1.70.PubMed: A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.Directories as Topic: Lists of persons or organizations, systematically arranged, usually in alphabetic or classed order, giving address, affiliations, etc., for individuals, and giving address, officers, functions, and similar data for organizations. (ALA Glossary of Library and Information Science, 1983)Oxidation-Reduction: A chemical reaction in which an electron is transferred from one molecule to another. The electron-donating molecule is the reducing agent or reductant; the electron-accepting molecule is the oxidizing agent or oxidant. Reducing and oxidizing agents function as conjugate reductant-oxidant pairs or redox pairs (Lehninger, Principles of Biochemistry, 1982, p471).Tetrahydronaphthalenes: Partially saturated 1,2,3,4-tetrahydronaphthalene compounds.Publishing: "The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.Congresses as Topic: Conferences, conventions or formal meetings usually attended by delegates representing a special field of interest.Editorial Policies: The guidelines and policy statements set forth by the editor(s) or editorial board of a publication.Pharmacopoeias as Topic: Authoritative treatises on drugs and preparations, their description, formulation, analytic composition, physical constants, main chemical properties used in identification, standards for strength, purity, and dosage, chemical tests for determining identity and purity, etc. They are usually published under governmental jurisdiction (e.g., USP, the United States Pharmacopoeia; BP, British Pharmacopoeia; P. Helv., the Swiss Pharmacopoeia). They differ from FORMULARIES in that they are far more complete: formularies tend to be mere listings of formulas and prescriptions.International Cooperation: The interaction of persons or groups of persons representing various nations in the pursuit of a common goal or interest.United States Food and Drug Administration: An agency of the PUBLIC HEALTH SERVICE concerned with the overall planning, promoting, and administering of programs pertaining to maintaining standards of quality of foods, drugs, therapeutic devices, etc.Drug Approval: Process that is gone through in order for a drug to receive approval by a government regulatory agency. This includes any required pre-clinical or clinical testing, review, submission, and evaluation of the applications and test results, and post-marketing surveillance of the drug.European Union: The collective designation of three organizations with common membership: the European Economic Community (Common Market), the European Coal and Steel Community, and the European Atomic Energy Community (Euratom). It was known as the European Community until 1994. It is primarily an economic union with the principal objectives of free movement of goods, capital, and labor. Professional services, social, medical and paramedical, are subsumed under labor. The constituent countries are Austria, Belgium, Denmark, Finland, France, Germany, Greece, Ireland, Italy, Luxembourg, Netherlands, Portugal, Spain, Sweden, and the United Kingdom. (The World Almanac and Book of Facts 1997, p842)Guidelines as Topic: A systematic statement of policy rules or principles. Guidelines may be developed by government agencies at any level, institutions, professional societies, governing boards, or by convening expert panels. The text may be cursive or in outline form but is generally a comprehensive guide to problems and approaches in any field of activity. For guidelines in the field of health care and clinical medicine, PRACTICE GUIDELINES AS TOPIC is available.Informatics: The field of information science concerned with the analysis and dissemination of data through the application of computers.International Agencies: International organizations which provide health-related or other cooperative services.Mannans: Polysaccharides consisting of mannose units.Amorphophallus: A plant genus of the family ARACEAE. Members contain konjac glucomannan (MANNANS) and SEROTONIN.beta-Mannosidase: An enzyme that catalyzes the hydrolysis of terminal, non-reducing beta-D-mannose residues in beta-D-mannosides. The enzyme plays a role in the lysosomal degradation of the N-glycosylprotein glycans. Defects in the lysosomal form of the enzyme in humans result in a buildup of mannoside intermediate metabolites and the disease BETA-MANNOSIDOSIS.Cathartics: Agents that are used to stimulate evacuation of the bowels.Postgastrectomy Syndromes: Sequelae of gastrectomy from the second week after operation on. Include recurrent or anastomotic ulcer, postprandial syndromes (DUMPING SYNDROME and late postprandial hypoglycemia), disordered bowel action, and nutritional deficiencies.Mycotoxins: Toxic compounds produced by FUNGI.Fusarium: A mitosporic Hypocreales fungal genus, various species of which are important parasitic pathogens of plants and a variety of vertebrates. Teleomorphs include GIBBERELLA.Aflatoxins: Furano-furano-benzopyrans that are produced by ASPERGILLUS from STERIGMATOCYSTIN. They are structurally related to COUMARINS and easily oxidized to an epoxide form to become ALKYLATING AGENTS. Members of the group include AFLATOXIN B1; aflatoxin B2, aflatoxin G1, aflatoxin G2; AFLATOXIN M1; and aflatoxin M2.Dietary Fiber: The remnants of plant cell walls that are resistant to digestion by the alimentary enzymes of man. It comprises various polysaccharides and lignins.Mannosidases: Glycoside hydrolases that catalyze the hydrolysis of alpha or beta linked MANNOSE.

Maintenance of DeltapH by a butanol-tolerant mutant of Clostridium beijerinckii. (1/18)

The isolation of Clostridium beijerinckii mutants that are more tolerant of butanol than the wild-type offered the opportunity to investigate whether the membrane activities which are required for maintaining the transmembrane DeltapH (the difference in pH between the cellular interior and exterior) are sensitive targets of butanol toxicity. The DeltapH was measured by the accumulation of [14C]benzoate using late-exponential-phase cells which were suspended in citrate/phosphate buffer at pH 5 (to maximize the DeltapH component of the protonmotive force) and supplemented with glucose and Mg2+. The DeltapH of the butanol-tolerant tolerant mutant, strain BR54, of C. beijerinckii NCIMB 8052 was found to be significantly more tolerant of added butanol than the wild-type. Thus, in potassium citrate/phosphate buffer the mutant cells maintained a DeltapH of 1.4 when butanol was added to a concentration of 1.5 % (w/v), while the wild-type DeltapH was reduced to 0.1. The DeltapH of both strains was completely dissipated with 1.75 % butanol, an effect attributed to a chaotropic effect on the membrane phospholipids. Similar results were obtained in sodium citrate/phosphate buffer. In the absence of added Mg2+, the DeltapH of the mutant decreased in both sodium and potassium citrate/phosphate buffer, but more rapidly in the former. Interestingly, the addition of butanol at low concentrations (0.8 %) prevented this DeltapH dissipation, but only in cells suspended in sodium citrate/phosphate buffer, and not in potassium citrate/phosphate buffer. In wild-type cells the decrease in DeltapH occurred more slowly than in the mutant, and sparing of the DeltapH by 0.8 % butanol was less pronounced. The authors interpret these data to mean that the DeltapH is dissipated in the absence of Mg2+ by a Na+- or K+-linked process, possibly by a Na+/H+ or a K+/H+ antiporter, and that the former is inhibited by butanol. Apparently, butanol can selectively affect a membrane-associated function at concentrations lower than required for the complete dissipation of transmembrane ion gradients. Additionally, since the butanol-tolerant mutant BR54 is deficient in the ability to detoxify methylglyoxal (MG) and contains higher levels of MG than the wild-type, the higher Na+/H+ antiporter activity of the mutant may be due to the greater degree of protein glycation by MG in the mutant cells. The mechanism of butanol tolerance may be an indirect result of the elevated glycation of cell proteins in the mutant strain. Analysis of membrane protein fractions revealed that mutant cells contained significantly lower levels of unmodified arginine residues than those of the wild-type cells, and that unmodified arginine residues of the wild-type were decreased by exposure of the growing cells to added MG.  (+info)

Evidence for the presence of an alternative glucose transport system in Clostridium beijerinckii NCIMB 8052 and the solvent-hyperproducing mutant BA101. (2/18)

The effects of substrate analogs and energy inhibitors on glucose uptake and phosphorylation by Clostridium beijerinckii provide evidence for the operation of two uptake systems: a previously characterized phosphoenolpyruvate-dependent phosphotransferase system (PTS) and a non-PTS system probably energized by the transmembrane proton gradient. In both wild-type C. beijerinckii NCIMB 8052 and the butanol-hyperproducing mutant BA101, PTS activity declined at the end of exponential growth, while glucokinase activity increased in the later stages of fermentation. The non-PTS uptake system, together with enhanced glucokinase activity, may provide an explanation for the ability of the mutant to utilize glucose more effectively during fermentation despite the fact that it is partially defective in PTS activity.  (+info)

Influence of the protein environment on the redox potentials of flavodoxins from Clostridium beijerinckii. (3/18)

The flavin mononucleotide (FMN) quinones in flavodoxin have two characteristic redox potentials, namely, Em(FMNH./FMNH-) for the one-electron reduction of the protonated FMN (E1) and Em(FMN/FMNH.) for the proton-coupled one-electron reduction (E2). These redox potentials in native and mutant flavodoxins obtained from Clostridium beijerinckii were calculated by considering the protonation states of all titratable sites as well as the energy contributed at the pKa value of FMN during protonation at the N5 nitrogen (pKa(N5)). E1 is sensitive to the subtle differences in the protein environments in the proximity of FMN. The protein dielectric volume that prevents the solvation of charged FMN quinones is responsible for the downshift of 130-160 mV of the E1 values with respect to that in an aqueous solution. The influence of the negatively charged 5'-phosphate group of FMN quinone on E1 could result in a maximum shift of 90 mV. A dramatic difference of 130 mV in the calculated E2 values of FMN quinone of the native and G57T mutant flavodoxins is due to the difference in the pKa(N5) values. This is due to the difference in the influence exerted by the carbonyl group of the protein backbone at residue 57.  (+info)

Engineered synthetic pathway for isopropanol production in Escherichia coli. (4/18)

A synthetic pathway was engineered in Escherichia coli to produce isopropanol by expressing various combinations of genes from Clostridium acetobutylicum ATCC 824, E. coli K-12 MG1655, Clostridium beijerinckii NRRL B593, and Thermoanaerobacter brockii HTD4. The strain with the combination of C. acetobutylicum thl (acetyl-coenzyme A [CoA] acetyltransferase), E. coli atoAD (acetoacetyl-CoA transferase), C. acetobutylicum adc (acetoacetate decarboxylase), and C. beijerinckii adh (secondary alcohol dehydrogenase) achieved the highest titer. This strain produced 81.6 mM isopropanol in shake flasks with a yield of 43.5% (mol/mol) in the production phase. To our knowledge, this work is the first to produce isopropanol in E. coli, and the titer exceeded that from the native producers.  (+info)

Transcriptional analysis of Clostridium beijerinckii NCIMB 8052 and the hyper-butanol-producing mutant BA101 during the shift from acidogenesis to solventogenesis. (5/18)

 (+info)

Fermentation of rice bran and defatted rice bran for butanol 5 production using clostridium beijerinckii NCIMB 8052. (6/18)

We examined butanol fermentation by Clostridium beijerinckii NCIMB 8052 using various hydrolyzates obtained from rice bran, which is one of the most abundant agricultural by-products in Korea and Japan. In order to increase the amount of fermentable sugars in the hydrolyzates of rice bran, various hydrolysis procedures were applied. Eight different hydrolyzates were prepared using rice bran (RB) and defatted rice bran (DRB) with enzyme or acid treatment or both. Each hydrolyzate was evaluated in terms of total sugar concentration and butanol production after fermentation by C. beijerinckii NCIMB 8052. Acid treatment yielded more sugar than enzyme treatment, and combined treatment with enzyme and acid yielded even more sugars as compared with single treatment with enzyme or acid. As a result, the highest sugar concentration (33 g/l) was observed from the hydrolyzate from DRB (100 g/l) with combined treatment using enzyme and acid. Prior to fermentation of the hydrolyzates, we examined the effect of P2 solution containing yeast extract, buffer, minerals, and vitamins on production of butanol during the fermentation. Fermentation of the hydrolyzates with or without addition of P2 was performed using C. beijerinckii NCIMB 8052 in a 1-l anaerobic bioreactor. Although the RB hydrolyzates were able to support growth and butanol production, addition of P2 solution into the hydrolyzates significantly improved cell growth and butanol production. The highest butanol production (12.24 g/l) was observed from the hydrolyzate of DRB with acid and enzyme treatment after supplementation of P2 solution.  (+info)

Large number of phosphotransferase genes in the Clostridium beijerinckii NCIMB 8052 genome and the study on their evolution. (7/18)

 (+info)

D-2,3-butanediol production due to heterologous expression of an acetoin reductase in Clostridium acetobutylicum. (8/18)

 (+info)

*Clostridium beijerinckii

... is a gram positive, rod shaped, motile bacterium of the genus Clostridium. It has been isolated from ... Clostridium acetobutylicum Butanol A.B.E. process Clostridium beijerinckii information from JGI bacterio.net, list of ... "Physical map of the Clostridium beijerinckii (formerly Clostridium acetobutylicum) NCIMB 8052 chromosome". American Society for ... Type strain of Clostridium beijerinckii at BacDive - the Bacterial Diversity Metadatabase Biology portal. ...

*Acetone-butanol-ethanol fermentation

Clostridium acetobutylicum is the most well-studied and widely used species, although Clostridium beijerinckii has also been ... Recent advances in ABE fermentation: hyper-butanol producing Clostridium beijerinckii BA101. J Ind Microbiol Biotechnol 27(5): ... It usually uses a strain of bacteria from the Class Clostridia (Family Clostridiaceae). ... with Chaim Weizmann's isolation of Clostridium acetobutylicum, as described in U.S. patent 1315585. The Weizmann process was ...

*Martinus Beijerinck

History of virology Nitrification Dmitri Ivanovsky Sergei Winogradsky Clostridium beijerinckii Chung, K. T.; Ferris, D. H. ( ...

*Peptide plane flipping

"Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes". ...

*Butanol fuel

The process uses the bacterium Clostridium acetobutylicum, also known as the Weizmann organism, or Clostridium beijerinckii. It ... Anaerobic bacteria such as Clostridium acetobutylicum and Clostridium saccharobutylicum also contain these pathways. Succinate ... The university's researchers have stated that the source of the "TU-103" Clostridium bacteria strain was most likely from the ... Under normal living conditions, Clostridium bacterial communities have a low yield of butanol per gram of glucose. Obtaining ...

*Clostridium acetobutylicum

ABE Acetone Butanol Clostridium beijerinckii Ethanol Nölling J, Breton G, Omelchenko MV, et al. (August 2001). "Genome sequence ... Pathema-Clostridium Resource Chaim Weizmann Type strain of Clostridium acetobutylicum at BacDive - the Bacterial Diversity ... EPA Clostridium acetobutylicum Final Risk Assessment Genetic Engineering of Clostridium acetobutylicum for Enhanced Production ... Zappe H, Jones WA, Jones DT, Woods DR (May 1988). "Structure of an endo-beta-1,4-glucanase gene from Clostridium acetobutylicum ...

*Martha L. Ludwig

... where they examined the redox state of a flavodoxin from Clostridium beijerinckii. Her laboratory focused on proteins involved ... her first publication which focused on the crystallization of both oxidized and semiquinone forms of protein from Clostridium ...

*Acetoacetate decarboxylase

Bacillus polymyxa Chromobacterium violaceum Clostridium beijerinckii Clostridium cellulolyticum Pseudomonas putida While this ... Acetoacetate decarboxylase from Clostridium acetobutylicum catalyzes the decarboxylation of acetoacetate to yield acetone and ... In 1916, biochemist and future first president of Israel Chaim Weizmann was the first to isolate Clostridium acetobutylicum, a ... Acetoacetate decarboxylase has been found and studied in the following bacteria in addition to Clostridium acetobutylicum: ...

*Lactate racemase

... as well as in non-lactic acid bacteria such as Clostridium beijerinckii. The molecular weight of lactate racemase (Lar) differs ... In C. beijerinckii, evidence exists that lactate racemase appears to work through a mechanism that includes an α-carbonyl ...

*List of MeSH codes (B03)

Clostridium beijerinckii MeSH B03.300.390.400.200.130 --- Clostridium bifermentans MeSH B03.300.390.400.200.160 --- Clostridium ... Clostridium beijerinckii MeSH B03.510.415.400.200.130 --- Clostridium bifermentans MeSH B03.510.415.400.200.160 --- Clostridium ... Clostridium symbiosum MeSH B03.300.390.400.200.722 --- Clostridium tertium MeSH B03.300.390.400.200.725 --- Clostridium tetani ... Clostridium symbiosum MeSH B03.510.415.400.200.722 --- Clostridium tertium MeSH B03.510.415.400.200.725 --- Clostridium tetani ...

*Clostridium saccharoperbutylacetonicum

"Emended descriptions of Clostridium acetobutylicum and Clostridium beijerinckii, and descriptions of Clostridium ... Clostridium saccharoperbutylacetonicum at the Encyclopedia of Life LPSN Type strain of Clostridium saccharoperbutylacetonicum ... Clostridium saccharoperbutylacetonicum is an indole and notably butanol-producing bacteria, with type strain N1-4 (HMT) (= ATCC ... and Clostridium saccharobutylicum sp. nov". International Journal of Systematic and Evolutionary Microbiology. 51 (6): 2095- ...

*Clostridium saccharobutylicum

"Emended descriptions of Clostridium acetobutylicum and Clostridium beijerinckii, and descriptions of Clostridium ... Clostridium saccharobutylicum at the Encyclopedia of Life LPSN Type strain of Clostridium saccharobutylicum at BacDive - the ... Keis S, Sullivan JT, Jones DT (2001). "Physical and genetic map of the Clostridium saccharobutylicum (formerly Clostridium ... Clostridium saccharobutylicum is an indole and notably acetone, butanol and ethanol-producing bactera, with type strain DSM ...

*Clostridium novyi-NT

Salmonella typhimurium C. butyricum C. tetani C. histolyticum 17 and 18 C. beijerinckii 19 C. acetobutylicum C. sporogenes ... Clostridium novyi-NT is a modified form of Clostridium novyi that is under investigation as a cancer treatment. It is one of ... Among the various Clostridium strains that have been examined, pathogenic strains have a stronger oncolytic effect than others ... "Intratumoral injection of Clostridium novyi-NT spores induces antitumor responses". Science Translational Medicine. Aug 2014. ...
The overall goal of my thesis research is to produce four-carbon alcohols such as 1-butanol and 2,3-butanediol, and isobutanol as advanced biofuels and chemicals from microorganisms through metabolic engineering, systems biology, and synthetic biology approaches. Biobutanol is an attractive renewable biofuel and intermediate chemical that has been produced from the ABE (acetone-butanol-ethanol) fermentation by solventogenic clostridia such as Clostridium beijerinckii. Although the ABE fermentation is considered as a promising process for butanol production, current drawbacks in the ABE fermentation include low titer, yield, and productivity of solvent production that needs to be improved to achieve an economically viable process. Therefore, the first goal of my thesis study was to improve the ABE fermentation by C. beijerinckii for production of butanol and its derivatives. This first objective involved four approaches. First, optimization of ABE fermentation condition was conducted to maximize ...
Lee, J., Mitchell, W. J., Tangney, M. & Blaschek, H. P. (2005). Evidence for the presence of an alternative glucose transport system in Clostridium beijerinckii NCIMB 8052 and the solvent hyper-producing mutant BA101. Applied and Environmental Microbiology. 71, 3384-3387. doi:10.1128/AEM.71.6.3384-3387.2005. ISSN 0099-2240. ...
Lee, J., Mitchell, W. J., Tangney, M. & Blaschek, H. P. (2005). Evidence for the presence of an alternative glucose transport system in Clostridium beijerinckii NCIMB 8052 and the solvent hyper-producing mutant BA101. Applied and Environmental Microbiology. 71, 3384-3387. doi:10.1128/AEM.71.6.3384-3387.2005. ISSN 0099-2240. ...
Exogenous anthrahydroquinone-2,6-disulfonate specifically increases xylose utilization during mixed sugar fermentation by Clostridium beijerinckii NCIMB ...
The invention relates to mutant bacteria of the genus Clostridium beijerinckii, CNCM I-4985, CNCM I-4986, CNCM I-4987 and CNCM I-4988, deposited on the 27th May 2015 at the Pasteur institute (CNCM, 25 rue du Docteur Roux, F-75724 PARIS C ...
1PED: Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
ABE is a small, fast and convenient program for visualizing and modeling experimental bioassay data. The data can be modeled using either polynomials or a more specific four-parameter model based upon the standard, sigmoidal dose-response curve.. ABE is a small, fast and convenient program ... ...
... York, Wiley - trading binary options by abe cofnas, binary option trading in canada, friday trading system binary options
Later this month, Japanese Prime Minister Shinzo Abe will address a joint session of the US Congress. The Japan-US alliance is now 63 years old, so why is this the first time that a democratically elected Japanese leader has received this honor from the American government and people?
ABE is a small, fast and convenient program for visualizing and modeling experimental bioassay data. The data can be modeled using either polynomials or a more specific four-parameter model based upon the standard, sigmoidal dose-response curve. Find ABE at: http://bioinformatics.org/abe/. ...
Affiliation:京都大学,農学研究科,助教, Research Field:Bioproduction chemistry/Bioorganic chemistry,Bioorganic chemistry,Molecular and Genome biology and related fields, Keywords:カルジオリピン,ミトコンドリア,リポソーム,アポトーシス,リン脂質,シトクロムc,リゾカルジオリピン,シトクロムc,脂質,有機合成, # of Research Projects:4, # of Research Products:62, Ongoing Project:変異体を用いた新規合成脂質スクリーニングが解き明かす光合成膜脂質の機能
T01611 (acav,adh,amin,apom,arn,asoc,ato,bara,bko,camg,cmb,def,fln,gli,gtm,les,mbov,mee,nfu,ntp,ntt,parb,part,pavi,pht,ppoa,prap,ptu,rhu,sgv,smal,sscu,sya,tpaf,trl : calculation not yet completed ...
T01611 (acry,aem,aid,aue,barr,bmur,brk,cir,dei,deo,fsa,laca,lcy,lni,lyb,mete,mgg,ncv,our,paih,pio,poi,psai,rox,scla,smur,sva,vdb,vgo,vit : calculation not yet completed ...
Shinkichi Shimizu, Nanao Watanabe, Toshiaki Kataoka, Takayuki Shoji, Nobuyuki Abe, Sinji Morishita and Hisao Ichimura. Published Online : 15 JUN 2000, DOI: 10.1002/14356007.a22_399. ...
Feed Type Link http://www.venturedeal.com/Search/SearchResultTransactionDetail.aspx?TransactionId=df207bd1-fbb6-41b8-9b9e-0269b8613abe&Preview=1 Date 5
individual fundamental and technical analysis in forex A280 - fundamental and technical analysis in forex, making pips forex trading, learn the art of forex trading with abe cofnas review guide
Noriyuki Abe sub-mit-ted an up-date to the jl-req pack-age. Ver-sion num-ber: 2017-03-14 Li-cense type: bsd2 Sum-mary de-scrip-tion: Ja-panese doc-u-ment class based on re-quire-ments for Ja-panese text lay-out An-nounce-ment text ...
The audiovisual bounce inducing effect (ABE) is a bouncing percept induced by the presentation of a sound in a motion display otherwise perceived as streaming. The literature suggests that the origin of the ABE is double: the effect stems from the action of an attentional component and that of a non-attentional component. However, the type of response classically gathered in ABE studies does not enable the disentanglement of the two components. Here, we used the ABE stimuli in a detection task and observed the effect of the sound on participants sensitivity (hypothesised to be linked to the attentional component) and on response bias (hypothesised to be linked to the non-attentional component). The sound affected sensitivity and response bias in a way that is consistent with that expected by a selective modulation of the attentional and non-attentional component by the sound.
Reversion" opens the way its signature product, Oubli, is best marketed to its prospective constituents. A woman who has achieved an impossible level of bliss details the experiences that led up to her current state, praising Oubli as a masterful and life-changing device that can truly alter the mind and the way she and others can see the world. Its creator, Jack (Colm Feore), sits by and smiles as his daughter and the Oublis head of marketing, Sophie (Aja Naomi King) shares her own perspective of the devices transformative power. As the Oublis big launch hurtles closer, Sophies world is shattered when she is kidnapped by a mysterious woman and she begins to realize that her memories may not be as reliable or true as she has come to believe ...
PM Shinzo Abe will need to address Japans aging population as the country still lacks structural reform, says Naoyuki Yoshino of the Asian Development Bank Institute.
Sachin Chaturvedi of Research and Information System for Developing Countries weighs in on what Indias Asia-Africa Growth Corridor means for the region as Japanese PM Shinzo Abe visits.
New Japanese Prime Minister Shinzo Abe vowed on Wednesday to battle deflation and a strong yen, and bolster ties with the United States as he kicked off a second administration committed to reviving the economy while coping with a rising China.
Started taking all of the above today and I just wanted to share to things with you guys: 1. Decent pumps in the gym. Better then usual. 2. Omfg this
Sehubungan dengan penghentian pengadaan produk Botanical Collagen Drink oleh PT. ABE, maka kami sebagai distributornya tidak lagi menjual produk Botanical Collagen Drink.. Sesuai dengan surat dari PT. ABE per tanggal 18 Juli 2016 seperti terlihat dalam gambar berikut ini.. terimakasih. ...
Reinforcers (per session) Sociale stressfaktorer ændre hjernens dopamin funktion og påvirker selvadministration af rusmidler Individuelt med mor Gruppe med andre aber Reinforcers (per session) Cocaine (mg/kg/) * S Dominant Underordnet Dominant abe Ingen stress Underordnet abe stressed
Japans government has restarted another controversial nuclear reactor , pushing ahead with plans to revive an industry that many Japanese remain critical of.
Ito, K., Sugawara, T., Koizumi, A., Nakajima, K. I., Shimizu-Ibuka, A., Shiroishi, M., Asada, H., Yurugi-Kobayashi, T., Shimamura, T., Asakura, T., Misaka, T., Iwata, S., Kobayashi, T. & Abe, K., 1 1 2011, : : Biotechnology letters. 33, 1, p. 103-107 5 p.. 研究成果: ジャーナルへの寄稿 › 記事 ...
Previously we have developed a butanol tolerant mutant of Clostridium acetobutylicum Rh8, from the wild type strain DSM 1731. Strain Rh8 can tolerate up to 19 g/L butanol, with solvent titer improved accordingly, thus exhibiting industrial application potential. To test if strain Rh8 can be used for production of high level mixed alcohols, a single secondary alcohol dehydrogenase from Clostridium beijerinckii NRRL B593 was overexpressed in strain Rh8 under the control of thl promoter. The heterogenous gene sADH was functionally expressed in C. acetobutylicum Rh8. This simple, one-step engineering approach switched the traditional ABE (acetone-butanol-ethanol) fermentation to IBE (isopropanol-butanol-ethanol) fermentation. The total alcohol titer reached 23.88 g/l (7.6 g/l isopropanol, 15 g/l butanol, and 1.28 g/l ethanol) with a yield to glucose of 31.42%. The acid (butyrate and acetate) assimilation rate in isopropanol producing strain Rh8(psADH) was increased. The improved butanol tolerance and the
TY - JOUR. T1 - Pervaporative separation and intensification of downstream recovery of acetone-butanol-ethanol (ABE). AU - van Wyk, S.. AU - van der Ham, A.G.J.. AU - Kersten, S.R.A.. N1 - Elsevier deal. PY - 2018/8/1. Y1 - 2018/8/1. N2 - The feasibility of pervaporative concentration of organic compounds from an ABE mixture to reduce the energy consumption of a downstream recovery unit was investigated. Firstly, an experimental investigation was done, using a polydimethylsiloxane (PDMS) membrane and a model solution of ABE as the feed. Different operating temperatures where investigated, with 40 °C showing the most favourable results. Secondly, the experimental results were utilised as the input for process simulations using Aspen Plus. Two ABE separation schemes were studied, one consisting of only distillation (conventional process) and one with an upstream pervaporation unit followed by an alternative distillation scheme. For the proposed pervaporative scheme, the butanol concentration ...
Hey, Abe. Jordy Cummings here. How is the meeshpuchah? (ie., family) How was your Seder this year? We had an interesting one-Chomskyites on one side of the room, Zionists on the other side. Nevertheless, there was shalom babayi (ie., "peace in the house"). Even after the horrendous attack on a Seder in Tel Aviv and Israels subsequent murderous reprisal, we were able to have a decent gathering. We sang Dayeinu, indeed only the chorus, and ate brisket. We libated and joked. We knew we were safe.. I am on a tangent, Abe. See, the reason I am writing you is that you happen to be the head of the Anti-Defamation League, mandated to protect Jewish people from racism and prejudice. No doubt, with the obviously neo-nazi perpetrated attacks on synagogues in France and Manitoba, this is still a concern. But Abe, I am worried about a more serious defamation, that being practiced by a country that actually calls itself the Jewish state! I know that we can differ in our political thinkings, my good man, but ...
2311167DNAClostridium beijerinckii 1atggcacgtt ttactttacc aagagacatt tatcatggag aaggagcact tgaggcactt 60aaaactttaa aaggtaagaa agctttctta gtagttggtg gcggatcaat gaaaagattt 120ggatttctta aacaagttga agattattta aaagaagcag gaatggaagt agaattattt 180gaaggtgttg aaccagatcc atcagtggaa acagtaatga aaggcgcaga agctatgaga 240aactttgagc ctgattggat agttgcaatg ggtggaggat caccaattga tgctgcaaag 300gctatgtgga tattctacga atacccagat tttacttttg aacaagcagt tgttccattt 360ggattaccag accttagaca aaaagctaag tttgtagcta ttccatcaac aagcggtaca 420gctacagaag ttacagcatt ctcagttatc acaaattatt cagaaaaaat taaatatcct 480ttagctgatt ttaacataac tccagatata gcaatagttg atccagcact tgctcaaact 540atgccaaaaa ctttaacagc tcatactgga atggatgcat taactcacgc tatagaagca 600tacactgcat cacttcaatc aaatttctca gatccattag caattaaagc tgtagaaatg 660gttcaagaaa atttaatcaa atcatttgaa ggagataaag aagctagaaa tctaatgcat 720gaagctcaat gtttagctgg aatggcattt tctaatgcat tacttggaat agttcactca 780atggctcata aggttggtgc tgtattccat attcctcatg gatgtgcaaa tgctatattt ...
In his mid-30s, Abe clings to the trappings of his adolescence, including the extensive collection of toys and action figures adorning his boyhood bedroom. Still living with his parents, Abe works for his increasingly disappointed Dad and spends evenings ruthlessly trouncing his Mom at backgammon. His older brother Richards success as a California doctor only feeds Abes resentment and rage at his family over his failures. When Abe meets Miranda, whose personal and professional disasters have sent her scrambling back to the safety of her parents suburban home, he sees what he thinks is a chance at true love. Abe throws himself into pursuing the overmedicated Miranda, convincing her to marry him after a whirlwind courtship. But, as the couple haltingly prepares to start a new life together, the film swerves into Abes subconscious, where his crippling self-doubt and dark fears begin to undermine his nearly realized dream of a fuller life ...
Trump told a local sports radio station last weekend golf was a better way to get to know someone than lunch and saw his match-up with Abe as a fun meeting between partners rather than adversaries.
Japan international midfielder Yuki Abe headed his first goal of the season as Leicester City ended 10-man Brighton and Hove Albions unbeaten start to the
Shares in Japan rebounded Friday after a pledge by Japanese Prime Minister Shinzo Abe to strengthen the countrys economy, while markets elsewhere mostly fell amid the prospect of higher rates in the U.S.
SWEETWATER CREEK FARMS is a trademark and brand of Abes Finest Meats, LLC. Filed to USPTO On Thursday, August 18, 2016, The SWEETWATER CREEK FARMS covers Processed meat, namely, bacon, bacon ends and pieces, loins, sausages. Search for other trademarks at Trademarkia.
Daniel J Klionsky, Kotb Abdelmohsen, Akihisa Abe, Md Joynal Abedin, Hagai Abeliovich, Abraham Acevedo Arozena, Hiroaki Adachi, Christopher M Adams, Peter D Adams, Khosrow Adeli, Peter J Adhihetty, Sharon G Adler, Galila Agam, Rajesh Agarwal, Manish K Aghi, Maria Agnello, Patrizia Agostinis, Patricia V Aguilar, Julio Aguirre-Ghiso, Edoardo M Airoldi, Slimane Ait-Si-Ali, Takahiko Akematsu, Emmanuel T Akporiaye, Mohamed Al-Rubeai, Guillermo M Albaiceta, Chris Albanese, Diego Albani, Matthew L Albert, Jesus Aldudo, Hana Algül, Mehrdad Alirezaei, Iraide Alloza, Alexandru Almasan, Maylin Almonte-Beceril, Emad S Alnemri, Covadonga Alonso, Nihal Altan-Bonnet, Dario C Altieri, Silvia Alvarez, Lydia Alvarez-Erviti, Sandro Alves, Giuseppina Amadoro, Atsuo Amano, Consuelo Amantini, Santiago Ambrosio, Ivano Amelio, Amal O Amer, Mohamed Amessou, Angelika Amon, Zhenyi An, Frank A Anania, Stig U Andersen, Usha P Andley, Catherine K Andreadi, Nathalie Andrieu-Abadie, Alberto Anel, David K Ann, Shailendra ...
Chakraborty S, Krishnan Y. 2017. A structural map of oncomiR-1 at single-nucleotide resolution.. Nucleic Acids Res. 45(16):9694-9705. ...
The Agricultural & Biosystems Engineering Department is developing innovative systems to sustainably feed an increasing pupulation through cutting-edge technology, sustainable practices, and the drive to make a difference in the world. We build sustainable solutions that create resilience among society, the environment and the economy. Currently, were working on:. ...
For the sake of babies, syringes work haler than spoons because you can be reliable youre getting all the medicine into your boys pronounce and down his thro
Japanese workers will see a 1 percent increase in their total earnings next year, the most since 1997, as rising profits and the tightest labor market in decades add upward pressure on pay, a Bloomberg survey shows. "The labor shortage is definitely getting more serious," said Shuji Tonouchi, a senior market economist at Mitsubishi UFJ Morgan […]. Read More ». ...
L -eo xpe nsive new com er nosed fashioned a slim 25 -2 le ad at 4-N- m be tn G ont ora o U S N eeds abe ttervo ck yd 10e- RiY ears.* n il l _l e l w h l ...
This knife didnt cut very well, but it sure was cute! Our waiter informed me they can be found at Bed, Bath, and Beyond.. The one thing he neglected to tell us was the price of this beer that Abe ordered! When the check came, we thought he had been mistakenly charged for two. Nope, this is what a $12 bottle looks like:. ...
I think its need to be reopen because its not working with Version: 6.1.0.0.alpha1+ Build ID: 1462bdc3abe60cee43cf6064663d646adbf13894 CPU threads: 8; OS: Linux 4.14; UI render: default; VCL: kde4; TinderBox: [email protected], Branch:master, Time: 2018-05-19_02:52:14 Locale: nl-BE (en_US.UTF-8); Calc: group Version: 6.2.0.0.alpha0+ Build ID: bfed5c384d41253bec39fc3e44f839242602f1a1 CPU threads: 8; OS: Linux 4.14; UI render: default; VCL: kde4; TinderBox: [email protected], Branch:master, Time: 2018-06-03_00:35:28 Locale: nl-BE (en_US.UTF-8); Calc: group threaded Version: 6.2.0.0.alpha0+ Build ID: 35c00b2ece11b7f60c5ffba10bd7083d4e7bc4f2 CPU threads: 8; OS: Linux 4.14; UI render: default; VCL: kde4; Locale: nl-BE (en_US.UTF-8); Calc: group ...
Glycerol is a byproduct of bioethanol and biodiesel production processes and can be converted to more valuable products such as ethanol, butanol, 1,3-propanediol, and 2,3-butanediol by various anaerobic bacteria. In this study, we isolated glycerol-utilizing anaerobic bacteria to obtain ones having a superior ability to produce butanol. By adding acetic and butyric acids into the mineral medium containing glycerol, we could enrich butanol-producing bacteria from a soil sample. Isolates showed ,99% 16S rRNA gene similarities with Clostridium diolis/beijerinckii (group 1), C. butyricum (group 2), C. arbusti (group 3), and Klebsiella oxytoca (group 4). The isolates belonging to group 3 produced up to 12.5 g/L of butanol and the isolates belonging to group 2 produced up to 17.1 g/L of 1,3-propanediol from 30 g/L of glycerol. When glucose was used instead of glycerol, the isolates belonging to group 1 produced 12.0 g/L of butanol and 6.9 g/L of ethanol and the isolate of group 4 produced 21.0 g/L of ...
The study presents a multiscale methodology consisting in a decision support tool. The selection depends on efficiency, profitability and sustainability of the process. In this model, the process structure consists in the pretreatment, the hydrolysis, the fermentation, the separation and the purification. The Acetone-Butanol-Ethanol fermentations methodology is demonstrated in this study. © 2016 Elsevier B.V. ...
ID Q13S50_PARXL Unreviewed; 203 AA. AC Q13S50; DT 22-AUG-2006, integrated into UniProtKB/TrEMBL. DT 22-AUG-2006, sequence version 1. DT 30-AUG-2017, entry version 79. DE SubName: Full=Two component transcriptional regulator, LuxR family {ECO:0000313,EMBL:ABE33089.1}; GN ORFNames=Bxe_B2906 {ECO:0000313,EMBL:ABE33089.1}; OS Paraburkholderia xenovorans (strain LB400). OC Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; OC Burkholderiaceae; Paraburkholderia. OX NCBI_TaxID=266265 {ECO:0000313,EMBL:ABE33089.1, ECO:0000313,Proteomes:UP000001817}; RN [1] {ECO:0000313,EMBL:ABE33089.1, ECO:0000313,Proteomes:UP000001817} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=LB400 {ECO:0000313,EMBL:ABE33089.1, RC ECO:0000313,Proteomes:UP000001817}; RX PubMed=17030797; DOI=10.1073/pnas.0606924103; RA Chain P.S.G., Denef V.J., Konstantinidis K.T., Vergez L.M., Agullo L., RA Reyes V.L., Hauser L., Cordova M., Gomez L., Gonzalez M., Land M., RA Lao V., Larimer F., LiPuma J.J., ...
Online Medical Supply provides many Medline medical products like the Medline Deluxe Aluminum Transport Chairs, Blue (MDS808200ABE) and other Wheelchairs and Accessories, Wheelchairs related products
Electric Phenomena in Polymer Science by Abe Akihiro (ISBN: 978-3-662-15416-8); Published by Springerin Oct 2013. Compare book prices on Bookwire.com to buy books from the lowest price among top online book retailers
Construction of a D-valine sensor using D-amino acid oxidase of Rubrobacter xylanophilus, Journal of Technology and Education, 2016/12/01, Katsumi TAKAYAMA, Chisato SAKAMOTO, Shouji TAKAHASHI, Katsumasa ABE, Ayano HIROBE, and Takeji KOSHIGIRI. ...
Tlic líoll Hint Alie Split. this is the rail tbat Abe split. this is the man who fetched the rail that Abe split. these are the delegates, honest men, Who voted for States where theyd never been, Who hurrahed fot ihe man who fetched the rail that Abo split. This is Greely, of Oregon, "Who fought the battle of Sleivenamon, And primed the delegates, honest men, Who voted for States where theyd never been, Who hurrahed for the man who fetched the rail that Abe split. This is Bill Seward, all forlorn, Who " cusses" the Greely of Oregon, Who fought the battle of Sleivenamon, Aud primed the delégales, honest men, Who voled for Stales where theyd never been, Who hurrahed for the man who (etched the rail that Abe split. This is Beecher, all shaven and shorn, Whose rifles were once to Virginia borne, Who crucified Seward, all forlorn, Who cusses the Greely from Oregon. ■Who fought ihe bailie of Sleivenamon, And primed the delegal.es. honest men, "Who voted for States where theyd never been. Aud ...
There are many ways to grow trees, depending on which type youre talking about, and Abe has been trying them all.. Planting from seed is slow, but effective, for the ones that come true (are like their parents). This is generally the method we choose for the native trees, which we plant mainly to reforest our hill. For example, last year, when the oaks produced a lot of acorns, Abe and the boys walked all over the property planting seeds along the contours. Not all of these will make it, but some will, with no further effort or water from us. Another good reason for planting seeds is when you cant find the live plant - ordering a seed online is sometimes the only way well find some of the varieties that we want in our forest garden.. Another form of propagation is to take cuttings and root them. Weve had some success with this method, but not as much as we would like. Abe has made a propagator, but it is still a work in progress, ironing out kinks in both temperature and humidity control. ...
Ultrarapid DNA sequencing would allow physicians to acquire full on-the-spot genomic information and would therefore advance clinical practice to provide a level of care that would have been unbelievable just a few years ago. We are working to advance several critical limitations associated with ultrarapid DNA sequencing. Our approach involves nanopore strand sequencing, in which a single strand of DNA moves through a narrow pore, the alpha-hemolysin (aHL) protein nanopore, and the bases are identified as they pass a reading head.. We are investigating methods to control and monitor the translocation of single stranded DNA through a nanopore with single-nucleotide resolution. We have recently made a breakthrough in this field by designing the first supramolecular nanopore device capable of detecting up to nine consecutive DNA polymerase-catalyzed single nucleotide primer extensions with high sensitivity and spatial resolution (2.4 Å). In this setup, the polymerase acts as a molecular motor to ...
Ex-convict-turned-writer Joji Abe, known for a bestselling humor-filled novel depicting the lives of inmates, died of pneumonia at his home in Tokyo on Monday, his family said. He was 82. A native of Tokyo, Abe joined a gangster group when he was in junior high ... ...
Please confirm the information below before signing in. Sign In. {* #registrationForm *} {* firstName *} {* lastName *} {* emailAddress *} {* displayName *} {* phone *} {* addressCity *} {* addressCountry *} {* newPassword *} {* newPasswordConfirm *} By clicking "Create Account", you confirm that you accept our terms of service and have read and understand privacy policy ...
Chinese news outlets mistook a pardoned turkey named Abe -- named after Abraham Lincoln -- to be instead named after Japanese Prime Minister Shinzo Abe, provoking a round of gloating in the Chinese media.
Ilyas : dah paham mama.bukan mama amik duit milik ilyas kan (tetap jugak gune perkataan milik tuh).mama tukar je ngan duit milik mama.duit ilyas tu dalam bank kan..(sambil sibuk bace amount duit die kat buku bank tuh) ...
by Suzuki, Takuji and Suzuki, Takuji and Arumugam, Paritha and Arumugam, Paritha and Sakagami, Takuro and Sakagami, Takuro and Lachmann, Nico and Lachmann, Nico and Chalk, Claudia and Chalk, Claudia and Sallese, Anthony and Sallese, Anthony and Abe, Shuichi and Abe, Shuichi and Trapnell, Cole and Trapnell, Cole and Carey, Brenna and Carey, Brenna and Moritz, Thomas and Moritz, Thomas and Malik, Punam and Malik, Punam and Lutzko, Carolyn and Lutzko, Carolyn and Wood, Robert E and Wood, Robert E and Trapnell, Bruce C and Trapnell, Bruce C ...
The over-rated Washington Post sports columnist Tom Boswell just repeated the conventional disinformation that the 06 Sox have abandoned their homer-hitting ways of the past for a more "balanced offense." If I hear this crap one more time, Im running naked into the street with a machete! The Sox dumped NONE of their power hitters (Millar no longer qualifies, with a single digit homer total last season), and added a new one in Willy Mo. As the Globe pointed out today, the Sox offense, homers included, is pretty much the same as 05 to this point. But I keep hearing that the Sox are no longer "bashers." Who starts this kind of stuff, and how the hell do you stop it? ...
An image display controlling unit controls to display a standard image and a dummy image. The standard image is an image that has been previously decided by the user. The dummy image looks like the standard image but the standard image and the dummy image has differences that only the ...
Affiliation:山口大,医学部附属病院,助手, Research Field:Digestive surgery,Digestive surgery, Keywords:CGH,食道癌,リンパ節転移,LC-MS,tropomyosin,microarray,proteomics,M,Tropomyosin,マイクロアレイ, # of Research Projects:3, # of Research Products:4
In order to achieve the status of being a normal country, the Shinzo Abe administration in Japan has been doing everything it can to bury the countrys criminal war record. With their false sense of pride, Abe and his cronies havent hesitated to lie and deny younger generations access to the truth.
Klionsky, DJ; Abdelmohsen, K; Abe, A; Abedin, MJ; Abeliovich, H; Acevedo Arozena, A; Adachi, H; ... Zughaier, SM; + view all Klionsky, DJ; Abdelmohsen, K; Abe, A; Abedin, MJ; Abeliovich, H; Acevedo Arozena, A; Adachi, H; Adams, CM; Adams, PD; Adeli, K; Adhihetty, PJ; Adler, SG; Agam, G; Agarwal, R; Aghi, MK; Agnello, M; Agostinis, P; Aguilar, PV; Aguirre-Ghiso, J; Airoldi, EM; Ait-Si-Ali, S; Akematsu, T; Akporiaye, ET; Al-Rubeai, M; Albaiceta, GM; Albanese, C; Albani, D; Albert, ML; Aldudo, J; Algül, H; Alirezaei, M; Alloza, I; Almasan, A; Almonte-Beceril, M; Alnemri, ES; Alonso, C; Altan-Bonnet, N; Altieri, DC; Alvarez, S; Alvarez-Erviti, L; Alves, S; Amadoro, G; Amano, A; Amantini, C; Ambrosio, S; Amelio, I; Amer, AO; Amessou, M; Amon, A; An, Z; Anania, FA; Andersen, SU; Andley, UP; Andreadi, CK; Andrieu-Abadie, N; Anel, A; Ann, DK; Anoopkumar-Dukie, S; Antonioli, M; Aoki, H; Apostolova, N; Aquila, S; Aquilano, K; Araki, K; Arama, E; Aranda, A; Araya, J; Arcaro, A; Arias, E; Arimoto, H; ...
An illustration of a dream on the theme of summer where i let my imagination drive everything." - Sébastian Abes Sebastian Abes is the creator of this video and the music […]. ...
Motoaki Shichiri, Ryuzo Kawamori, Michio Yoshida, Nobuaki Etani, Mitsuru Hoshi, Kanji Izumi, Yukio Shigeta, Hiroshi Abe and Kanji Osaka ...
Klionsky, DJ, Abdelmohsen, K, Abe, A, Abedin, MJ, Abeliovich, H, Acevedo Arozena, A et al.. Guidelines for the use and interpretation of assays for monitoring autophagy (3rd edition). Autophagy. 2016;12 (1):1-222. doi: 10.1080/15548627.2015.1100356. PubMed PMID:26799652 PubMed Central PMC4835977 ...
Shetty R, Joshi D, Jain M, Vasudevan M, Paul JChrysolite, Bhat G, Banerjee P, Abe T, Kiyonari H, VijayRaghavan K et al.. 2018. Rudhira/BCAS3 is essential for mouse development and cardiovascular patterning.. Sci Rep. 8(1):5632. ...
abe:ARB_03861 K00799 glutathione S-transferase [EC:2.5.1.18] , (RefSeq) glutathione S-transferase Ure2-like, putative (A) MSTLKPLKLYGGIFPANPLKVALVLEELGLPYETEDVPMAERKKPPFTNINPNGRTPALY DPNTDLNIWESGAIVSYLVDKYDKDHKISFPHDTNEYYSANQWLHFQMSGQGPYYGQYFW FINYHPEKVPSAIDRYYNEINRVVGVLEKWLAGSEDGGDGKGPRNYIMGDKCTYTDLVLF PWQIFLPRIVWKGKLNPETEFPNVMAWVKRIGARPSLERILTEVNAIAEPFLKAAEEKMA KEAEEEKQ ...
Yezza.. bulan ni memang OFFER BEST ! Mana taknya Offer untuk Shaklee VIVIX ! Pasti ramai yang dah ternanti-nanti, tertunggu-tunggu bilalah agaknya Shaklee VIVIX ni nak offer lagi kan? Haa.. tu lar.. masa tengah offer takmo beli.. Dah abes offer tanya lak.. hihi.. Takpe, takpe.. ni offer dah datang lagi, jangan tunggu lama-lama, silalah rembat yea.. HARGA OFFER memang berbaloi.. ...
Growing up playing side-scrolling action games like Oddworld: Abes Oddysee and Another World has cemented my love of the genre, so any time I get the chance to play another title in that vein, I jump at the chance. Enter Rocketbirds: Hardb...
The trouble with retirement is that you never get a day off." Abe Lemons Retirement is a stage of life where one requires financial support and proper care. The best thing you can do is to plan for your retirement. Target-date mutual fund is one of the best retirement options with low-maintenance requirements. According to… Read More ». ...
This Histri was built automatically but not manually verified. As a consequence, the Histri can be incomplete or can contain errors ...
This Histri was built automatically but not manually verified. As a consequence, the Histri can be incomplete or can contain errors ...
Preliminary work has been done on the formulation of a new solventogenic clostridial fermentation medium based on the use of corn steep liquor (CSL). CSL is a by-product of the corn wet-milling industry, and has been used primarily as a feed supplement in the livestock industry. This nutrient-rich medium is an ideal base for use in a bacterial fermentation medium. A medium developed from CSL has been found to support good bacterial growth while allowing a level of solvent production approaching that of complex, more expensive clostridial growth media. When used in combination with C. beijerinckii, BA101, this newly developed medium holds promise to increase the cost-effectiveness of the ABE fermentation. (Abstract shortened by UMI ...
Pure bacterial strains give better yields when producing H2 than mixed, natural communities. However the main drawback with the pure cultures is the need to perform the fermentations under sterile conditions. Therefore, H2 production using artificial co-cultures, composed of well characterized strains, is one of the directions currently undertaken in the field of biohydrogen research. Four pure Clostridium cultures, including C. butyricum CWBI1009, C. pasteurianum DSM525, C. beijerinckii DSM1820 and C. felsineum DSM749, and three different co-cultures composed of (1) C. pasteurianum and C. felsineum, (2) C. butyricum and C. felsineum, (3) C. butyricum and C. pasteurianum, were grown in 20 L batch bioreactors. In the first part of the study a strategy composed of three-culture sequences was developed to determine the optimal pH for H2 production (sequence 1); and the H2-producing potential of each pure strain and co-culture, during glucose (sequence 2) and starch (sequence 3) fermentations at the optimal
OptKnock algorithm was used as part of a study in RobOKoD: microbial strain design for (over)production of target compounds. (http://fairdomhub.org/publications/236). It was used to generate a strain of e.coli for producing butanol, that was then compared to an experimental strain. ...
ID Q13RX3_PARXL Unreviewed; 102 AA. AC Q13RX3; DT 22-AUG-2006, integrated into UniProtKB/TrEMBL. DT 22-AUG-2006, sequence version 1. DT 07-JUN-2017, entry version 78. DE RecName: Full=Exodeoxyribonuclease 7 small subunit {ECO:0000256,HAMAP-Rule:MF_00337}; DE EC=3.1.11.6 {ECO:0000256,HAMAP-Rule:MF_00337}; DE AltName: Full=Exodeoxyribonuclease VII small subunit {ECO:0000256,HAMAP-Rule:MF_00337}; DE Short=Exonuclease VII small subunit {ECO:0000256,HAMAP-Rule:MF_00337}; GN Name=xseB {ECO:0000256,HAMAP-Rule:MF_00337}; GN ORFNames=Bxe_B2829 {ECO:0000313,EMBL:ABE33166.1}; OS Paraburkholderia xenovorans (strain LB400). OC Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; OC Burkholderiaceae; Paraburkholderia. OX NCBI_TaxID=266265 {ECO:0000313,EMBL:ABE33166.1, ECO:0000313,Proteomes:UP000001817}; RN [1] {ECO:0000313,EMBL:ABE33166.1, ECO:0000313,Proteomes:UP000001817} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=LB400 {ECO:0000313,EMBL:ABE33166.1, RC ...
Abe, N; Yamaguchi, T; Hoshino, F; Suzuki, F; Ebina, A; and Ishida, N, "Antitumor and interferon-inducing activities of th69, a whole bacterial preparation of streptococcus faecalis, in mice." (1982). Subject Strain Bibliography 1982. 853 ...
Rapporteur: Chris B. Cameron. Tricia Abe began her lecture by asking How do genetic drift and selection interact to produce new species?" That is, is speciation a by-product of adaptation or do adaptive differences accumulate after genetic reorganization has occurred in a founder event? Viewing speciation in a historical context we see that Darwin (1859) was the first to recognize lineage splitting in The Evolution of Species, but he didnt address the underlying mechanism of speciation. Fisher (1918) documented the accumulation of new and favorable mutations in a population, and that adaptation produces genetic differences as a side effect. In 1931 Wright noticed that the non adaptive drift in small stable populations is sufficient to favor gene combinations that are unlikely to occur in larger populations, and that eventually this drift would become hard wired by natural selection. In 1940 Mayr formulated the biological species concept and by 1954 recognized that random genetic drift and ...
Theeb (Jacir Eid Al-Hwietat), which translates to "wolf," is the younger brother of Hussein (Hussein Salameh Al-Sweilhiyeen), and both are members of a Bedouin community with an uncanny familiarity with their surroundings, which to any visitor might seem simply like endless desert. A British officer arrives and requests to be guided through the desert by Hussein, and, naturally, Theeb cannot resist tagging along, staying back from the group as he follows the officer towards his unknown destination. Disaster quickly strikes as repeated warnings about the danger of where they are going are confirmed by the presence of vicious attacking raiders, and Theeb must do what he can to survive that and subsequent encounters ...
uuid": "01b2f724-da2b-4454-bdc7-54d8abe61307", "type": "records", "etag": "791373ae7829c8e81a95ea6186b012efb6b4f304", "data": { "dwc:specificEpithet": "incisa", "dwc:county": "Orange", "dwc:georeferenceSources": "GeoLocate", "dwc:order": "Peltigerales", "dcterms:references": "http://lichenportal.org/portal/collections/individual/index.php?occid=1045824", "dwc:scientificNameAuthorship": "Pers.", "dwc:occurrenceID": "01b2f724-da2b-4454-bdc7-54d8abe61307", "id": "1045824", "dwc:stateProvince": "Florida", "dwc:collectionID": "c04ce95d-61fb-4708-b6b0-77c2eaf24cc1", "dwc:institutionCode": "TENN", "dwc:country": "United States", "idigbio:recordId": "urn:uuid:01b2f724-da2b-4454-bdc7-54d8abe61307", "symbiota:recordEnteredBy": "nglenn5", "dwc:kingdom": "Fungi", "dwc:decimalLatitude": "28.698608", "dwc:occurrenceRemarks": "Data, see inside.", "dwc:basisOfRecord": "PreservedSpecimen", "dwc:genus": "Coccocarpia", "dwc:family": "Coccocarpiaceae", "dc:rights": "http://creativecommons.org/licenses/by-nc/3.0/", ...
The government recently passed the so-called Special Secrets Protection Bill, which closely resembles the 1985 legislation. Abe recently became the first sitting prime minister since 2006 to visit Yasukuni Shrine. And he has announced his intention to disregard the protests of the Chinese and Korean governments against nationalist whitewashing in Japanese history textbooks.. The sort of violent right-wing discourse that characterized Sekihotai is now all too familiar. Just look at visitors comments on Mr. Abes Facebook page. "Forget about those primitive Chinese and Koreans. The time has come to do battle with the anti-Japanese mass media (above all Asahi types)," says one, adding, "The primitive Chinese and Koreans have no influence anyway; the Japanese mass media, which go on brainwashing so many of the nations citizens, are infinitely worse. Theyre a dauntless, hardy enemy, but this is a fight-or-die moment. Fight for us, Prime Minister Abe!!". The languages virulence doesnt quite come ...
Japanese PM Shinzo Abe and Tokyo Governor Yuriko Koike agreed Tuesday to work together to ensure the success of the 2020 Tokyo Olympics and Paralympics, eschewing for now talks on how the financial burden should be shared, according to KYODO. Koike said after meeting with Abe in the PMs
Influence of surface flashover and charging characteristics in vacuum on alumina ceramics exposed to intense X-ray irradiation (放電 開閉保護 高電圧合同研究会 雷・高電圧,開閉保護,放電技術一般(IWHV2016 & JK2016)) (2016 ...
Ml REVEILLE "" PUBLISHED BY THE SENIOR CLASS MARYLAND AGRICULTURAL COLLEGE COLLEGE PARK, MD. iei3 VOLUME SIXTEEN ®0 in grateful apprrrialinu fatlitful fri^it&5t)t^j tn nitr Alma Mntn anb as a Sribut^ tn a "p^rf^rt lunman, unblg planitpb" m^ ftritratr iRfunlb MARYLAND AGRICULTURAL COLLEGE (iwcttng: W.0 our true frtcnb©, foI]o e6er foisl] us tuell; to our *olh boos," 6tI]0 rljensb foitb memories, grabe aub t^ay, of tl,eir ofou bays at tl]e olb college, cl]augeb tliouglj it may be; to our faculty, past mxb preseut, &il]0 l]abe so patieittly borue loitI, us; auh to our motI,ers, sisters, aith sloeetI]earts, lol,0 look forfuarb aub back aqaiu to tl]e rosy joys auh proub monteuts of Olommeuceuteut; - frotix tl]e ^eittor Class of tl,e ^JHarylaub Agricultural CUollege, mxct rats,- uofu lueu: (ireetiug. pie l,abe joyfully hone mud] ebil iu our libes; but if foe e&er hlh auy ebil to you, 6ie repeitt, auh ask your forgibeuess^ ^e lay before you our (oork for tbe year, iu atl]letic, liter- ary, auh ...
act was measured on similar two scales with a slightly different preceding words as "As a whole purchasing margarine X is".. 928 housewives of family size of two or more were randomly extracted form Tokyo, Kyoto, Osaka, and their vicinities. Data were collected by personal interview method during September 1985. This interview covered several products among which margarine was the one for this research purpose. Of 938 housewives, 138 were absent and 230 refused to corporate, therefore, the remaining 260 housewives answered the questionnaire. Two forms of questionnaire were used on a split run basis, i.e., one for collecting data on Ao and the other for collecting data on Aacts Of those who responded, we further limited the sample respondents to those whose evoked set plus hold set included all three brands of concern. If any one of these three brands belonged to foggy set, unawareness set, or reject set, then the respondent was excluded form the sample (Laroche et. al., 1983). In other words, ...
Timothy Hughes Rare & Early Newspapers offers the largest inventory of original historic newspapers for sale, all guaranteed authentic and all at great prices.
Building Type: Architecture critic Christopher Hawthorne in conversation with two architecture deans, who have plenty to say about their schools and this city.
Dr. Singh has joined the faculty of ABE and EEE on the West Lafayette campus. Please see her website for additional information. For publications, please visit her Google Scholar page ...
Ito Mikako , Miyamoto Junko , Mori Yumiko , FUJIMOTO Satoru , UCHIUMI Toshiki , ABE Mikiko , SUZUKI Akihiro , TABATA Satoshi , FUKUI Kiichi Journal of plant research 113(1112), 435-442, 2000-12-01 DOI 参考文献39件 被引用文献6件 ...
ok, nenek eqa prnh cite, time zaman jepun dlu, sgt susah... mkn ubi kayu jerk... then klu girls, xyah ar kuar rmh bhaye... sbb tkut kne rape... so nenek kte klu dyorg nk kuar.. kne conteng arang kt muka.. so, jepon xkn terpikat ngan yg hodoh2...then, until now, nenek sgt x suke ngan jepun...(tp cucu dy nie suka tgk cite jepun, abes ar klu nenek tau...shhhh ...
Learn more about 3-3-dimethyl-2-butanol. We enable science by offering product choice, services, process excellence and our people make it happen.
Recently, lignocellulosic biomass as the most abundant renewable resource has been widely considered for bioalcohols production. However, the complex structure of lignocelluloses requires a multi-step process which is costly and time consuming. Although, several bioprocessing approaches have been developed for pretreatment, saccharification and fermentation, bioalcohols production from lignocelluloses is still limited because of the economic infeasibility of these technologies. This cost constraint could be overcome by designing and constructing robust cellulolytic and bioalcohols producing microbes and by using them in a consolidated bioprocessing (CBP) system. This paper comprehensively reviews potentials, recent advances and challenges faced in CBP systems for efficient bioalcohols (ethanol and butanol) production from lignocellulosic and starchy biomass. The CBP strategies include using native single strains with cellulytic and alcohol production activities, microbial co-cultures containing both
The symposium will include research roundtable presentations, industry panels, a plenary speaker and lunch, a poster session, and evening banquet and keynote speaker. Research roundtables will consist of four ten minute student presentations in four independent sessions focusing on the following ABE core research areas: 1) Environmental and Natural Resources, 2) Biological / Food Process Engineering, 3) Machine Systems / Fluid Power, and 4) Bio-Energy. To submit an abstract for the presentation or poster session, please complete the form by February 21. Available here: http://tinyurl.com/kaehpxm. Registration is not required to attend the symposium.. Thursday, March 6. 7:30 AM - 8:00 AM Breakfast, Burton D. Morgan Center (MRGN). 8:00 AM - 9:00 AM Research Roundtables (sessions in parallel), MRGN. 9:15 AM - 10:15 AM Research Roundtables (sessions in parallel), MRGN. 10:30 AM - 11:30 AM Industry Panels, MRGN. 12:00 PM - 1:30 PM Plenary Speaker & Lunch, MRGN. Sonny Ramaswamy, Director, NIFA 2:00 PM ...
When Dr. Abe Mandelbaum (Martin Landau) moves into the nursing home, Cliffside Manor, with his deteriorating wife Molly, he forms an improbable relationship with gambler and womanizer, Phil Nicoletti (Paul Sorvino). Even though at first Abe feels that moving into the home is the end of the road, he soon realizes that his life is finding a whole new beginning. Abe and Phils friendship is challenged when a mysterious nurse claims that her biological father resides in the home. Without children of their own, both Abe and Phil jump at the chance to convince Angela, and themselves, that they are her father. The Last Poker Game is written and directed by world renowned neurologist, and first time director, Howard Weiner ...
By Vladimir Terekhov. On May 3 of this year, one of the most significant events of recent years marked the domestic political life of Japan. On this day, TV viewers of the country saw the record of the Prime Minister Shinzō Abe speech in front of the supporters of constitutional reforms from the ruling Liberal Democratic Party.. In the speech, the prime minister mainly reflected on a number of issues that were all best summarized in his passage, "I would like to express my sincere desire to transform the year 2020 into the year when the new Constitution shall finally come into force".. NEO occasionally addresses the topic of Japans potential constitutional reform. This is primarily because the issue concerns the most important aspect of the gradual return of the country to the "Great World Politics", which, as it seemed, irrevocably got out of it in the autumn of 1945.. This withdrawal was legally formalized in the post-war Constitution, mainly in the Article 9, which includes two paragraphs. ...
We hope you enjoy this excerpt from Pariah, new from Tor Books!. 1. February, Then. Larry Gabler lay there, gasping, bleeding. At seventy-two, he was Abes junior by eleven years, but at the moment he could have given Methuselah a run for his money.. "You gotta get home to Ruthie," he wheezed as sweat glossed his waxy face.. "Yeah, yeah," Abe said, pouring himself a stiff one from the bottle in his desk. The radio droned the barely cogent reportage of nervewracked correspondents attempting to articulate what was happening throughout the five boroughs-not to mention the entire globe. Abe took a tentative sip of the whisky, then downed it as he sauntered over to the window to catch an eyeful of uncorked chaos below. As he peered down, three taxis collided, the driver of one bursting through his windshield like a meat torpedo. People were jostling, shoving, climbing all over each other, every man for himself, the hell with the rest. The sounds of screams and random gunfire echoed in the darkening ...
With SeqCap Epi you can choose your own content or select the CpGiant Enrichment Kit. This off-the-shelf probe-set interrogates over 5.5 million methylation sites per sample at single-nucleotide resolution. This kit can serve as a screening tool to identify specific regions in the genome for methylation variation assessment. Capturing of known differentially methylated regions vastly reduces the sequencing output required to analyze the whole methylation landscape, compared to whole genome sequencing. Furthermore, it enables you to observe the methylation changes on both strands, while you can still study the SNPs in the targeted regions.. ...
Thanks to the latest development of high-throughput techniques that unambiguously identifies mammalian m6A sites in single-nucleotide resolution, now we are able to extract and integrate the sequence and predicted structural features around m6A sites under a machine learning framework and build a mammalian m6A sites predictor: SRAMP (sequence-based RNA adenosine methylation site predictor). SRAMP achieves promising performance both in cross-validation tests on its training dataset, and in the rigorous independent tests. Another highlighting trait of this predictor is that only RNA sequences are required when running a prediction and no external -omics data are loaded. Therefore, SRAMP would serve as a useful tool to predict m6A modification sites on the RNA sequences of interests ...
Increasing demand for the production of renewable fuels has recently generated a particular interest in microbial production of butanol. Anaerobic bacteria, such as Clostridium spp., can naturally convert carbohydrates into a variety of primary products, including alcohols like butanol. The genetics of microorganisms like Clostridium acetobutylicum have been well studied and their solvent-producing metabolic pathways characterized. In contrast, less is known about the genetics of Clostridium spp. capable of converting syngas or its individual components into solvents. In this study, the type of strain of a new solventogenic Clostridium species, C. carboxidivorans, was genetically characterized by genome sequencing. C. carboxidivorans strain P7T possessed a complete Wood-Ljungdahl pathway gene cluster, involving CO and CO2 fixation and conversion to acetyl-CoA. Moreover, with the exception of an acetone production pathway, all the genetic determinants of canonical ABE metabolic pathways for acetate,
This Small Business Innovation Research (SBIR) Phase I project will develop a costeffective butanol production and purification process. The specific aim of this project is to scaleup a butanol production system from a small, ?laboratory scale? ,2 liter volume, to a 200 liter culture volume in order to determine the feasibility of its utility for production of practical amounts of the valuable biofuel. The broader/commercial impacts of this research are that the process should be configurable for fuel and/or hydrogen production by individuals safely and with negligible environmental impact, and that demonstration of the feasibility of production of fuels by ?microrefineries? could foster growth of a network of ?cottage industries? devoted to local fuel and biochemicals production that could provide increased opportunities for employment in rural areas where carbohydraterich waste streams are available. The growth of the dairy products industry in eastern South Dakota has resulted in the ...
CRISPR/Cas-based genetic engineering has revolutionised molecular biology in both eukaryotes and prokaryotes. Several tools dedicated to the genomic transformation of the Clostridium genus of Gram-positive bacteria have been described in the literature; however, the integration of large DNA fragments still remains relatively limited. In this study, a CRISPR/Cas9 genome editing tool using a two-plasmid strategy was developed for the solventogenic strain Clostridium acetobutylicum ATCC 824. Codon-optimised cas9 from Streptococcus pyogenes was placed under the control of an anhydrotetracycline-inducible promoter on one plasmid, while the gRNA expression cassettes and editing templates were located on a second plasmid. Through the sequential introduction of these vectors into the cell, we achieved highly accurate genome modifications, including nucleotide substitution, gene deletion and cassette insertion up to 3.6 kb. To demonstrate its potential, this genome editing tool was used to generate a marker-free
The combative, off-putting Dark Horse features many of writer-director Todd Solondzs usual preoccupations: misery, complexity, stunted emotions, misplaced dreams. The one glaring absence is any fixation on child abuse or sexual depravity of some kind, though it would be easy to assume that these damaged souls might be hiding a few seriously complicated backstories. Whats more, one of those souls looks awfully familiar: the gloomy, sloe-eyed Miranda, a depressive ex-writer who meets a toy-collecting slacker at a wedding and days later agrees to marry him. Mirandas affair with Abe opens with boredom and concludes, many difficult minutes later, in the soapy zone of sudden melodramatic excess. Despite being pampered and fed by his odd, exhausted parents (Christopher Walken, never freakier, and Mia Farrow, never fainter), Abe is still convinced they love his front-running high-achieving doctor brother (Justin Bartha) way, way more.

Clostridium beijerinckii - Overview - Encyclopedia of LifeClostridium beijerinckii - Overview - Encyclopedia of Life

Clostridia +*Clostridiales +*Clostridiaceae +*Clostridium +*Clostridium beijerinckii + * Clostridium beijerinckii NCIMB 8052 * ... Clostridium beijerinckii AAU1 * Clostridium beijerinckii ATCC 35702 * Clostridium beijerinckii G117 * Clostridium beijerinckii ...
more infohttp://eol.org/pages/1015432/overview

Clostridium beijerinckii - WikipediaClostridium beijerinckii - Wikipedia

Clostridium beijerinckii is a gram positive, rod shaped, motile bacterium of the genus Clostridium. It has been isolated from ... Clostridium acetobutylicum Butanol A.B.E. process Clostridium beijerinckii information from JGI bacterio.net, list of ... "Physical map of the Clostridium beijerinckii (formerly Clostridium acetobutylicum) NCIMB 8052 chromosome". American Society for ... Type strain of Clostridium beijerinckii at BacDive - the Bacterial Diversity Metadatabase Biology portal. ...
more infohttps://en.wikipedia.org/wiki/Clostridium_beijerinckii

purH - Bifunctional purine biosynthesis protein PurH - Clostridium beijerinckii NRRL B-598 - purH gene & proteinpurH - Bifunctional purine biosynthesis protein PurH - Clostridium beijerinckii NRRL B-598 - purH gene & protein

Clostridium beijerinckii NRRL B-598Imported. ,p>Information which has been imported from another database using automatic ... tr,A0A0K2MHX2,A0A0K2MHX2_CLOBE Bifunctional purine biosynthesis protein PurH OS=Clostridium beijerinckii NRRL B-598 OX=1428454 ... cellular organisms › Bacteria › Terrabacteria group › Firmicutes › Clostridia › Clostridiales › Clostridiaceae › Clostridium › ...
more infohttps://www.uniprot.org/uniprot/A0A0K2MHX2

Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423 | BMC Genomics | Full TextGenome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423 | BMC Genomics | Full Text

We present the full genome sequence of Clostridium beijerinckii DSM 6423, providing a complete genetic background of this ... The complete genome sequence and a first transcriptome analysis of C. beijerinckii DSM 6423 are described in this manuscript. ... Isopropanol has recently received a specific interest and the best studied natural isopropanol producer is C. beijerinckii DSM ... Research efforts including omics and genetic engineering approaches are therefore needed to enable the use of C. beijerinckii ...
more infohttps://bmcgenomics.biomedcentral.com/articles/10.1186/s12864-018-4636-7

IDEALS @ Illinois: Production of 1-butanol and butanol isomers by metabolically engineered Clostridium beijerinckii and...IDEALS @ Illinois: Production of 1-butanol and butanol isomers by metabolically engineered Clostridium beijerinckii and...

... fermentation by solventogenic clostridia such as Clostridium beijerinckii. Although the ABE fermentation is considered as a ... Clostridium beijerinckii Saccharomyces cerevisiae Metabolic engineering. Abstract:. The overall goal of my thesis research is ... Production of 1-butanol and butanol isomers by metabolically engineered Clostridium beijerinckii and Saccharomyces cerevisiae. ... Production of 1-butanol and butanol isomers by metabolically engineered Clostridium beijerinckii and Saccharomyces cerevisiae. ...
more infohttps://www.ideals.illinois.edu/handle/2142/97592

Abstract: Two-Stage Gas Stripping Recovery Process for Enhanced Butanol Production in Acetone-Butanol-Ethanol Fermentation by...Abstract: Two-Stage Gas Stripping Recovery Process for Enhanced Butanol Production in Acetone-Butanol-Ethanol Fermentation by...

Stripping Recovery Process for Enhanced Butanol Production in Acetone-Butanol-Ethanol Fermentation by Clostridium Beijerinckii ... was developed for online butanol recovery from ABE fermentation by a butanol-tolerant mutant strain of Clostridium beijerinckii ... fermentation by solventogenic Clostridia. However, conventional ABE fermentation is limited by the low butanol product titer (, ...
more infohttps://aiche.confex.com/aiche/2010/webprogram/Paper192991.html

Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423, BMC Genomics | 10.1186/s12864...Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423, BMC Genomics | 10.1186/s12864...

"Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423, BMC Genomics" on DeepDyve, the ... BMC Genomics (2018) 19:242 Page 10 of 12 in Clostridium beijerinckii NCIMB8052 [8], in Clostridium response using butanol [6] ... BMC Genomics (2018) 19:242 Page 10 of 12 in Clostridium beijerinckii NCIMB8052 [8], in Clostridium response using butanol [6] ... 2 Fermentation profile of Clostridium beijerinckii DSM6423 on glucose. C. beijerinckii DSM 6423 was cultivated in bioreactors ...
more infohttps://www.deepdyve.com/lp/springer_journal/genome-and-transcriptome-of-the-natural-isopropanol-producer-6quRAFWuIW

Metabolic engineering of Clostridium beijerinckii to improve glycerol metabolism and furfural tolerance | Biotechnology for...Metabolic engineering of Clostridium beijerinckii to improve glycerol metabolism and furfural tolerance | Biotechnology for...

By overexpressing two glycerol dehydrogenase (Gldh) genes (dhaD1 and gldA1) from the glycerol hyper-utilizing Clostridium ... Inefficient utilization of glycerol by Clostridium beijerinckii (Cb) is a major impediment to adopting glycerol metabolism as a ... From: Metabolic engineering of Clostridium beijerinckii to improve glycerol metabolism and furfural tolerance ...
more infohttps://biotechnologyforbiofuels.biomedcentral.com/articles/10.1186/s13068-019-1388-9/figures/3

Exogenous anthrahydroquinone-2,6-disulfonate specifically increases xylose utilization during mixed sugar fermentation by...Exogenous anthrahydroquinone-2,6-disulfonate specifically increases xylose utilization during mixed sugar fermentation by...

6-disulfonate specifically increases xylose utilization during mixed sugar fermentation by Clostridium beijerinckii NCIMB 8052 ...
more infohttps://www.research-collection.ethz.ch/handle/20.500.11850/65325

Cansu Birgen - SINTEFCansu Birgen - SINTEF

The Effect of Feeding Strategy on Butanol Production by Clostridium beijerinckii NCIMB 8052 Using Glucose and Xylose https:// ... Modeling the Growth of Clostridium beijerinckii NCIMB 8052 on Lignocellulosic Sugars https://www.sintef.no/publikasjoner/ ... Response Surface Methodology for Understanding Glucose and Xylose Utilization by Clostridium beijerinckii NCIMB 8052 https:// ... Understanding Effect of Sugar Composition on Growth Kinetics: Fermentation of Glucose and Xylose by Clostridium Acetobutylicum ...
more infohttps://www.sintef.no/alle-ansatte/ansatt/?empId=7717

Sidsel Markussen - SINTEFSidsel Markussen - SINTEF

The Effect of Feeding Strategy on Butanol Production by Clostridium beijerinckii NCIMB 8052 Using Glucose and Xylose https:// ... Modeling the Growth of Clostridium beijerinckii NCIMB 8052 on Lignocellulosic Sugars https://www.sintef.no/publikasjoner/ ... Response Surface Methodology for Understanding Glucose and Xylose Utilization by Clostridium beijerinckii NCIMB 8052 https:// ...
more infohttps://www.sintef.no/alle-ansatte/ansatt/?empId=918

Systems biotechnology and metabolic engineeringSystems biotechnology and metabolic engineering

Enhanced phenolic compounds tolerance response of Clostridium beijerinckii NCIMB 8052 by inactivation of Cbei_3304 Phenolic ... Metabolic engineering of Clostridium cellulolyticum for the production of n-butanol from crystalline cellulose Sustainable ... in hydrolysis of lignocellulosic materials are major limiting factors for biological production of solvents by Clostridia, but ...
more infohttps://www.biomedcentral.com/collections/systemsbiotech

Similar proteins: Anti-sigma F factor (B0K150) | InterPro | EMBL-EBISimilar proteins: Anti-sigma F factor (B0K150) | InterPro | EMBL-EBI

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052). Loading... A6QIR1 Serine-protein kinase RsbW. Staphylococcus aureus ...
more infohttp://www.ebi.ac.uk/interpro/protein/B0K150/similar-proteins

Proteins matched: SSF63829 (SSF63829) | InterPro | EMBL-EBIProteins matched: SSF63829 (SSF63829) | InterPro | EMBL-EBI

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052). Loading... A9VQJ9 Virginiamycin B lyase. Bacillus weihenstephanensis ...
more infohttp://www.ebi.ac.uk/interpro/signature/SSF63829/proteins-matched

BRENDA - Reference to 1.1.1.71; Id = 728288BRENDA - Reference to 1.1.1.71; Id = 728288

Clostridium beijerinckii, Thermoanaerobacter brockii. J. Mol. Biol.. 278. 967-981. 1998. -. -. -. 2 ...
more infohttps://www.brenda-enzymes.org/literature.php?e=1.1.1.71&r=728288

Publications - Universität UlmPublications - Universität Ulm

Clostridium acetobutylicum, Clostridium beijerinckii and related organisms. Wiley-Blackwell Biotechnology Series. In: Advanced ... Karl MM, Poehlein A, Bengelsdorf FR, Daniel R, Dürre P (2017). Complete genome sequence of the autotrophic acetogen Clostridium ... The complete genome sequence of Clostridium aceticum: a missing link between Rnf- and cytochrome-containing autotrophic ... Improved operating strategy for continuous fermentation of carbon monoxide to fuel-ethanol by clostridia. Applied Energy 169: ...
more infohttps://www.uni-ulm.de/nawi/nawi-mikrobio/forschung/dr-frank-bengelsdorf/publications/

MemberMember

Analysis of Clostridium beijerinckii NCIMB 8052s transcriptional response to ferulic acid and its application to enhance the ...
more infohttps://www.biomedcentral.com/about/institutional-support/membership/1600136011/1600136011?searchType&

Search ResultsSearch Results

Our research uses the bacterium Clostridium beijerinckii as the model for the fermentative production of butanol using ... Esbenshade, Aaron JDifferential Protein Expression and Butanol Production using Clostridium beijerinckii. ... We have been able to grow C. beijerinckii in media containing xylose or glucose as the principle sugars, both which are present ...
more infohttps://etd.ohiolink.edu/pg_6?0::NO:6:P6_SUBJECTS:23

Milestones Tables : MetricsMilestones Tables : Metrics

Genus: Clostridium. 84. Clostridium acetobutylicum. 31. Clostridium beijerinckii. 1. Clostridium difficile. 19. ...
more infohttp://www.sbkb.org/metrics/milestonestables.html

BRENDA - Reference to 1.1.1.6; Id = 636296BRENDA - Reference to 1.1.1.6; Id = 636296

Clostridium beijerinckii and C .... Clostridioides difficile, Clostridium beijerinckii. Appl. Environ. Microbiol.. 67 ...
more infohttp://www.brenda-enzymes.org/literature.php?e=1.1.1.6&r=636296

Bidard F[au] - PubMed - NCBIBidard F[au] - PubMed - NCBI

Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423.. Máté de Gérando H, Wasels F, ... Correction to: Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM6423. ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed?cmd=search&term=Bidard+F%5Bau%5D&dispmax=50

Jiang W[au] - PubMed - NCBIJiang W[au] - PubMed - NCBI

CRISPR-Cas9D10A nickase-assisted base editing in solvent producer Clostridium beijerinckii. ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed?cmd=search&term=Jiang+W%5Bau%5D&dispmax=50

Biotechnology for Fuels and Chemicals | SpringerLinkBiotechnology for Fuels and Chemicals | SpringerLink

Production of Acetone Butanol Ethanol from Degermed Corn Using Clostridium beijerinckii BA101 ...
more infohttps://link.springer.com/book/10.1007/978-1-4612-0119-9

Applications filed at May 24 2018 | SYSTEM INTEGRATING ATOMIC LAYER DEPOSITION AND REACTIVE ION ETCHING | Patents.comApplications filed at May 24 2018 | SYSTEM INTEGRATING ATOMIC LAYER DEPOSITION AND REACTIVE ION ETCHING | Patents.com

MUTANT STRAINS OF THE GENUS CLOSTRIDIUM BEIJERINCKII. The present invention relates to mutant bacteria of the genus Clostridium ... beijerinckii, CNCM I-4985, CNCM I-4986, CNCM I-4987 and CNCM I-4988, deposited at the... ...
more infohttp://patents.com/ap-20180524-p85.html