A large family of transmembrane proteins found in TIGHT JUNCTIONS. They take part in the formation of paracellular barriers and pores that regulate paracellular permeability.
A ubiquitously-expressed claudin subtype that acts as a general barrier-forming protein in TIGHT JUNCTIONS. Elevated expression of claudin-3 is found in a variety of tumor cell types, suggesting its role as a therapeutic target for specific ANTINEOPLASTIC AGENTS.
An integral membrane protein that is localized to TIGHT JUNCTIONS, where it plays a role in controlling the paracellular permeability of polarized cells. Mutations in the gene for claudin-1 are associated with Neonatal Ichthyosis-Sclerosing Cholangitis (NISCH) Syndrome.
A claudin subtype that takes part in maintaining the barrier-forming property of TIGHT JUNCTIONS. Claudin-4 is found associated with CLAUDIN-8 in the KIDNEY COLLECTING DUCT where it may play a role in paracellular chloride ion reabsorption.
Cell-cell junctions that seal adjacent epithelial cells together, preventing the passage of most dissolved molecules from one side of the epithelial sheet to the other. (Alberts et al., Molecular Biology of the Cell, 2nd ed, p22)
A claudin subtype that is found localized to TIGHT JUNCTIONS in VASCULAR ENDOTHELIAL CELLS. The protein was initially identified as one of several proteins which are deleted in VELOCARDIOFACIAL SYNDROME and may play an important role in maintaining the integrity of the BLOOD-BRAIN BARRIER.
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
A MARVEL domain protein that plays an important role in the formation and regulation of the TIGHT JUNCTION paracellular permeability barrier.
A 195-kDa zonula occludens protein that is distinguished by the presence of a ZU5 domain at the C-terminal of the molecule.
A zonula occludens protein subtype found in epithelial cell junctions. Several isoforms of zonula occludens-2 protein exist due to use of alternative promoter regions and alternative mRNA splicings.
A claudin subtype that is associated with the formation of cation-selective channels and increased epithelial permeability. It is localized to the TIGHT JUNCTIONS of the PROXIMAL KIDNEY TUBULE and INTESTINAL EPITHELIUM.
A specialized barrier, in the TESTIS, between the interstitial BLOOD compartment and the adluminal compartment of the SEMINIFEROUS TUBULES. The barrier is formed by layers of cells from the VASCULAR ENDOTHELIUM of the capillary BLOOD VESSELS, to the SEMINIFEROUS EPITHELIUM of the seminiferous tubules. TIGHT JUNCTIONS form between adjacent SERTOLI CELLS, as well as between the ENDOTHELIAL CELLS.
Property of membranes and other structures to permit passage of light, heat, gases, liquids, metabolites, and mineral ions.
The resistance to the flow of either alternating or direct electrical current.
The technique of placing cells or tissue in a supporting medium so that thin sections can be cut using a microtome. The medium can be paraffin wax (PARAFFIN EMBEDDING) or plastics (PLASTIC EMBEDDING) such as epoxy resins.
A genus of pufferfish commonly used for research.
Cells that line the inner and outer surfaces of the body by forming cellular layers (EPITHELIUM) or masses. Epithelial cells lining the SKIN; the MOUTH; the NOSE; and the ANAL CANAL derive from ectoderm; those lining the RESPIRATORY SYSTEM and the DIGESTIVE SYSTEM derive from endoderm; others (CARDIOVASCULAR SYSTEM and LYMPHATIC SYSTEM) derive from mesoderm. Epithelial cells can be classified mainly by cell shape and function into squamous, glandular and transitional epithelial cells.
Excretion of abnormally high level of CALCIUM in the URINE, greater than 4 mg/kg/day.
An inherited renal disorder characterized by defective NaCl reabsorption in the convoluted DISTAL KIDNEY TUBULE leading to HYPOKALEMIA. In contrast with BARTTER SYNDROME, Gitelman syndrome includes hypomagnesemia and normocalcemic hypocalciuria, and is caused by mutations in the thiazide-sensitive SODIUM-POTASSIUM-CHLORIDE SYMPORTERS.
A condition characterized by calcification of the renal tissue itself. It is usually seen in distal RENAL TUBULAR ACIDOSIS with calcium deposition in the DISTAL KIDNEY TUBULES and the surrounding interstitium. Nephrocalcinosis causes RENAL INSUFFICIENCY.
A quality of cell membranes which permits the passage of solvents and solutes into and out of cells.
Human colonic ADENOCARCINOMA cells that are able to express differentiation features characteristic of mature intestinal cells, such as ENTEROCYTES. These cells are valuable in vitro tools for studies related to intestinal cell function and differentiation.
The U-shaped portion of the renal tubule in the KIDNEY MEDULLA, consisting of a descending limb and an ascending limb. It is situated between the PROXIMAL KIDNEY TUBULE and the DISTAL KIDNEY TUBULE.
Preparation for electron microscopy of minute replicas of exposed surfaces of the cell which have been ruptured in the frozen state. The specimen is frozen, then cleaved under high vacuum at the same temperature. The exposed surface is shadowed with carbon and platinum and coated with carbon to obtain a carbon replica.
Cells of epithelial origin possessing specialized sensory functions. They include cells that are found in the TASTE BUDS; OLFACTORY MUCOSA; COCHLEA; and NEUROEPITHELIAL BODIES.
One or more layers of EPITHELIAL CELLS, supported by the basal lamina, which covers the inner or outer surfaces of the body.
Paired respiratory organs of fishes and some amphibians that are analogous to lungs. They are richly supplied with blood vessels by which oxygen and carbon dioxide are exchanged directly with the environment.
The domestic dog, Canis familiaris, comprising about 400 breeds, of the carnivore family CANIDAE. They are worldwide in distribution and live in association with people. (Walker's Mammals of the World, 5th ed, p1065)
Anchoring points where the CYTOSKELETON of neighboring cells are connected to each other. They are composed of specialized areas of the plasma membrane where bundles of the ACTIN CYTOSKELETON attach to the membrane through the transmembrane linkers, CADHERINS, which in turn attach through their extracellular domains to cadherins in the neighboring cell membranes. In sheets of cells, they form into adhesion belts (zonula adherens) that go all the way around a cell.
Supporting cells projecting inward from the basement membrane of SEMINIFEROUS TUBULES. They surround and nourish the developing male germ cells and secrete ANDROGEN-BINDING PROTEIN and hormones such as ANTI-MULLERIAN HORMONE. The tight junctions of Sertoli cells with the SPERMATOGONIA and SPERMATOCYTES provide a BLOOD-TESTIS BARRIER.
A usually benign glandular tumor composed of oxyphil cells, large cells with small irregular nuclei and dense acidophilic granules due to the presence of abundant MITOCHONDRIA. Oxyphil cells, also known as oncocytes, are found in oncocytomas of the kidney, salivary glands, and endocrine glands. In the thyroid gland, oxyphil cells are known as Hurthle cells and Askanazy cells.
Histochemical localization of immunoreactive substances using labeled antibodies as reagents.
Direct contact of a cell with a neighboring cell. Most such junctions are too small to be resolved by light microscopy, but they can be visualized by conventional or freeze-fracture electron microscopy, both of which show that the interacting CELL MEMBRANE and often the underlying CYTOPLASM and the intervening EXTRACELLULAR SPACE are highly specialized in these regions. (From Alberts et al., Molecular Biology of the Cell, 2d ed, p792)
Established cell cultures that have the potential to propagate indefinitely.
Different forms of a protein that may be produced from different GENES, or from the same gene by ALTERNATIVE SPLICING.
The artificial induction of GENE SILENCING by the use of RNA INTERFERENCE to reduce the expression of a specific gene. It includes the use of DOUBLE-STRANDED RNA, such as SMALL INTERFERING RNA and RNA containing HAIRPIN LOOP SEQUENCE, and ANTI-SENSE OLIGONUCLEOTIDES.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action during the developmental stages of an organism.
Body organ that filters blood for the secretion of URINE and that regulates ion concentrations.
A form of fluorescent antibody technique commonly used to detect serum antibodies and immune complexes in tissues and microorganisms in specimens from patients with infectious diseases. The technique involves formation of an antigen-antibody complex which is labeled with fluorescein-conjugated anti-immunoglobulin antibody. (From Bennington, Saunders Dictionary & Encyclopedia of Laboratory Medicine and Technology, 1984)
Degree of saltiness, which is largely the OSMOLAR CONCENTRATION of SODIUM CHLORIDE plus any other SALTS present. It is an ecological factor of considerable importance, influencing the types of organisms that live in an ENVIRONMENT.
The simultaneous analysis of multiple samples of TISSUES or CELLS from BIOPSY or in vitro culture that have been arranged in an array format on slides or microchips.
The most common etiologic agent of GAS GANGRENE. It is differentiable into several distinct types based on the distribution of twelve different toxins.
A variation of the PCR technique in which cDNA is made from RNA via reverse transcription. The resultant cDNA is then amplified using standard PCR protocols.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A general term for the complete or partial loss of the ability to hear from one or both ears.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
Lining of the INTESTINES, consisting of an inner EPITHELIUM, a middle LAMINA PROPRIA, and an outer MUSCULARIS MUCOSAE. In the SMALL INTESTINE, the mucosa is characterized by a series of folds and abundance of absorptive cells (ENTEROCYTES) with MICROVILLI.
The part of the inner ear (LABYRINTH) that is concerned with hearing. It forms the anterior part of the labyrinth, as a snail-like structure that is situated almost horizontally anterior to the VESTIBULAR LABYRINTH.
Phenotypic changes of EPITHELIAL CELLS to MESENCHYME type, which increase cell mobility critical in many developmental processes such as NEURAL TUBE development. NEOPLASM METASTASIS and DISEASE PROGRESSION may also induce this transition.
The portion of renal tubule that begins from the enlarged segment of the ascending limb of the LOOP OF HENLE. It reenters the KIDNEY CORTEX and forms the convoluted segments of the distal tubule.
Substances that are toxic to the intestinal tract causing vomiting, diarrhea, etc.; most common enterotoxins are produced by bacteria.
Male germ cells derived from SPERMATOGONIA. The euploid primary spermatocytes undergo MEIOSIS and give rise to the haploid secondary spermatocytes which in turn give rise to SPERMATIDS.
Membrane-limited structures derived from the plasma membrane or various intracellular membranes which function in storage, transport or metabolism.
A malignant neoplasm arising from tenosynovial tissue of the joints and in synovial cells of tendons and bursae. The legs are the most common site, but the tumor can occur in the abdominal wall and other trunk muscles. There are two recognized types: the monophasic (characterized by sheaths of monotonous spindle cells) and the biphasic (characterized by slit-like spaces or clefts within the tumor, lined by cuboidal or tall columnar epithelial cells). These sarcomas occur most commonly in the second and fourth decades of life. (From Dorland, 27th ed; DeVita Jr et al., Cancer: Principles & Practice of Oncology, 3d ed, p1363)
A genetic rearrangement through loss of segments of DNA or RNA, bringing sequences which are normally separated into close proximity. This deletion may be detected using cytogenetic techniques and can also be inferred from the phenotype, indicating a deletion at one specific locus.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
The mucous membrane lining the RESPIRATORY TRACT, including the NASAL CAVITY; the LARYNX; the TRACHEA; and the BRONCHI tree. The respiratory mucosa consists of various types of epithelial cells ranging from ciliated columnar to simple squamous, mucous GOBLET CELLS, and glands containing both mucous and serous cells.
Carcinoma that arises from the PANCREATIC DUCTS. It accounts for the majority of cancers derived from the PANCREAS.
Molecular products metabolized and secreted by neoplastic tissue and characterized biochemically in cells or body fluids. They are indicators of tumor stage and grade as well as useful for monitoring responses to treatment and predicting recurrence. Many chemical groups are represented including hormones, antigens, amino and nucleic acids, enzymes, polyamines, and specific cell membrane proteins and lipids.
The determination of the pattern of genes expressed at the level of GENETIC TRANSCRIPTION, under specific circumstances or in a specific cell.
An EPITHELIUM with MUCUS-secreting cells, such as GOBLET CELLS. It forms the lining of many body cavities, such as the DIGESTIVE TRACT, the RESPIRATORY TRACT, and the reproductive tract. Mucosa, rich in blood and lymph vessels, comprises an inner epithelium, a middle layer (lamina propria) of loose CONNECTIVE TISSUE, and an outer layer (muscularis mucosae) of SMOOTH MUSCLE CELLS that separates the mucosa from submucosa.
Stratified squamous epithelium that covers the outer surface of the CORNEA. It is smooth and contains many free nerve endings.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
The physical or physiological processes by which substances, tissue, cells, etc. take up or take in other substances or energy.
Microscopy of specimens stained with fluorescent dye (usually fluorescein isothiocyanate) or of naturally fluorescent materials, which emit light when exposed to ultraviolet or blue light. Immunofluorescence microscopy utilizes antibodies that are labeled with fluorescent dye.
The sequential location of genes on a chromosome.
Specialized non-fenestrated tightly-joined ENDOTHELIAL CELLS with TIGHT JUNCTIONS that form a transport barrier for certain substances between the cerebral capillaries and the BRAIN tissue.
The outward appearance of the individual. It is the product of interactions between genes, and between the GENOTYPE and the environment.
Small polyhedral outpouchings along the walls of the alveolar sacs, alveolar ducts and terminal bronchioles through the walls of which gas exchange between alveolar air and pulmonary capillary blood takes place.
Proteins obtained from the ZEBRAFISH. Many of the proteins in this species have been the subject of studies involving basic embryological development (EMBRYOLOGY).
Test for tissue antigen using either a direct method, by conjugation of antibody with fluorescent dye (FLUORESCENT ANTIBODY TECHNIQUE, DIRECT) or an indirect method, by formation of antigen-antibody complex which is then labeled with fluorescein-conjugated anti-immunoglobulin antibody (FLUORESCENT ANTIBODY TECHNIQUE, INDIRECT). The tissue is then examined by fluorescence microscopy.
Calcium-dependent cell adhesion proteins. They are important in the formation of ADHERENS JUNCTIONS between cells. Cadherins are classified by their distinct immunological and tissue specificities, either by letters (E- for epithelial, N- for neural, and P- for placental cadherins) or by numbers (cadherin-12 or N-cadherin 2 for brain-cadherin). Cadherins promote cell adhesion via a homophilic mechanism as in the construction of tissues and of the whole animal body.
A carcinoma discovered by Dr. Margaret R. Lewis of the Wistar Institute in 1951. This tumor originated spontaneously as a carcinoma of the lung of a C57BL mouse. The tumor does not appear to be grossly hemorrhagic and the majority of the tumor tissue is a semifirm homogeneous mass. (From Cancer Chemother Rep 2 1972 Nov;(3)1:325) It is also called 3LL and LLC and is used as a transplantable malignancy.
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
An exotic species of the family CYPRINIDAE, originally from Asia, that has been introduced in North America. They are used in embryological studies and to study the effects of certain chemicals on development.
The process of moving proteins from one cellular compartment (including extracellular) to another by various sorting and transport mechanisms such as gated transport, protein translocation, and vesicular transport.
A light microscopic technique in which only a small spot is illuminated and observed at a time. An image is constructed through point-by-point scanning of the field in this manner. Light sources may be conventional or laser, and fluorescence or transmitted observations are possible.
A cell line derived from cultured tumor cells.
Interruption or suppression of the expression of a gene at transcriptional or translational levels.
Strains of mice in which certain GENES of their GENOMES have been disrupted, or "knocked-out". To produce knockouts, using RECOMBINANT DNA technology, the normal DNA sequence of the gene being studied is altered to prevent synthesis of a normal gene product. Cloned cells in which this DNA alteration is successful are then injected into mouse EMBRYOS to produce chimeric mice. The chimeric mice are then bred to yield a strain in which all the cells of the mouse contain the disrupted gene. Knockout mice are used as EXPERIMENTAL ANIMAL MODELS for diseases (DISEASE MODELS, ANIMAL) and to clarify the functions of the genes.
The process of germ cell development in the male from the primordial germ cells, through SPERMATOGONIA; SPERMATOCYTES; SPERMATIDS; to the mature haploid SPERMATOZOA.
Immunologic method used for detecting or quantifying immunoreactive substances. The substance is identified by first immobilizing it by blotting onto a membrane and then tagging it with labeled antibodies.
The pattern of GENE EXPRESSION at the level of genetic transcription in a specific organism or under specific circumstances in specific cells.
Orientation of intracellular structures especially with respect to the apical and basolateral domains of the plasma membrane. Polarized cells must direct proteins from the Golgi apparatus to the appropriate domain since tight junctions prevent proteins from diffusing between the two domains.
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
A set of genes descended by duplication and variation from some ancestral gene. Such genes may be clustered together on the same chromosome or dispersed on different chromosomes. Examples of multigene families include those that encode the hemoglobins, immunoglobulins, histocompatibility antigens, actins, tubulins, keratins, collagens, heat shock proteins, salivary glue proteins, chorion proteins, cuticle proteins, yolk proteins, and phaseolins, as well as histones, ribosomal RNA, and transfer RNA genes. The latter three are examples of reiterated genes, where hundreds of identical genes are present in a tandem array. (King & Stanfield, A Dictionary of Genetics, 4th ed)
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in neoplastic tissue.
Refers to animals in the period of time just after birth.
Progressive restriction of the developmental potential and increasing specialization of function that leads to the formation of specialized cells, tissues, and organs.
Methods used for detecting the amplified DNA products from the polymerase chain reaction as they accumulate instead of at the end of the reaction.
The relationships of groups of organisms as reflected by their genetic makeup.
A negative regulatory effect on physiological processes at the molecular, cellular, or systemic level. At the molecular level, the major regulatory sites include membrane receptors, genes (GENE EXPRESSION REGULATION), mRNAs (RNA, MESSENGER), and proteins.
Highly specialized EPITHELIAL CELLS that line the HEART; BLOOD VESSELS; and lymph vessels, forming the ENDOTHELIUM. They are polygonal in shape and joined together by TIGHT JUNCTIONS. The tight junctions allow for variable permeability to specific macromolecules that are transported across the endothelial layer.
The phenotypic manifestation of a gene or genes by the processes of GENETIC TRANSCRIPTION and GENETIC TRANSLATION.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Hybridization of a nucleic acid sample to a very large set of OLIGONUCLEOTIDE PROBES, which have been attached individually in columns and rows to a solid support, to determine a BASE SEQUENCE, or to detect variations in a gene sequence, GENE EXPRESSION, or for GENE MAPPING.
MAMMARY GLANDS in the non-human MAMMALS.
A nonparametric method of compiling LIFE TABLES or survival tables. It combines calculated probabilities of survival and estimates to allow for observations occurring beyond a measurement threshold, which are assumed to occur randomly. Time intervals are defined as ending each time an event occurs and are therefore unequal. (From Last, A Dictionary of Epidemiology, 1995)
Surface ligands, usually glycoproteins, that mediate cell-to-cell adhesion. Their functions include the assembly and interconnection of various vertebrate systems, as well as maintenance of tissue integration, wound healing, morphogenic movements, cellular migrations, and metastasis.
A positive regulatory effect on physiological processes at the molecular, cellular, or systemic level. At the molecular level, the major regulatory sites include membrane receptors, genes (GENE EXPRESSION REGULATION), mRNAs (RNA, MESSENGER), and proteins.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
Tumors or cancer of the human BREAST.
A set of statistical methods used to group variables or observations into strongly inter-related subgroups. In epidemiology, it may be used to analyze a closely grouped series of events or cases of disease or other health-related phenomenon with well-defined distribution patterns in relation to time or place or both.
Adherence of cells to surfaces or to other cells.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Small double-stranded, non-protein coding RNAs (21-31 nucleotides) involved in GENE SILENCING functions, especially RNA INTERFERENCE (RNAi). Endogenously, siRNAs are generated from dsRNAs (RNA, DOUBLE-STRANDED) by the same ribonuclease, Dicer, that generates miRNAs (MICRORNAS). The perfect match of the siRNAs' antisense strand to their target RNAs mediates RNAi by siRNA-guided RNA cleavage. siRNAs fall into different classes including trans-acting siRNA (tasiRNA), repeat-associated RNA (rasiRNA), small-scan RNA (scnRNA), and Piwi protein-interacting RNA (piRNA) and have different specific gene silencing functions.
A basic element found in nearly all organized tissues. It is a member of the alkaline earth family of metals with the atomic symbol Ca, atomic number 20, and atomic weight 40. Calcium is the most abundant mineral in the body and combines with phosphorus to form calcium phosphate in the bones and teeth. It is essential for the normal functioning of nerves and muscles and plays a role in blood coagulation (as factor IV) and in many enzymatic processes.
Tumors or cancer of the PANCREAS. Depending on the types of ISLET CELLS present in the tumors, various hormones can be secreted: GLUCAGON from PANCREATIC ALPHA CELLS; INSULIN from PANCREATIC BETA CELLS; and SOMATOSTATIN from the SOMATOSTATIN-SECRETING CELLS. Most are malignant except the insulin-producing tumors (INSULINOMA).
All of the processes involved in increasing CELL NUMBER including CELL DIVISION.
Laboratory tests used to evaluate how well the kidneys are working through examination of blood and urine.
Proteins prepared by recombinant DNA technology.

Phosphorylation of claudin-2 on serine 208 promotes membrane retention and reduces trafficking to lysosomes. (1/13)

 (+info)

Epithelial permeability alterations in an in vitro air-liquid interface model of allergic fungal rhinosinusitis. (2/13)

 (+info)

Myofibroblast keratinocyte growth factor reduces tight junctional integrity and increases claudin-2 levels in polarized Caco-2 cells. (3/13)

The colonic epithelium is composed of a polarized monolayer sheathed by a layer of pericryptal myofibroblasts (PCMFs). We mimicked these cellular compartments in vitro to assess the effects of paracrine-acting PCMF-derived factors on tight junction (TJ) integrity, as measured by transepithelial electrical resistance (TER). Coculture with 18Co PCMFs, or basolateral administration of 18Co conditioned medium, significantly reduced TER of polarized Caco-2 cells. Among candidate paracrine factors, only keratinocyte growth factor (KGF) reduced Caco-2 TER; basolateral KGF treatment led to time- and concentration-dependent increases in claudin-2 levels. We also demonstrate that amphiregulin (AREG), produced largely by Caco-2 cells, increased claudin-2 levels, leading to epidermal growth factor receptor-mediated TER reduction. We propose that colonic epithelial TJ integrity can be modulated by paracrine KGF and autocrine AREG through increased claudin-2 levels. KGF-regulated claudin-2 induction may have implications for inflammatory bowel disease, where both KGF and claudin-2 are upregulated.  (+info)

Effects of a high-sodium diet on renal tubule Ca2+ transporter and claudin expression in Wistar-Kyoto rats. (4/13)

 (+info)

STAT6 deficiency ameliorates severity of oxazolone colitis by decreasing expression of claudin-2 and Th2-inducing cytokines. (5/13)

 (+info)

The junctional proteins cingulin and paracingulin modulate the expression of tight junction protein genes through GATA-4. (6/13)

 (+info)

Epithelial barrier assembly requires coordinated activity of multiple domains of the tight junction protein ZO-1. (7/13)

 (+info)

Scanning ion conductance microscopy measurement of paracellular channel conductance in tight junctions. (8/13)

 (+info)

In previous studies we have shown that protein kinase inhibitors and extracellular calcium can affect dramatically the assembly of tight junctions (TJ) and the localization of the TJ protein cingulin at sites of cell-cell contact in renal epithelial (MDCK) cells. To characterize in more detail the relationships between kinase activity and junction organization, we have studied the effects of the protein kinase C agonist phorbol myristate acetate (PMA) on the intracellular localization of cingulin, E-cadherin, desmoplakin and actin microfilaments in confluent MDCK monolayers. To study cingulin phosphorylation, MDCK cells were metabolically labelled with [32P]orthophosphate and immunoprecipitates were prepared with anti-cingulin antiserum. We show here that cingulin is phosphorylated in vivo on serine, and its specific phosphorylation is not significantly changed by treatment of confluent MDCK monolayers with PMA, with the protein kinase inhibitor H-7, or with the calcium chelator EGTA. Metabolic ...
Park NX-Bio enables that with its innovative in-liquid imaging Scanning Ion Conductance Microscopy (SICM) and its highly acclaimed Atomic Force Microscopy (AFM) technology.
in Anticancer Research (2007), 27. The viability, cytolysis and apoptosis-mediated cellular death induced by giganteosides D and E (Gig-D and Gig-E) and hederacolchisides A and A1 (Hcol-A and Hcol- A1) were analysed in HL-60 cells ... [more ▼]. The viability, cytolysis and apoptosis-mediated cellular death induced by giganteosides D and E (Gig-D and Gig-E) and hederacolchisides A and A1 (Hcol-A and Hcol- A1) were analysed in HL-60 cells. Materials and Methods: the end-point metabolic (WST1) and lactate dehydrogenase (LDH) assays were used. Cell cycle analysis and apoptosis were measured by flow cytometry, DNA laddering and caspase 3 analyses. Results: the HL-60 cell line was more sensitive to Hcol-A1 and Gig-D (IC50 3-5 ÌM) than to Gig-E and Hcol-A (IC50 8-13 ÌM; WST1 assay). This was related to LDH release. The induction of apoptosis could be detected without caspase 3 activation after 24 h of treatment. DNA fragmentation could be detected only with Gig-D. With Hcol- A1 and Gig-D, an ...
Supplementary Materials Online Supplement supp_45_3_534__index. noticed an apoptosis-mediated and necrosis-mediated depletion ( 90%) from the receiver Compact disc103poperating-system DC subset, in support of a 50C60% depletion of receiver Compact disc11bpos DCs from lung parenchymal tissues on Times 3 and 5, whereas receiver lung and alveolar macrophages had been significantly less radiosensitive, showing an around 50% depletion by Times 14C21 after treatment. A repopulation of lung tissues with donor DC subsets acquired occurred by Times 10 and 28 for Compact disc11bpos DCs and Compact disc103poperating-system DCs, whereas lung and alveolar macrophages were repopulated by 6 and 10 weeks after treatment. Furthermore, chlamydia of mice with further accelerated the turnover of lung lung and DCs macrophage subsets. Our data illustrate the vulnerability of lung Compact disc103poperating-system Compact disc11bpos and DCs DCs to irradiation, and indicate an accelerated turnover of lung DC subsets ...
TY - JOUR. T1 - Micropipet-Based Navigation in a Microvascular Model for Imaging Endothelial Cell Topography Using Scanning Ion Conductance Microscopy. AU - Taira, Noriko. AU - Nashimoto, Yuji. AU - Ino, Kosuke. AU - Ida, Hiroki. AU - Imaizumi, Takuto. AU - Kumatani, Akichika. AU - Takahashi, Yasufumi. AU - Shiku, Hitoshi. N1 - Publisher Copyright: © PY - 2021. Y1 - 2021. N2 - Scanning ion conductance microscopy (SICM) has enabled cell surface topography at a high resolution with low invasiveness. However, SICM has not been applied to the observation of cell surfaces in hydrogels, which can serve as scaffolds for three-dimensional cell culture. In this study, we applied SICM for imaging a cell surface in a microvascular lumen reconstructed in a hydrogel. To achieve this goal, we developed a micropipet navigation technique using ionic current to detect the position of a microvascular lumen. Combining this navigation technique with SICM, endothelial cells in a microvascular model and blebs were ...
Scanning electrochemical microscopy (SECM) is a powerful technique for examining the diffusive, convective, and migratory transport of solutes. In SECM, an ultramicroelectrode (UME), attached to piezoelectric positioners, is mobile in three dimensions. The UME can be positioned close to an interface with submicron precision, and can probe the topography, reactivity, or permeability of that interface with high spatial resolution (Bard et al., 1991b; Barker et al., 1999). SECM has been applied to the study of a number of synthetic membranes and biomaterials including skin (Bath et al., 1998; Scott et al., 1991; 1993a, b; 1995), dentine (Macpherson et al., 1995a, b; Unwin et al., 1997), and bilayer lipid membranes (Matsue et al., 1994). SECM has the advantage over scanning ion conductance microscopy, which has found some application in the investigation of membrane transport (Hansma et al., 1989; Korchev et al., 1997), in that it can selectively detect both neutral and charged species, rather than ...
Scanning electrochemical microscopy (SECM) is a powerful technique for examining the diffusive, convective, and migratory transport of solutes. In SECM, an ultramicroelectrode (UME), attached to piezoelectric positioners, is mobile in three dimensions. The UME can be positioned close to an interface with submicron precision, and can probe the topography, reactivity, or permeability of that interface with high spatial resolution (Bard et al., 1991b; Barker et al., 1999). SECM has been applied to the study of a number of synthetic membranes and biomaterials including skin (Bath et al., 1998; Scott et al., 1991; 1993a, b; 1995), dentine (Macpherson et al., 1995a, b; Unwin et al., 1997), and bilayer lipid membranes (Matsue et al., 1994). SECM has the advantage over scanning ion conductance microscopy, which has found some application in the investigation of membrane transport (Hansma et al., 1989; Korchev et al., 1997), in that it can selectively detect both neutral and charged species, rather than ...
Application archive. Nov. 26, 2018Applications Scanning Ion Conductance Microscopy - Scanning Electrochemical Microscopy Since the inception of scanning tunneling microscopy (STM) [1],
Podcast: Play in new window , Download. Subscribe: Android , RSS. In this weeks episodes, I discuss the presentation and management of acute, chronic and allergic fungal rhinosinusitis.. ...
The avian basilar papilla is composed of hair and supporting cells arranged in a regular pattern in which the hair cells are surrounded and isolated from each other by supporting cell processes. This arrangement of cells, in which the apical borders of hair cells do not contact one another, may be generated by contact-mediated lateral inhibition. Little is known, however, about the way in which hair and supporting cells are organized during development. Whole mounts double-labeled with antibodies to the 275 kDa hair-cell antigen and the tight junction protein cingulin were therefore used to examine the development of cell patterns in the basilar papilla. Hair cells that contact each other at their apical borders are seen during early development, especially on embryonic days (E) 8 and 9, but are no longer observed after E12. Hair and supporting cell patterns were analyzed in three different areas of the papilla at E9 and E12. In two of these regions between E9 and E12, the ratio of supporting ...
Allergic fungal rhinosinusitis (AFRS) is a unique variety of chronic polypoid rhinosinusitis usually in atopic individuals, characterized by presence of eosinophilic mucin and fungal hyphae in paranasal sinuses without invasion into surrounding mucosa. It has emerged as an important disease involving a large population across the world with geographic variation in incidence and epidemiology. The disease is surrounded by controversies regarding its definition and etiopathogenesis. A working group on
Upon viral infection, the major defense mounted by the host innate immune system is activation of the IFN- and apoptosis-mediated antiviral pathway. In order to complete their life cycle, viruses that are obligatory intracellular parasites must modulate these host immune responses. We have previously shown that the γHV68 latency-associated M2 protein effectively downregulates STAT1 and STAT2, resulting in the inhibition of type I and II IFN-mediated transcriptional activation. Here, we demonstrate that M2 interacts with ATM, a DNA damage signal transducer, and the DDB1/COP9/cullin DNA damage effector complex. This interaction blocked DNA damage-sensing activity as well as DNA damage repair activity, thereby rendering cells resistant to DNA damage-induced apoptosis. These results indicate that γHV68 encodes M2, a latency-associated gene, to antagonize both IFN- and apoptosis-mediated host innate immunities and thus is important in establishing and maintaining viral latency in infected ...
Our data reveal that the H,K-ATPase ion pump is required for apoptosis-mediated head size and organ scaling throughout the animal. Morphallactic defects in Smed-H,K-ATPase(RNAi) regenerates were observed in: head and pharyngeal resizing; pharyngeal A/P placement; anterior neural, brain and intestinal tract remodeling; and the re-establishment of anterior identity in previously more posterior tissues. All these remodeling defects occurred without inhibiting new tissue proliferation associated with blastema growth (epimorphosis). Therefore, when H,K-ATPase is lost during regeneration, head is made from new tissues and stays small because remodeling failures prevent old tissues from contributing to it, whereas the pharynx stays large because apoptosis fails to sculpt it to the correct size. This suggests that morphallactic remodeling of pre-existing tissues is an independent pathway from epimorphic blastema growth, a distinction that was previously unclear (Agata et al., 2007).. The working ...
Food allergies, celiac disease, inflammatory bowel disease (IBD), diarrhea and other gastrointestinal diseases have something in common: all have been linked to epithelial barrier loss. The gut epithelial barrier-that critical lining of cells in the gut that must allow nutrients into the body while keeping food-borne microbes out-can be compromised during intestinal inflammation and cause disease. While many of the molecular mechanisms that trigger gastrointestinal diseases remain a mystery, previous research has found that one enzyme, known as myosin light chain kinase (MLCK), plays a critical role. However, MLCK is also essential for critical functions in gut epithelia and other cell types. This makes direct inhibition of MLCK impossible, as it would result in many toxic and systemic side effects. A team led by investigators from Brigham and Womens Hospital has now developed an alternative approach. In a study published in Nature Medicine, the researchers report new evidence suggesting that ...
Shop a large selection of Proteins A-Z products and learn more about Novus Biologicals Claudin-2 Recombinant Protein Antigen Quantity: 100µL:Life Quantity: 100µL.
Claudin-4 (Clostridium perfringens enterotoxin receptor) is a tight junction protein encoded by the gene CLDN4. Expression of Claudin-4 has been associated with either poor prognosis or a more favorable diagnosis, depending on the type of cancer. Claudin-4 has been shown to distinguish adenocarcinoma from malignant mesothelioma with 99% specificity in malignant effusions (1). Claudin-4 overexpression was able to independently predict survival in a breast cancer multivariate analysis as it was associated with poor prognosis, high tumor grade and Her2 expression and was inversely correlated with estrogen receptor staining (2). In luminal breast cancer, the increase of Claudin-4 protein was correlated with the increase of tumor grade and with Ki-67, and thus demonstrated an overall shorter life survival (3). Basal-like tumors also demonstrated overexpression of Claudin-4 (4). Counter to the above breast cancer subtypes, the presence of Claudin-4 in triple negative breast cancer was a biomarker that
The expression of claudin-11 in benign and malignant bladder tissue and the effect of forced expression of claudin-11 on tight junction function and invasiveness of bladder cancer cells were studied. Claudin-11 expression was tested in bladder cancer cell lines (T24/83, RT 112/84 and EJ138) using reverse transcription-polymerase chain reaction (RT-PCR) and in benign and malignant bladder tissue by quantitative RT-PCR and immunohistochemistry. T24/83 cells were transfected with the pcDNA.1/NT-GFP-TOPO vector containing full-length human claudin-11 sequence. Stable-transfected cells overexpressing claudin-11 (T24Cl-11Ex), wild-type cells (T24WT) and the empty plasmid control clone (T24GFP) were compared using transurothelial resistance (TUR), in vitro adhesion, invasion and growth assays. Claudin-11 was strongly expressed in the non-invasive RT112/84 cell line compared to the invasive T24/83 and EJ138 TCC cell lines. Benign bladder tissue demonstrated equal expression of claudin-11 mRNA as ...
Objective Helicobacter pylori strains that express the oncoprotein CagA augment risk for gastric cancer. However, the precise mechanisms through which cag+ strains heighten cancer risk have not been fully delineated and model systems that recapitulate the gastric niche are critical for understanding pathogenesis. Gastroids are three-dimensional organ-like structures that provide unique opportunities to study host-H. pylori interactions in a preclinical model. We used gastroids to inform and direct in vitro studies to define mechanisms through which H. pylori modulates expression of the cancer-associated tight junction protein claudin-7.. ...
Read Claudin-8 Expression in Renal Epithelial Cells Augments the Paracellular Barrier by Replacing Endogenous Claudin-2, The Journal of Membrane Biology on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
This work investigates the physicochemical properties and in vitro accuracy of a genetically engineered drug delivery system based on elastin-like block recombinamers. The DNA recombinant technics allowed us to create this smart complex polymer containing bioactive sequences for internalization, lysosome activation under acidic pH and blockage of cellular growth by a small peptide inhibitor. The recombinant polymer reversibly self-assembled, when temperature was increased above 15°C, into nanoparticles with a diameter of 72 nm and negative surface charge. Furthermore, smart nanoparticles were showed to enter in the cells via clathrin-dependent endocytosis, and properly blocked phosphorylation and consequent activation of Akt kinase. This system provoked apoptosis-mediated cell death in breast and colorectal cancer cells, which possess higher expression levels of Akt, whereas non-cancerous cells, such as endothelial cells, fibroblasts and mesenchymal stem cells, were not affected. Hence, we ...
Shop a large selection of products and learn more about Claudin-9 Rabbit anti-Human, Polyclonal, Novus Biologicals 100µL; 100µL; Unlabeled.
Claudin-3 is a major protein of tight junctions (TJs) in the intestinal epithelium and is critical for maintaining cell-cell adhesion, barrier function, and epithelium polarity. Recent studies have shown high claudin-3 levels in several solid tumors, but the regulation mechanism of claudin-3 expression remains poorly understood. In the present study, colorectal cancer (CRC) tissues, HT-29 and DLD-1 CRC cell lines, CRC murine model (C57BL/6 mice) and c-kit loss-of-function mutant mice were used. We demonstrated that elevated claudin-3 levels were positively correlated with highly expressed c-kit in CRC tissues based upon analysis of protein expression. In vitro, claudin-3 expression was clearly increased in CRC cells by overexpressed c-kit or stimulated by exogenous recombinant human stem cell factor (rhSCF), while significantly decreased by the treatment with c-kit or c-Jun N-terminal kinase (JNK) inhibitors. Chromatin immunoprecipitation (ChIP) and luciferase reporter assay showed that SCF/c-kit
DESCRIPTION (provided by applicant): Disruption of the cell-cell junction with concomitant changes in the expression of junctional proteins is a hallmark of cancer metastasis and invasion. Role of adherent junction proteins have been studied extensively in cancer, however the role of tight junction proteins is less understood. Claudins are the recently identified tetraspanins, which are integral to the structure and function of tight junctions (TJs). Recent studies have shown changes in expression/cellular localization for claudins during tumorigenesis, however a cause and effect relationship has not been established. Here, we report a highly increased expression for claudin-1 in human primary colon carcinoma and metastatic tissues and cell lines derived from similar sources with relatively frequent nuclear localization. Furthermore, using genetic manipulations of claudin-1 expression in colon cancer cell lines, we demonstrate a role for claudin-1 in the regulation of epithelial to mesenchymal ...
Claudin, P; Andreotti, B (2006). "A scaling law for aeolian dunes on Mars, Venus, Earth, and for subaqueous ripples". Earth and ... Retrieved October 2, 2013. Meslin, P.-Y.; Forni, O.; Schroder, S.; Cousin, A.; Berger, G.; Clegg, S. M.; Lasue, J.; Maurice, S ... 252 (1-2): 30-44. arXiv:cond-mat/0603656. Bibcode:2006E&PSL.252...30C. doi:10.1016/j.epsl.2006.09.004. S2CID 13910286. Sullivan ... while particles as large as 20 µm diameter can enter suspension from rest at surface wind turbulence as low as 2 ms−1 or remain ...
Claudin, Philippe; Andreotti, Bruno (2006). "A scaling law for aeolian dunes on Mars, Venus, Earth, and for subaqueous ripples ... 38 (2): 179-182. doi:10.1002/esp.3316. ISSN 0197-9337. Bourke, M.C.; Balme, M.; Beyer, R.A.; Williams, K.K.; Zimbelman, J. ( ... 252 (1-2): 30-44. arXiv:cond-mat/0603656. doi:10.1016/j.epsl.2006.09.004. ISSN 0012-821X. Williams, S. H.; Zimbelman, J. R.; ... 58 (2-3): 323-336. doi:10.7202/013146ar. ISSN 1492-143X. Silvestro, S.; Chojnacki, M.; Vaz, D. A.; Cardinale, M.; Yizhaq, H.; ...
February 2018). "claudin 5". Biology Open. 7 (2): bio030494. doi:10.1242/bio.030494. PMC 5861362. PMID 29437557. Abbott NJ, ... 259 (6 Pt 2): R1131-8. doi:10.1152/ajpregu.1990.259.6.R1131. PMID 2260724. Shaver SW, Pang JJ, Wainman DS, Wall KM, Gross PM ( ... 73 (2): 304-11. PMID 23823990. Gross PM, Weindl A (December 1987). "Peering through the windows of the brain". Journal of ...
ISBN 978-84-7222-878-8. Azcárate, Manuel; Fernando Claudin (1979). Marc Abeles; Charles-Albert Ryng (eds.). L'Europe de ... ISBN 2-7071-1102-3. Azcárate, Manuel (1980). Interrogantes ante la izquierda (in Spanish). Marc Abeles, Charles-Albert Ryng, ... ISBN 2-13-037918-4. ISSN 0398-7922. Azcárate, Manuel (1986). La izquierda europea (in Spanish). Madrid: Ediciones El País. ... ISBN 2-7157-1054-2. Azcárate, Manuel (1982). La crisis del eurocomunismo. Primera plana (in Spanish). Barcelona: Argos Vergara ...
Anatole Claudin (1898). The First Paris Press: an account of the books printed for G. Fichet and J. Heynlin in the Sorbonne, ... Claudin 1898. Lacôte-Gabrysiak 2010. Martine Poulain (2016). "France". Encyclopedia of Library and Information Science (4th ed ... ISBN 2-7654-0708-8. Lylette Lacôte-Gabrysiak (2010). "C'est un best-seller! Meilleures ventes de livres en France de 1984 à ... 1-2. Brill. ISBN 9789004156876. + Volumes 3-4 (2011): Books published in France before 1601 in Latin and Languages other than ...
Van Itallie CM, Mitic LL, Anderson JM (July 2012). "SUMOylation of claudin-2". Annals of the New York Academy of Sciences. 1258 ... 554 (1-2): 111-8. doi:10.1016/s0014-5793(03)01116-5. PMID 14596924. S2CID 23261716. Wong KA, Kim R, Christofk H, Gao J, Lawson ... 229 (1-2): 109-16. doi:10.1016/s0378-1119(99)00033-5. PMID 10095110. Betz A, Lampen N, Martinek S, Young MW, Darnell JE (August ... 14 (2): 121-41. doi:10.1101/gad.14.2.121 (inactive 20 January 2021). PMID 10652267.CS1 maint: DOI inactive as of January 2021 ( ...
Claudin-7 is a protein that in humans is encoded by the CLDN7 gene. It belongs to the group of claudins. Claudins, such as ... "Entrez Gene: CLDN7 claudin 7". CS1 maint: discouraged parameter (link) Human CLDN7 genome location and CLDN7 gene details page ... 2005). "Claudin-1 is a strong prognostic indicator in stage II colonic cancer: a tissue microarray study". Mod. Pathol. 18 (4 ... 2003). "Loss of the tight junction protein claudin-7 correlates with histological grade in both ductal carcinoma in situ and ...
"Entrez Gene: CLDN1 claudin 1". Coyne CB, Gambling TM, Boucher RC, Carson JL, Johnson LG (Nov 2003). "Role of claudin ... Claudin-1 is a protein that in humans is encoded by the CLDN1 gene. It belongs to the group of claudins. Tight junctions ... The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight ... Miyamori H, Takino T, Kobayashi Y, Tokai H, Itoh Y, Seiki M, Sato H (2001). "Claudin promotes activation of pro-matrix ...
Claudin-8 is a protein that in humans is encoded by the CLDN8 gene. It belongs to the group of claudins. GRCh38: Ensembl ... "Entrez Gene: CLDN8 claudin 8". CS1 maint: discouraged parameter (link) Human CLDN8 genome location and CLDN8 gene details page ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ... Morita K, Furuse M, Fujimoto K, Tsukita S (Mar 1999). "Claudin multigene family encoding four-transmembrane domain protein ...
Claudin-11 is a protein that in humans is encoded by the CLDN11 gene. It belongs to the group of claudins and was the first ... "Entrez Gene: CLDN11 claudin 11 (oligodendrocyte transmembrane protein)". Gow A, Southwood CM, Li JS, Pariali M, Riordan GP, ... The protein encoded by this gene belongs to the claudin family of tight junction associated proteins and is a major component ... Tiwari-Woodruff SK, Buznikov AG, Vu TQ, Micevych PE, Chen K, Kornblum HI, Bronstein JM (April 2001). "OSP/claudin-11 forms a ...
Claudin-12 is a protein that in humans is encoded by the CLDN12 gene. It belongs to the group of claudins. GRCh38: Ensembl ... "Entrez Gene: CLDN12 claudin 12". Human CLDN12 genome location and CLDN12 gene details page in the UCSC Genome Browser. Kniesel ... 2001). "claudin-18, a novel downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor, encodes lung- and ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Claudin-20 is a protein that in humans is encoded by the CLDN20 gene. It belongs to the group of claudins. GRCh38: Ensembl ... "Entrez Gene: CLDN20 claudin 20". CS1 maint: discouraged parameter (link) Human CLDN20 genome location and CLDN20 gene details ... Hewitt KJ, Agarwal R, Morin PJ (Aug 2006). "The claudin gene family: expression in normal and neoplastic tissues". BMC Cancer. ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Claudin-17 is a protein that in humans is encoded by the CLDN17 gene. It belongs to the group of claudins. It forms anion- ... "Entrez Gene: CLDN17 claudin 17". Krug SM, Günzel D, Conrad MP, Rosenthal R, Fromm A, Amasheh S, Schulzke JD, Fromm M (2012). " ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ... Heiskala M, Peterson PA, Yang Y (2001). "The roles of claudin superfamily proteins in paracellular transport". Traffic. 2 (2): ...
Claudin-14 is a protein that in humans is encoded by the CLDN14 gene. It belongs to a related family of proteins called ... "Entrez Gene: CLDN14 claudin 14". Baker M, Reynolds LE, Robinson SD, Lees DM, Parsons M, Elia G, et al. (2013). "Stromal ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ... Sticky cells, blood vessels and cancer - the paradox of Claudin-14 - Marianne Baker, Cancer Research UK Science Update blog, 14 ...
Claudin-5 is a protein that in humans is encoded by the CLDN5 gene. It belongs to the group of claudins. This gene encodes a ... "Entrez Gene: CLDN5 claudin 5 (transmembrane protein deleted in velocardiofacial syndrome)". Coyne CB, Gambling TM, Boucher RC, ... Kojima S, Rahner C, Peng S, Rizzolo LJ (2002). "Claudin 5 is transiently expressed during the development of the retinal ... Tsukita S, Furuse M (2002). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
2007). "Claudin-6 and claudin-9 function as additional coreceptors for hepatitis C virus". J. Virol. 81 (22): 12465-71. doi: ... Claudin-9 is a protein that in humans is encoded by the CLDN9 gene. It belongs to the group of claudins. This gene is involved ... "Entrez Gene: CLDN9 claudin 9". Gene discovery reveals a critical protein's function in hearing Human CLDN9 genome location and ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Claudin-22 is a protein that in humans is encoded by the CLDN22 gene. It belongs to the group of claudins. GRCh38: Ensembl ... "Entrez Gene: CLDN22 claudin 22". CS1 maint: discouraged parameter (link) Human CLDN22 genome location and CLDN22 gene details ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ... Heiskala M, Peterson PA, Yang Y (2001). "The roles of claudin superfamily proteins in paracellular transport". Traffic. 2 (2): ...
Claudin 3, also known as CLDN3, is a protein which in humans is encoded by the CLDN3 gene. It is a member of the claudin ... "Entrez Gene: CLDN3 claudin 3". Coyne CB, Gambling TM, Boucher RC, Carson JL, Johnson LG (Nov 2003). "Role of claudin ... "Expression of Clostridium perfringens enterotoxin receptors claudin-3 and claudin-4 in prostate cancer epithelium". Cancer Res ... The protein encoded by this intron-less gene, a member of the claudin family, is an integral membrane protein and a component ...
"Entrez Gene: CLDN18 claudin 18". CS1 maint: discouraged parameter (link) Niimi T, Nagashima K, Ward JM, et al. (2001). "claudin ... Claudin 18.2) is abundant in gastric tumors. Experimental antibody IMAB362 targets Claudin 18.2 to help treat gastric cancers. ... Claudin-18 is a protein that in humans is encoded by the CLDN18 gene. It belongs to the group of claudins. CLDN18 belongs to ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Claudin-19 is a protein that in humans is encoded by the CLDN19 gene. It belongs to the group of claudins. Claudin-19 has been ... "Entrez Gene: CLDN19 claudin 19". Naeem, M.; Hussain, S.; Akhtar, N. (2011). "Mutation in the Tight-Junction Gene Claudin 19 ( ... 2006). "Kidney claudin-19: localization in distal tubules and collecting ducts and dysregulation in polycystic renal disease". ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Claudin-15 is a protein that in humans is encoded by the CLDN15 gene. It belongs to the group of claudins. Among its related ... "Entrez Gene: CLDN15 claudin 15". Database, GeneCards Human Gene. "CLDN15 Gene - GeneCards , CLD15 Protein , CLD15 Antibody". ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ... Heiskala M, Peterson PA, Yang Y (2001). "The roles of claudin superfamily proteins in paracellular transport". Traffic. 2 (2): ...
Claudin-16 is a protein that in humans is encoded by the CLDN16 gene. It belongs to the group of claudins. Tight junctions ... The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight ... 2004). "A Novel Claudin 16 Mutation Associated with Childhood Hypercalciuria Abolishes Binding to ZO-1 and Results in Lysosomal ... "Entrez Gene: CLDN16 claudin 16". "Salmonella infection data for Cldn16". Wellcome Trust Sanger Institute. "Citrobacter ...
Claudin-2 is a protein that in humans is encoded by the CLDN2 gene. It belongs to the group of claudins. Members of the claudin ... "Entrez Gene: CLDN2 claudin 2". CS1 maint: discouraged parameter (link) Muto, S.; Hata, M.; Taniguchi, J.; Tsuruoka, S.; ... 1998). "Claudin-1 and -2: Novel Integral Membrane Proteins Localizing at Tight Junctions with No Sequence Similarity to ... Furthermore, claudin-2 has been shown to form paracellular channels for water. GRCh38: Ensembl release 89: ENSG00000165376 - ...
CLDND1: Claudin domain containing 1. *CPN2: Carboxypeptidase N subunit 2. *CPOX: coproporphyrinogen oxidase (coproporphyria, ... 978-1-136-84407-2. .. *^ a b c Genome Decoration Page, NCBI. Ideogram data for Homo sapience (850 bphs, Assembly GRCh38.p3). ... ZBED2: encoding protein Zinc finger BED-type containing 2. *ZNF9: zinc finger protein 9 (a cellular retroviral nucleic acid ... Tom Strachan; Andrew Read (2 April 2010). Human Molecular Genetics. Garland Science. p. 45. ISBN ...
"Systems Proteomics View of the Endogenous Human Claudin Protein Family". Journal of Proteome Research. 15 (2): 339-359. doi: ... 15 (2): 411-421. doi:10.1021/acs.jproteome.5b00589. ISSN 1535-3893. PMID 26718741. Fenyö, David; Beavis, Ronald C. (2015). " ... 15 (2): 677-678. doi:10.1021/acs.jproteome.5b01028. ISSN 1535-3893. PMID 26680273. Liu, Fei; Koval, Michael; Ranganathan, Shoba ...
Xu H, Liu Y, He G, Rossiter SJ, Zhang S (November 2013). "Adaptive evolution of tight junction protein claudin-14 in ... 530 (2): 208-14. doi:10.1016/j.gene.2013.08.034. PMID 23965379. {{cite journal , vauthors = Galatius A., Olsen M. T., Steeman M ... 1 (2): 136-140. doi:10.1080/14786447808676811. From p. 140: From these experiments the author concludes: … that the organ of ... 5 (2): 90-92. doi:10.1007/bf02153744. S2CID 500691. Hahn WL (1908). "Some habits and sensory adaptations of cave-inhabiting ...
Missing or empty ,title= (help) A. Claudin, The first Paris press; an account of the books printed for G. Fichet and J. Heynlin ... ISBN 3-88309-035-2. (in German) Information und Kommunikation in Geschichte und Gegenwart This article incorporates text from a ...
Claudin-10 is a protein that in humans is encoded by the CLDN10 gene. It belongs to the group of claudins. This gene encodes a ... "Entrez Gene: CLDN10 claudin 10". Human CLDN10 genome location and CLDN10 gene details page in the UCSC Genome Browser. Kniesel ... 2005). "Claudin-10 expression level is associated with recurrence of primary hepatocellular carcinoma". Clin. Cancer Res. 11 (2 ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Beeman N, Webb PG, Baumgartner HK (February 2012). "Occludin is required for apoptosis when claudin-claudin interactions are ... 3.0.CO;2-S. PMID 10497311. Kojima T, Sawada N, Chiba H, Kokai Y, Yamamoto M, Urban M, et al. (December 1999). "Induction of ... 123 (6 Pt 2): 1777-88. doi:10.1083/jcb.123.6.1777. PMC 2290891. PMID 8276896. Blasig IE, Bellmann C, Cording J, Del Vecchio G, ... 3 (2): e273. doi:10.1038/cddis.2012.14. PMC 3288343. PMID 22361748. Osanai M, Murata M, Nishikiori N, Chiba H, Kojima T, Sawada ...
Morita K, Sasaki H, Furuse M, Tsukita S (1999). "Endothelial Claudin: Claudin-5/Tmvcf Constitutes Tight Junction Strands in ... Claudin-6 is a protein that in humans is encoded by the CLDN6 gene. It belongs to the group of claudins. The knockout mice of ... "Entrez Gene: CLDN6 claudin 6". Human CLDN6 genome location and CLDN6 gene details page in the UCSC Genome Browser. Kniesel U, ... Tsukita S, Furuse M (2003). "Claudin-based barrier in simple and stratified cellular sheets". Curr. Opin. Cell Biol. 14 (5): ...
Famous composers of these "Parisian" chansons included Claudin de Sermisy and Clément Janequin. Janequin's La guerre, written ... 2-08-013617-8. .. *Hampton. Timothy. Literature and Nation in the Sixteenth Century: Inventing Renaissance France (2003) 289p. ... 2-08-013583-X. .. *. Chastel, André. French Art Vol III: The Ancient Régime. ISBN ... 0-300-05314-2. .. *. Chastel, André. French Art Vol II: The Renaissance. ISBN ...
Claudin 5 is transiently expressed during the development of the retinal pigment epithelium. J Membr Biol 186: 81-88, 2002 ... 2] IPM에 의하여 망막색소상피 전구체가 망막색소상피세포로 성숙된다.[3] 해부학적 위치[편집]. 망막색소상피세포는 육각형 모양의 세포들이 단일층을 구성하고 있다. [4] 이 세포들은 색소 과립 (pigmented ... 기형종(Teratoma, 테라토마) : 인체 내의 3배엽 중에서 한 가지 배엽 이상의 세포가 발견되는 암을 의미함.(출처 : [[2]]) 혹은, 3배엽(외배엽, 내배엽, 중배엽) 유래의 세포나 조직이 관찰되는 종양을 의미한다.[ ...
Sertoliho bunky tvoria pomocou tesných spojov (proteínmi ako je claudin alebo occludin) hemato-semenníkovú bariéru, ktorá ... Diabetes, 1997-2, roč. 46, čís. 2, s. 317-322. PMID: 9000711. Dostupné online [cit. 2018-08-22]. ISSN 0012-1797. ... 2 Imunomodulačné vlastnosti Sertoliho bunky *2.1 Molekuly produkované Sertoliho bunkami asociované s imunosupresiou alebo ...
Claudin 1, which is a tight-junction protein, and CD81 link to create a complex, priming them for later HCV infection processes ... Human polyomavirus 2 Progressive multifocal leukoencephalopathy. RNA virus. MeV Subacute sclerosing panencephalitis. LCV ... 46 (2): 251-9. doi:10.1134/S0026893312020033. PMID 22670521. S2CID 7379944.. *^ Bartenschlager R, Lohmann V (July 2000). " ... The hepatitis C virus (HCV)[2] is a small (55-65 nm in size), enveloped, positive-sense single-stranded RNA virus of the family ...
Clostridium perfringens enterotoxin binds to the second extracellular loop of claudin-3, a tight junction integral membrane ... vermutlich Claudin bei CPE,[14] sowie vermutlich GPI-Anker oder andere Glykosylierungen beim ε-Toxin. Durch die ... 2, April 2005, S. 247-56. doi:10.1016/j.cell.2005.02.033. PMID 15851031. ...
384 (2): 205-15. doi:10.1006/abbi.2000.2131. PMID 11368307.. *^ a b Maeda, Shoji; Nakagawa, So; Suga, Michihiro; Yamashita, ... 162 (2): 235-52. doi:10.1007/BF00209209. PMID 1237352.. *^ Orci L, Malaisse-Lagae F, Amherdt M, et al. (November 1975). "Cell ... 96 (2): 231-8. PMID 1698798.. *^ Johnson, R. G.; Reynhout, J. K.; Tenbroek, E. M.; Quade, B. J.; Yasumura, T.; Davidson, K. G. ... 82 (2): 219-23. doi:10.3181/00379727-82-20071. PMID 13037850.. *^ Friend DS, Gilula NB (June 1972). "Variations in tight and ...
Cates, M. E.; Wittmer, J. P.; Bouchaud, J.-P.; Claudin, P. (31 August 1998). "Jamming, Force Chains, and Fragile Matter". ... 2 (33): 6869-6892. doi:10.1088/0953-8984/2/33/001. ISSN 0953-8984. Cates, M. E. (1987). "Reptation of living polymers: dynamics ...
These complexes, formed primarily of members of the claudin and the occludin families, consist of about 35 different proteins, ... 154 (2): 274-84. doi:10.1016/j.cell.2013.07.004. PMID 23870119. van der Flier, Laurens G.; Clevers, Hans (1 January 2009). " ... 92 (1-2): 256-262. doi:10.1016/j.physbeh.2007.05.017. ISSN 0031-9384. PMID 17582445. Cario, E (2010). "Heads up! How the ... 39 (4 Suppl 2): S53-58. doi:10.1097/01.mcg.0000155521.81382.3a. ISSN 0192-0790. PMID 15758660. Näslund, Erik; Hellström, Per M ...
... is concentrated at tight junctions through its possible interaction with claudin-1 and junctional adhesion molecule". The ... 163 (2): 553-7. PMID 10395639. Naik UP, Ehrlich YH, Kornecki E (Aug 1995). "Mechanisms of platelet activation by a stimulatory ... In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in ... doi:10.1016/S0955-0674(03)00104-2. PMID 14519386. Naik UP, Eckfeld K (2004). "Junctional adhesion molecule 1 (JAM-1)". Journal ...
... has overexpressed HER2/neu Normal breast-like Claudin-low: a more recently described class; often triple-negative, but distinct ... 13 (1): 2-7. doi:10.2325/jbcs.13.2. PMID 16518056. Normanno N, De Luca A, Carotenuto P, Lamura L, Oliva I, D'Alessio A (2009 ... 2] Archived July 26, 2010, at the Wayback Machine Ravdin PM, Siminoff LA, Davis GJ, et al. (February 2001). "Computer program ... Well differentiated is given a grade of 1, moderate is grade 2, while poor or undifferentiated is given a higher grade of 3 or ...
Claudin 4, also known as CLDN4, is a protein which in humans is encoded by the CLDN4 gene. It belongs to the group of claudins ... "Entrez Gene: CLDN4 claudin 4". Human CLDN4 genome location and CLDN4 gene details page in the UCSC Genome Browser. Kniesel U, ... This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight ... 2003). "Claudin-4 expression decreases invasiveness and metastatic potential of pancreatic cancer". Cancer Res. 63 (19): 6265- ...
Claudin E is a molecule found in tight junctions that appears to be expressed in the EVL and required for normal zebrafish ... "The tight junction component claudin E is required for zebra fish epiboly". Developmental Dynamics. 239 (2): 715-722. doi: ... 83 (1-2): 77-94. doi:10.1016/S0925-4773(99)00036-2. PMID 10381569. Conway G, Margoliath A, Wong-Madden S, Roberts RJ, Gilbert W ... 346 (2): 272-83. doi:10.1016/j.ydbio.2010.07.037. PMC 2956273. PMID 20692251. Fang Lin; Songhai Chen; Diane S. Sepich; Jennifer ...
Markov AG, Falchuk EL, Kruglova NM, Radloff J, Amasheh S (January 2016). "Claudin expression in follicle-associated epithelium ... 66 (2): 189-203. doi:10.1016/s0016-5085(74)80102-2. PMID 4810912. Onori P, Franchitto A, Sferra R, Vetuschi A, Gaudio E (May ... "Skin graft rejection by beta 2-microglobulin-deficient mice". The Journal of Experimental Medicine. 175 (4): 885-93. doi: ...
The name claudin comes from Latin word claudere ("to close"), suggesting the barrier role of these proteins. A recent review ... All human claudins (with the exception of Claudin 12) have domains that let them bind to PDZ domains of scaffold proteins. ... "Claudin-1 and -2: novel integral membrane proteins localizing at tight junctions with no sequence similarity to occludin". J. ... "A systems proteomics view of the endogenous human claudin protein family". J Proteome Res. 15 (2): 339-359. doi:10.1021/acs. ...
Claudin de Sermisy, Thomas Crecquillon, Domenico Ferrabosco, Jean de Latre, Jacquet de Berchem, Jakob Meiland, Alexander ... Retrieved 2 June 2016. Leszczyńska, Agnieszka. "The Beginnings of Musical Italianità in Gdańsk and Elbląg of the Renaissance ... Retrieved 2 June 2016. Podejko, Paweł; Przybyszewska-Jarminska, Barbara. "Gdańsk". The New Grove Dictionary of Music and ... Jahrhunderts, published by Harmonia Mundi in 1987, re-released as AME 3003-2 by Freiburger Musi Forum/Ars Musici in 1992; ...
Claudin de Sermisy, French composer (b. 1495) October 18 - Anne d'Alençon, French noblewoman (b. 1492) November 7 - Maldeo ... ISBN 978-0-19-821744-2. "Gorboduc, or the Tragedy of Ferrex and Porrox". Archived from the original on September 17, 2007. ... ISBN 0-7126-5616-2. Evers, Vernd (2003). Architectural Theory: from the Renaissance to the present. Taschen. p. 845. ISBN 978-3 ...
Nevertheless, another sources document existence of mTEC unipotent progenitors that express claudin 3 and 4 (Cld3/4). These two ... "Medullary thymic epithelial cells expressing Aire represent a unique lineage derived from cells expressing claudin". Nature ... 2 (11): 1032-9. doi:10.1038/ni723. PMID 11600886. Anderson MS, Venanzi ES, Klein L, Chen Z, Berzins SP, Turley SJ, von Boehmer ... 23 (2): 227-39. doi:10.1016/j.immuni.2005.07.005. PMID 16111640. Taniguchi RT, DeVoss JJ, Moon JJ, Sidney J, Sette A, Jenkins ...
"Claudin-1 overexpression effect on lung adenocarcinoma cell line". NCBI GEO Profiles. Retrieved 4 May 2015. Vandepoele K, Van ... 44 (2): 325-40. doi:10.1016/j.molcel.2011.08.025. PMC 3200427. PMID 21906983. Vandepoele K, Staes K, Andries V, van Roy F ( ... 11 (2): 82-8. doi:10.1016/s0962-8924(00)01898-5. PMID 11166216. Ille F, Sommer L (May 2005). "Wnt signaling: multiple functions ... 8 (2): 99-103. doi:10.3346/jkms.1993.8.2.99. PMC 3053866. PMID 8397936. "GDS424 / 59465_r_at / NBPF1, Normal human tissue ...
Claudin de Sermisy set the psalm. In the 17th century, Henry Dumont set this psalm for La Chapelle Royale au Louvre (1666). In ... Verses 2, 10, and 13 are recited during Selichot. Verses 10, 13, and 14 are part of the Tachanun prayer. Verse 14 is also ...
... is concentrated at tight junctions through its possible interaction with claudin-1 and junctional adhesion molecule". J. Biol. ... 3.0.CO;2-G. PMC 3501957. PMID 10967549. Lee SS, Glaunsinger B, Mantovani F, Banks L, Javier RT (2000). "Multi-PDZ Domain ... 424 (1-2): 63-8. doi:10.1016/s0014-5793(98)00141-0. PMID 9537516. S2CID 25328791. Mancini A, Koch A, Stefan M, Niemann H, ... 424 (1-2): 63-8. doi:10.1016/S0014-5793(98)00141-0. PMID 9537516. S2CID 25328791. Barritt DS, Pearn MT, Zisch AH, Lee SS, ...
Paris : A. Claudin, 1865 Google books. ...
Plus CAPOX Compared With Placebo Plus CAPOX as First-line Treatment of Subjects With Claudin (CLDN) 18.2-Positive, HER2- ... Retrieved May 2, 2021. Hatice Akyün (April 26, 2020). ""Wir sind Impfstoff": Über zwei Wissenschaftler, die nicht nur Hoffnung ... Archived from the original on December 2, 2020. Retrieved January 30, 2021. Anne Seibring (December 11, 2020). "Editorial". ... Rossmann, Ernst Dieter; Samsami, Behrang (December 2, 2020). "Gemeinsam denken" [Thinking together]. Der Freitag. ...
IPR006187 Claudin. IPR005411 Claudin2. IPR017974 Claudin_CS. IPR004031 PMP22/EMP/MP20/Claudin. ... IPR006187 Claudin. IPR005411 Claudin2. IPR017974 Claudin_CS. IPR004031 PMP22/EMP/MP20/Claudin. ... Belongs to the claudin family.Curated. Keywords - Domaini. Transmembrane, Transmembrane helix. Phylogenomic databases. ... "Claudin-1 and -2: novel integral membrane proteins localizing at tight junctions with no sequence similarity to occludin.". ...
However, confocal microscopy revealed a marked subjunctional localization of claudin-1 in C11 cells, indicating that claudin-1 ... Genuine expression of claudin-1 and claudin-2, but not of occludin or claudin-3, was reciprocal to transepithelial resistance. ... Claudin-2 expression induces cation-selective channels in tight junctions of epithelial cells.. Amasheh S1, Meiri N, Gitter AH ... Overexpression of claudin-2 in the originally tight epithelium with claudin-2 cDNA resulted in a 5.6-fold higher paracellular ...
Claudin-1 and claudin-2 differentiate fetal and embryonal components in human hepatoblastoma. Halász, J., Holczbauer, A., Páska ... Membrane-bound claudin 3 and 4 expression was seen in all cases of Pagets disease, whereas claudin 5 was seen in 50% of cases ... IL-17 induced formation of tight junctions correlated with up-regulation of claudin-1 and claudin-2 gene transcription [6]. ... Claudin-1 and claudin-2 differentiate fetal and embryonal components in human hepatoblastoma [1]. ...
Shop a large selection of Proteins A-Z products and learn more about Novus Biologicals Claudin-2 Recombinant Protein Antigen ... A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Claudin-2. Source: E.coli Amino Acid ... The Claudin-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition. ... RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV The Claudin-2 Recombinant Protein Antigen is derived from E. coli. ...
Shop a large selection of products and learn more about Claudin 2 Rabbit anti-Canine, Human, Rat, Polyclonal, Invitrogen 100 ... Claudin-1 and claudin-2 connect to the actin cytoskeleton through ZO-1; Claudin-2 functions as a paracellular channel with ... claudin-1 and claudin-2, with no similarity to occludin. In contrast to occludin, which induces only a small number of short ... The expression of claudin-2 is restricted to the liver and kidney, with small amounts also found in the brain. This product(s) ...
A claudin subtype that is associated with the formation of cation-selective channels and increased epithelial permeability. It ... Claudin-1 and claudin-2 expression is elevated in inflammatory bowel disease and may contribute to early neoplastic ... Claudin-2. Known as: Claudin 2, Claudin-2 [Chemical/Ingredient] A claudin subtype that is associated with the formation of ... Tight junction proteins claudin-2 and -12 are critical for vitamin D-dependent Ca2+ absorption between enterocytes. ...
Tight junction protein claudin-2 promotes self-renewal of human colorectal cancer stem-like cells. Sophie Paquet-Fifield, Shir ... Claudin-2 enhanced self-renewal of ALDHHigh CSC and increased their proportion in CRC cell populations, limiting their ... While several of these biological processes are features of the CSC phenotype, a role for claudin-2 in the regulation of these ... Among these, miR-222-3p was instrumental for the regulation of self-renewal by claudin-2, and enhancement of this self-renewal ...
claudin-2. Fwd. forward. GEO. Gene Expression Omnibus. GF. germ free. GPCR. G-protein coupled receptor. GPR109a. G-protein ... Claudin-2 as a mediator of leaky gut barrier during intestinal inflammation. Tissue Barriers 3: e977176. ... Claudin switching: physiological plasticity of the tight junction. Semin. Cell Dev. Biol. 42: 22-29. ... HIF-dependent regulation of claudin-1 is central to intestinal epithelial tight junction integrity. Mol. Biol. Cell 26: 2252- ...
Claudin 2 antibody LS-C254955 is a biotin-conjugated rabbit polyclonal antibody to human Claudin 2 (CLDN2). Validated for ELISA ... Claudin 2 antibody LS-C254955 is a biotin-conjugated rabbit polyclonal antibody to human Claudin 2 (CLDN2). Validated for ELISA ...
Claudin-10b-expressing cells showed no increase in water flux (n=7-11). (B) Western blot analysis of claudin-2 expression in C7 ... Claudin and AQP expression in MDCK cells. (A) Western blot analysis of the expression of claudin-2, claudin-10b and endogenous ... By contrast, claudin-10b transfection did not alter water flux. We conclude that claudin-2, but not claudin-10b, forms a ... Clone 6 exhibited strong claudin-2 signals and markedly reduced Rt values of 262±12 Ω·cm2 (n=6), compared to 1996±302 Ω·cm2 (n= ...
Changes in expression and distribution of claudin 2, 5 and 8 lead to discontinuous tight junctions and barrier dysfunction in ... Changes in expression and distribution of claudin 2, 5 and 8 lead to discontinuous tight junctions and barrier dysfunction in ... Changes in expression and distribution of claudin 2, 5 and 8 lead to discontinuous tight junctions and barrier dysfunction in ...
"Claudin-8 Expression in Renal Epithelial Cells Augments the Paracellular Barrier by Replacing Endogenous Claudin-2, The Journal ... Claudin-8 Expression in Renal Epithelial Cells Augments the Paracellular Barrier by Replacing Endogenous Claudin-2. Angelow, ... Claudin-8 also affects the trafficking of claudin-2, which was displaced specifically from the junctions at which claudin-8 was ... Claudin-8 Expression in Renal Epithelial Cells Augments the Paracellular Barrier by Replacing Endogenous Claudin-2. Claudin-8 ...
Occludin and the sealing tight junction proteins claudin 5 and claudin 8 were downregulated and redistributed off the tight ... Changes in expression and distribution of claudin 2, 5 and 8 lead to discontinuous tight junctions and barrier dysfunction in ... Changes in expression and distribution of claudin 2, 5 and 8 lead to discontinuous tight junctions and barrier dysfunction in ... Conclusion: Upregulation of pore-forming claudin 2 and downregulation and redistribution of sealing claudins 5 and 8 lead to ...
Effects of claudin-2, occludin or ZO-1 siRNA transfection on transepithelial electrical resistance (TER) in HK-2 cell ... claudin -2 expressiontubule epithelial cell line HK -2.claudin -2ZORNAHK -2 cellscontrol HK -2 monolayersTJ protein expression ... claudin -2 expressiontubule epithelial cell line HK -2.claudin -2ZORNAHK -2 cellscontrol HK -2 monolayersTJ protein expression ... Effects of claudin-2, occludin or ZO-1 siRNA transfection on transepithelial electrical resistance (TER) in HK-2 cell ...
show that the epithelial-mesenchymal-transition transcription factor Snail induces claudin-11 expression and suppresses RhoA ... Supplementary Figure 5 Tyrosine-phosphorylated claudin-11 recruits and activates Src.. (a) Amino acid sequence of claudin-11 ( ... Shang, X., Lin, X., Alvarez, E., Manorek, G. & Howell, S. B. Tight junction proteins claudin-3 and claudin-4 control tumor ... Supplementary Figure 7: Expression of Snail or claudin-11 correlates with an advanced HNSCC and a worse prognosis.. ...
Kinetics of Adhesion Mediated by Extracellular Loops of Claudin-2 as Revealed by Single-Molecule Force Spectroscopy. ... Kinetics of Adhesion Mediated by Extracellular Loops of Claudin-2 as Revealed by Single-Molecule Force Spectroscopy. Journal of ...
Title: Claudin-6 enhances cell invasiveness through claudin-1 in AGS human adenocarcinoma gastric cancer cells. ... CLDN6 claudin 6 [Homo sapiens] CLDN6 claudin 6 [Homo sapiens]. Gene ID:9074 ... claudin 6provided by HGNC. Primary source. HGNC:HGNC:2048 See related. Ensembl:ENSG00000184697 MIM:615798 Gene type. protein ... Claudin 6 expression is useful to distinguish myxofibrosarcomas from other myxoid soft tissue tumors. Bekki H, et al. Pathol ...
The name claudin comes from Latin word claudere ("to close"), suggesting the barrier role of these proteins. A recent review ... All human claudins (with the exception of Claudin 12) have domains that let them bind to PDZ domains of scaffold proteins. ... "Claudin-1 and -2: novel integral membrane proteins localizing at tight junctions with no sequence similarity to occludin". J. ... "A systems proteomics view of the endogenous human claudin protein family". J Proteome Res. 15 (2): 339-359. doi:10.1021/acs. ...
The claudin gene family: expression in normal and neoplastic tissues. BMC Cancer. 2006;6:186.PubMedCentralPubMedCrossRefGoogle ... Claudin-18 gene structure, regulation, and expression is evolutionary conserved in mammals. Gene. 2011;481:83-92.PubMedCrossRef ... Claudin-18 is an early-stage marker of pancreatic carcinogenesis. J Histochem Cytochem. 2011;59:942-952.PubMedCentralPubMed ... miR-1303 Claudin-18 Stomach neoplasms Proliferation Invasion This is a preview of subscription content, log in to check access. ...
4A). Claudin-5 is anchored to the actin cytoskeleton via ZO-1, and this structure is crucial for stable claudin-5 expression in ... Ripasudil inhibits claudin-5 and ZO-1 redistribution and restores the binding ratio between claudin-5 and ZO-1 decreased by ... For the single staining of claudin-5 or the double staining of claudin-5 and ZO-1, cultured cells were fixed with 100% methanol ... 7E). VEGF, TNFα, and IL-6 further decreased claudin-5 mRNA expression in ROCK2 KO cells, although claudin-5 protein expression ...
IPR006187 Claudin. IPR003550 Claudin4. IPR017974 Claudin_CS. IPR004031 PMP22/EMP/MP20/Claudin. ... IPR006187 Claudin. IPR003550 Claudin4. IPR017974 Claudin_CS. IPR004031 PMP22/EMP/MP20/Claudin. ... Belongs to the claudin family.UniRule annotation. Automatic assertion according to rulesi ... tr,F6YR27,F6YR27_MACMU Claudin OS=Macaca mulatta OX=9544 GN=CLDN4 PE=2 SV=1 ...
... the presence of claudin 1 in the Golgi cisterns may indicate the presence of tight junction precursors before transportation to ... the presence of claudin 1 in the Golgi cisterns may indicate the presence of tight junction precursors before transportation to ... and RAs stained positive with anti-claudin 1 antibodies. Since it has been shown that ameloblasts repeatedly alternate between ... and RAs stained positive with anti-claudin 1 antibodies. Since it has been shown that ameloblasts repeatedly alternate between ...
Analysis of claudin expression in human colonic samples. *2.. Generation and analysis of IL-9-citrine reporter mice. *3.. IL33 ... YouYi Hwang2. *, Alexej Nikolaev3. *, Raja Atreya1. *, Heike Dornhoff1. *, Stefanie Steiner1. *, Hans-Anton Lehr4. *, Stefan ... Andrew N J McKenzie2. *, Benno Weigmann1. n7* & Markus F Neurath1. n7 Nature Immunology volume 15, pages 676-686 (2014) , ... 2.. Strober, W., Fuss, I. & Mannon, P. The fundamental basis of inflammatory bowel disease. . J. Clin. Invest. 117, 514-521 ( ...
... and impaired claudin-1 barrier via repression of HIF-1α/claudin-1 signaling, which was restored by transgenic expression of ... claudin-1). Prolonged experimental hypoxia or HIF1A knockdown suppressed HIF-1α-dependent claudin-1 expression and epithelial ... Collectively, these studies reveal HIF-1αs critical role in maintaining barrier and highlight the HIF-1α/claudin-1 axis as a ... EoE patient biopsy analysis identified a repressed HIF-1α/claudin-1 axis, which was restored via pharmacologic HIF-1α ...
Claudin-18-mediated YAP activity regulates lung stem and progenitor cell homeostasis and tumorigenesis. ... Claudin-18-mediated YAP activity regulates lung stem and progenitor cell homeostasis and tumorigenesis. ... Here, we demonstrated that knockout of Cldn18, a claudin family member highly expressed in lung alveolar epithelium, leads to ... 2. Scale bars: 5 μm. (. H. ) IP with anti-p-LATS1/2 Ab shows decreased p-LATS1/2 and decreased association of p-LATS1/2 with p- ...
Claudin-5 Redistribution Induced by Inflammation Leads to Anti-VEGF Resistant Diabetic Macular Edema ... Claudin-5 Redistribution Induced by Inflammation Leads to Anti-VEGF Resistant Diabetic Macular Edema ... Claudin-5 Redistribution Induced by Inflammation Leads to Anti-VEGF Resistant Diabetic Macular Edema ... Claudin-5 Redistribution Induced by Inflammation Leads to Anti-VEGF Resistant Diabetic Macular Edema ...
... of the biologic heterogeneity of breast cancer and provide tools for the further evaluation of the unique biology of claudin- ... Phenotypic and molecular characterization of the claudin-low intrinsic subtype of breast cancer Breast Cancer Res. 2010;12(5): ... Results: Claudin-low tumors are characterized by the low to absent expression of luminal differentiation markers, high ... These main features of claudin-low tumors were also evaluated in a panel of breast cancer cell lines and genetically engineered ...
Claudin de Sermisy (c. 1490 - 13 October 1562) was a French composer of the Renaissance. Along with Clément Janequin he was one ... ISBN 0-393-09530-4 Free scores by Claudin de Sermisy at the International Music Score Library Project (IMSLP) Tant que vivray ... ISBN 0-89917-034-X Isabelle Cazeaux, "Claudin de Sermisy", The New Grove Dictionary of Music and Musicians, ed. Stanley Sadie. ... 1527) Tu disais que jen mourrais Vignon, vignon, vignon, vignette Vive la serpe Aspice, Domine Isabelle Cazeaux, "Claudin d ...
... while Cav-1 was responsible for claudin-5 redistribution. The interaction between Cav-1 and claudin-5 was further confirmed by ... Specific role of tight junction proteins claudin-5, occludin, and ZO-1 of the blood-brain barrier in a focal cerebral ischemic ... Moreover, occludin protein loss and claudin-5 redistribution were detected in ischemic cerebromicrovessels. These data indicate ... This same OGD treatment also led to rapid degradation of tight junction protein occludin and dissociation of claudin-5 from the ...
Tight junction protein claudin-3 and claudin-4 control tumor growth and metastases. Neoplasia. 2012;14:974-85 ... Mitchell LA, Overggard CE, Ward C, Margulies SS, Koyal M. Differential effects of claudin-3 and claudin-4 on alveolar ... Claudin-1 Protein Expression Is a Good Prognositic Factor in Non-Small Cell Lung Cancer, but only in Squamous Cell Carcinoma ... Role of claudin interactions in airway tight junctional permeability. Am J Physiol Lung Cell Mol Physiol. 2003;285:L1166-78 ...
  • This antibody is specific for the ~ 22 kDa Claudin-2 protein and does not appear to cross-react with related endogenous proteins. (fishersci.com)
  • Several peripheral membrane proteins are associated with tight junctions including ZO-1, ZO-2, ZO-3 (members of membrane-associated guanylate-kinase family), cingulin, the 7H6 antigen, Rab-3b, symplekin. (fishersci.com)
  • Fortunately, a closer examination of isolated tight junctions uncovered two related ~22 kDa, four-transmembrane domain proteins, claudin-1 and claudin-2, with no similarity to occludin. (fishersci.com)
  • Excitement in the tight junction field continues to rise following the recent discovery of claudins -3, -4, -5, -6, -7, and -8 and experiments suggesting that tight junctions in different tissues are comprised of different sets of claudin family proteins. (fishersci.com)
  • Tight junction proteins claudin-2 and -12 are critical for vitamin D-dependent Ca2+ absorption between enterocytes. (semanticscholar.org)
  • To this end, MDCK C7 cells were stably transfected with either claudin-2 or claudin-10b, two paracellular cation-channel-forming TJ proteins that are not endogenously expressed in this cell line. (biologists.org)
  • Perturbation was overexpression of either claudin-2 or claudin-10b, as both form cation channels within the TJ of MDCK C7 cells, a tight renal epithelial cell line that lacks endogenous expression of these TJ proteins. (biologists.org)
  • Occludin and the sealing tight junction proteins claudin 5 and claudin 8 were downregulated and redistributed off the tight junction, whereas the pore-forming tight junctions protein claudin 2 was strongly upregulated, which constitute the molecular basis of tight junction changes. (bmj.com)
  • All human claudins (with the exception of Claudin 12) have domains that let them bind to PDZ domains of scaffold proteins. (wikipedia.org)
  • The name claudin comes from Latin word claudere ("to close"), suggesting the barrier role of these proteins. (wikipedia.org)
  • A recent review discusses evidence regarding the structure and function of claudin family proteins using a systems approach to understand evidence generated by proteomics techniques. (wikipedia.org)
  • Matrix metalloproteinase-2 and -9 secreted by leukemic cells increase the permeability of blood-brain barrier by disrupting tight junction proteins. (qxmd.com)
  • Specific role of tight junction proteins claudin-5, occludin, and ZO-1 of the blood-brain barrier in a focal cerebral ischemic insult. (qxmd.com)
  • Cell lysates from Huh7.5.1 cells were incubated with purified GST-claudin-1 tail or GST, and proteins were pulled down with glutathione-Sepharose beads. (asm.org)
  • Candidate claudin-1 tail-interacting proteins were the GST-claudin-1-tail interactome. (asm.org)
  • The aberrant expression of the claudin proteins has been related to various human carcinomas. (biomedcentral.com)
  • Some studies have reported that down-regulation of the claudin, occludin and other TJ proteins has been considered one of the important reasons for the loss of cell adhesion, cell polarity, invasion and metastasis of malignant tumors [ 3 ], up-regulation of some TJ proteins has also been associated with the malignant phenotype. (biomedcentral.com)
  • Cardiotonic steroid ouabain stimulates expression of blood-testis barrier proteins claudin-1 and -11 and formation of tight junctions in Sertoli cells. (ptglab.com)
  • Claudin-4 belongs to the 20-member family of claudins, transmembrane cellular adhesion proteins localized at epithelial and endothelial tight junctions. (thermofisher.com)
  • Recent work points toward the claudin family of tight junction proteins as leading candidates for the molecular components that regulate paracellular permeability properties in epithelial tissues. (uab.edu)
  • Our results show that claudin-6 protein is significantly down-regulated in breast invasive ductal carcinomas and is an important correlate with lymphatic metastasis, but claudin-6 down-regulation was not correlated with upregulation of the methylation associated proteins (MeCP2, DNMT1) or histone modification associated proteins (HDAC1, H3Ac, H4Ac). (biomedcentral.com)
  • Other tight junction proteins, zonula occludens (ZO)-1, ZO-2, claudin-2, and claudin-3, were also decreased in polyamine-deficient cells. (physiology.org)
  • Major transmembrane and cytosolic tight junction proteins in the mammalian epithelium include occludin, claudins, zonula occludens (ZO)-1, and ZO-2 ( 8 , 12 , 41 , 54 , 66 ). (physiology.org)
  • We found that one of the proteins residing in the tight junctions, claudin-2, is lost in a chronic kidney disease mouse model. (kidney.ca)
  • Claudin proteins. (thermofisher.com)
  • Proteins such as ZO-1, ZO-2, ZO-3, MUPP-1, and PATJ colocalize with claudin proteins and together form tight junctions (Figure 2) . (thermofisher.com)
  • Classification of breast cancer (BC) has been historically based on both analysis of tumor morphology and histological detection of three marker proteins: the estrogen receptor (ER), the progesterone receptor (PR), and the human epidermal growth factor (EGF) receptor tyrosine kinase 2 (ErbB2 or HER2). (frontiersin.org)
  • The paracellular barrier of epithelia and endothelia is established by several tight junction proteins including claudin-3. (nih.gov)
  • Recent investigations have focused on tight junction proteins, belonging to the claudin family (claudins-1 to -27 in humans) and the newly defined group of TAMP (three proteins: occludin, Marvel-D2, and tricellulin). (wiley.com)
  • Most of the claudins (claudin-12 being the exception) have a C-terminal PDZ-binding motif that can interact with other PDZ domain proteins, such as scaffolding protein, ZO-1, -2 and -3 [ PMID: 24665401 ]. (ebi.ac.uk)
  • Tight junctions are composed of claudin and occludin proteins, which join the junctions to the cytoskeleton (1,2). (cellsignal.com)
  • The claudin family is composed of 23 integral membrane proteins, and their expression, which varies among tissue types, may determine both the strength and properties of the epithelial barrier. (cellsignal.com)
  • 1 , 2 Mutations in dozens of genes encoding proteins with highly diverse functions expressed in photoreceptor cells, retinal pigment epithelium (RPE), or choriocapillaris have been identified that are responsible for RP, with many more remaining to be discovered (reviewed in Ref. 1). (arvojournals.org)
  • Several classes of claudin interact with other proteins to form tight junction and regulate permeability of TJs. (biomedcentral.com)
  • It is also observed that the expression of claudin proteins found to be differentially regulated in several cancers. (biomedcentral.com)
  • As the essential component of TJ, claudin family of transmembrane proteins plays a critical role in both architecture and flux control of TJ. (syr.edu)
  • Understanding self-assembly of claudin family proteins provides clues to better interpret TJ-related diseases and to find cure for them. (syr.edu)
  • In order to characterize the contribution of claudin-2 to barrier and permeability properties of the tight junction in detail, we studied two strains of Madin-Darby canine kidney cells (MDCK-C7 and MDCK-C11) with different tight junctional permeabilities. (nih.gov)
  • A claudin subtype that is associated with the formation of cation-selective channels and increased epithelial permeability. (semanticscholar.org)
  • Loss and gain of IL-10RA expression directly correlates with IEC barrier formation and butyrate represses permeability-promoting claudin-2 tight-junction protein expression through an IL-10RA-dependent mechanism. (jimmunol.org)
  • Under all conditions, water flux in claudin-2-transfected cells was elevated compared with vector controls, indicating claudin-2-mediated paracellular water permeability. (biologists.org)
  • We previously reported that claudin-8 reduces paracellular cation permeability when expressed in low-resistance Madin-Darby canine kidney (MDCK) II cells. (deepdyve.com)
  • Unlike in MDCK II cells, induction of claudin-8 in MDCK I cells (which did not affect levels of endogenous claudins) did not alter paracellular ion permeability. (deepdyve.com)
  • Furthermore, when endogenous claudin-2 in MDCK II cells was downregulated by epidermal growth factor to create a cell model with low transepithelial resistance and low levels of claudin-2, the permeability effects of claudin-8 were also abolished. (deepdyve.com)
  • Exposure of bEND3 monolayer to OGD for 2 h significantly increased its permeability to FITC-labeled dextran and promoted the secretion of metalloproteinase-2 and -9 (MMP-2/9) and cytosolic translocation of caveolin-1 (Cav-1). (qxmd.com)
  • Increased permeability occurred within 2 days of infection and coincided with IL-22-dependent upregulation of the epithelial tight junction protein claudin-2. (elsevier.com)
  • Permeability increases were limited to small molecules, as expected for the paracellular water and Na + channel formed by claudin-2. (elsevier.com)
  • The overexpression of Claudin-4 has been shown to decrease paracellular electrical conductance due to a selective decrease in Na+ permeability, with no significant decrease in Cl - permeability. (thermofisher.com)
  • Intestinal permeability was assessed by measuring 4 kDa dextran-FITC flux in serum, barrier integrity was analyzed using biotin tracer experiment, and claudin-2 protein immunostaining. (uca.fr)
  • The protoplasmic or exoplasmic face association of tight junction particles cannot predict paracellular permeability or heterotypic claudin compatibility. (ebi.ac.uk)
  • These changes were accompanied by an augmented paracellular permeability of the cervix in 2‑ and 7‑month‑old FvB mice treated with E2, which became more pronounced in K14E7 mice treated with or without E2. (spandidos-publications.com)
  • Dysfunction of the intestinal barrier is associated with increased gut permeability and development of multiple gastrointestinal diseases, such as food allergy, inflammatory bowel disease (IBD), irritable bowel syndrome (IBS), celiac disease, and infectious enterocolitis [ 2 - 4 ]. (hindawi.com)
  • The present invention relates generally to methods for regulating claudin-mediated processes, and more particularly to the use of modulating agents comprising a claudin cell adhesion recognition sequence and/or an antibody that specifically recognizes such a sequence for inhibiting functions such as cell adhesion and the formation of tissue permeability barriers. (justia.com)
  • Our data indicated that the IL-1β increase in Caco-2 TJ permeability correlated with an activation of p38 kinase. (jimmunol.org)
  • Additionally, in vivo intestinal perfusion studies also indicated that the IL-1β increase in mouse intestinal permeability required p38 kinase-dependent activation of ATF-2. (jimmunol.org)
  • In conclusion, these studies show that the IL-1β-induced increase in intestinal TJ permeability in vitro and in vivo was regulated by p38 kinase activation of ATF-2 and by ATF-2 regulation of MLCK gene activity. (jimmunol.org)
  • Patients with Crohn disease have an increase in intestinal permeability ( 2 - 4 ). (jimmunol.org)
  • Overexpression of claudin-2 in the originally tight epithelium with claudin-2 cDNA resulted in a 5.6-fold higher paracellular conductivity and relative ion permeabilities of Na(+) identical with 1, K(+)=1.02, NMDG(+)=0.79, choline(+)=0.71, Cl(-)=0.12, Br(-)=0.10 (vector control, 1:1.04:0.95:0.94:0.85:0.83). (nih.gov)
  • Taken together, our results indicate that overexpression of claudin-2 promotes self-renewal within CRC stem-like cells, suggesting a potential role for this protein as a therapeutic target in CRC. (aacrjournals.org)
  • Our findings demonstrate that claudin overexpression studies measure the combined effect of alterations in both endogenous and exogenous claudins, thus explaining the dependence of the phenotype on the host cell line. (deepdyve.com)
  • Overexpression of snail correlates with increased claudin-11, and both are associated with a worse outcome. (nature.com)
  • VEGF overexpression in the mouse retina caused delayed inflammatory cytokine upregulation, monocyte/macrophage infiltration (CD11b + Ly6C + CCR2 + cells), macrophage/microglia activation (CD11b + CD80 + cells), and blood-retinal barrier disruption due to claudin-5 redistribution, which did not recover with VEGF blockade alone. (diabetesjournals.org)
  • E ) CLDN18 overexpression inhibits activation of a YAP luciferase reporter, but not of YAP mutant, YAP5SA, that is resistant to phosphorylation by LATS1/2. (jci.org)
  • Conversely, transgenic claudin-2 overexpression reduced disease severity. (elsevier.com)
  • Overexpression of Slug and Snail in MDCK (Madin-Darby canine kidney) cells down-regulated Claudin-1 at protein and mRNA levels. (biochemj.org)
  • Overexpression studies suggest that tight junction leakiness in these two strains of MDCK cells is conferred by expression of the tight junction protein claudin-2. (uab.edu)
  • Triple-negative breast cancer (TNBC), defined as lack of estrogen and progesterone receptors in the absence of protein overexpression/gene amplification of human epidermal growth factor receptor 2, is still a clinical challenge despite progress in breast cancer care. (frontiersin.org)
  • Claudin-6, 7, or 9 overexpression in the human gastric adenocarcinoma cell line AGS increases its invasiveness, migration, and proliferation rate. (semanticscholar.org)
  • Overexpression of the Xenopus tight-junction protein claudin causes randomization of the left - right body axis. (xenbase.org)
  • Genuine expression of claudin-1 and claudin-2, but not of occludin or claudin-3, was reciprocal to transepithelial resistance. (nih.gov)
  • In contrast to occludin, which induces only a small number of short strands at cell-cell contact sites when introduced into fibroblasts lacking tight junctions, claudin-1 and -2 induce networks of strands characteristic of true tight junctions. (fishersci.com)
  • Though inconclusive, these findings suggest that claudin-1 and -2 are major structural components of TJ strands and that occludin plays some other accessory role. (fishersci.com)
  • Effects of claudin-2, occludin or ZO-1 siRNA transfection on transepithelial electrical resistance (TER) in HK-2 cell monolayers. (figshare.com)
  • TER was significantly decreased by claudin-2 siRNA transfection, but significantly increased by siRNA transfection against occludin or ZO-1. (figshare.com)
  • This same OGD treatment also led to rapid degradation of tight junction protein occludin and dissociation of claudin-5 from the cytoskeleton, which contributed to OGD-induced endothelial barrier disruption. (qxmd.com)
  • Using selective MMP-2/9 inhibitor SB-3CT (2-[[(4-phenoxyphenyl)sulfonyl]methyl]-thiirane) or their neutralizing antibodies or Cav-1 siRNA, we found that MMP-2 was the major enzyme mediating OGD-induced occludin degradation, while Cav-1 was responsible for claudin-5 redistribution. (qxmd.com)
  • Moreover, occludin protein loss and claudin-5 redistribution were detected in ischemic cerebromicrovessels. (qxmd.com)
  • These data indicate that cerebral ischemia initiates two rapid parallel processes, MMP-2-mediated occludin degradation and Cav-1-mediated claudin-5 redistribution, to cause BBB disruption at early stroke stages relevant to acute thrombolysis. (qxmd.com)
  • C) Cell lysates from Huh7.5.1 cells were pulled down by GST-CD81-N-tail, GST-CD81-C-tail, GST-occludin-tail, GST-SRB1-tail, GST-claudin-1 tail or GST with two extra washes. (asm.org)
  • Similarly, it is not known if the expression of claudin-6, occludin and MMP2 is related with the clinical properties of these tumors. (biomedcentral.com)
  • Expression of claudin-6, occludin, and MMP2 was detected in samples of human ovarian cancer tissues by immunohistochemistry and correlated with the clinical properties of the tumors. (biomedcentral.com)
  • This research was conducted to examine the expression of claudin-6, occludin and MMP-2 in 36 ovarian papillary serous carcinomas and 26 ovarian serous adenomas specimens, and investigate the relationship between their expression and clinical properties of the ovarian tumor patients. (biomedcentral.com)
  • Upregulation of pore-forming claudin 2 and downregulation and redistribution of sealing claudins 5 and 8 lead to altered tight junction structure and pronounced barrier dysfunction already in mild to moderately active Crohn's disease. (bmj.com)
  • In HT29 cells, claudins 1, 3, 4 and 5 and possibly claudin 2 were redistributed to apical cell-cell contacts after PKC activation and the amounts of claudins 1, 3 and 5, but not of claudin 2, were increased in cell lysates. (deepdyve.com)
  • Claudins 1 and 4 were phosphorylated in both MDCK I and HT29 cells, but PKC-induced changes in claudin phosphorylation state were detected only in MDCK I cells. (deepdyve.com)
  • In humans, 24 claudins (claudin 1-24) have been identified. (ebi.ac.uk)
  • In MDCK cells the stable expression of E7 increased the space between adjacent cells and altered the architecture of the monolayers, induced the development of an acute peak of transepithelial electrical resistance accompanied by a reduced expression of claudins ‑1, ‑2 and ‑10, and an increase in claudin‑4. (spandidos-publications.com)
  • The Claudin-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition. (fishersci.com)
  • This antibody is confirmed reactive with human, rat, and dog Claudin-2. (fishersci.com)
  • Claudin 2 antibody LS-C254955 is a biotin-conjugated rabbit polyclonal antibody to human Claudin 2 (CLDN2). (lsbio.com)
  • Unexpectedly, the anti-claudin-1 antibody localized claudin to the Golgi apparatus of a sub-population of SA and RA in addition to the distal junctions of RA. (frontiersin.org)
  • The lysates were immunoprecipitated with anti-claudin-1 antibody followed by Western blotting. (asm.org)
  • We offer Claudin-14 Antibody Pairs for use in common research applications: Immunoprecipitation, Western Blot. (novusbio.com)
  • Each Claudin-14 Antibody Pair is fully covered by our Guarantee+, to give you complete peace of mind and the support when you need it. (novusbio.com)
  • Our Claudin-14 Antibody Pairs can be used in a variety of model species: Human. (novusbio.com)
  • Choose from our Claudin-14 Antibody Pairs. (novusbio.com)
  • Antibody is lyophilized from PBS buffer with 2% sucrose. (acris-antibodies.com)
  • 1X10^6 HepG2 cells were stained with 0.2ug Claudin 11 antibody (12152-1-AP, red) and control antibody (blue). (ptglab.com)
  • The following product was used in this experiment: Claudin 4 Monoclonal Antibody (3E2C1) from Thermo Fisher Scientific, catalog # 32-9400, RRID AB_2533096. (thermofisher.com)
  • This antibody reacts specifically with the ~ 22 kDa Claudin-4 protein and does not cross-react with the protein at 55 kDa. (thermofisher.com)
  • Using a human liver-chimeric mouse model(6), we show that a monoclonal antibody specific for the TJ protein claudin-1 (ref. 7) eliminates chronic HCV infection without detectable toxicity. (ugent.be)
  • 2. Incubate primary antibody overnight or at room temperature for 2 hours prepared in 5% milk/TBST. (novusbio.com)
  • The modulating agents comprise at least one claudin cell adhesion recognition sequence or an antibody or fragment thereof that specifically binds the claudin cell adhesion recognition sequence. (justia.com)
  • Here, we show that this is not because of relocalization of claudin-2 into the cytosolic pool but primarily due to a decrease in gene expression. (deepdyve.com)
  • This gene encodes a component of tight junction strands, which is a member of the claudin family. (nih.gov)
  • However, the effects of microRNA-1303 (miR-1303) on gastric cancer (GC) cells and the upstream regulation of GC-associated claudin-18 gene (CLDN18) remain unclear. (springer.com)
  • The claudin gene family: expression in normal and neoplastic tissues. (springer.com)
  • In breast cancer, gene expression analyses have defined five tumor subtypes (luminal A, luminal B, HER2-enriched, basal-like and claudin-low), each of which has unique biologic and prognostic features. (nih.gov)
  • The Claudin-4 gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. (thermofisher.com)
  • In addition, Snail and Slug are able to effectively repress human Claudin - 1 -driven reporter gene constructs containing the wild-type promoter sequence, but not those with mutations in two proximal E-box elements. (biochemj.org)
  • Taken together, these results support the hypothesis that Claudin - 1 is a direct downstream target gene of Snail family factors in epithelial cells. (biochemj.org)
  • The nucleotide sequence data reported for Canis familiaris partial mRNA for putative claudin-1 protein ( cldn1 gene) has been submitted to DDBJ, EMBL, GenBank® and GSDB Nucleotide Sequence Databases under the accession number AJ628857 . (biochemj.org)
  • Claudin-6 is a candidate tumor suppressor gene in breast cancer, and has been shown to be regulated by DNA methylation and histone modification in breast cancer lines. (biomedcentral.com)
  • To study the basolateral function of claudin-7, claudin-7 gene silencing experiments were carried out in a lung cancer cell line using the lentivirus shRNA approach. (aacrjournals.org)
  • We also generated claudin-7-deficient (Cldn7 −/− ) mice using targeted-gene deletion method. (aacrjournals.org)
  • More recently, gene expression analyses showed that BC is a more heterogeneous disease than previously assumed and the BC histotypes based on ER/PR/HER2 classification were expanded to include five major transcriptional subtypes: basal-like, HER2-enriched, luminal A, luminal B, and normal breast-like ( 1 , 2 ). (frontiersin.org)
  • Sixty mutations of claudin 16 coding gene have been reported in familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC) patients. (biomedcentral.com)
  • The contribution of mitochondrial dysfunction to impairments in insulin metabolic signaling is also suggested by gene array analysis showing that reductions in gene expression, that regulates mitochondrial ATP production, are associated with insulin resistance and type 2 diabetes mellitus. (chemweb.com)
  • Tumors with high COX-2 expression displayed large differences in gene expression compared to normal colon. (biomedcentral.com)
  • The promoter region of COX-2 gene did not show consistent methylation in tumor or normal colon tissue. (biomedcentral.com)
  • We conclude that 2,3- pentanedione is a respiratory hazard that can also alter gene expression in the brain. (cdc.gov)
  • The activated ATF-2 translocated to the nucleus where it attached to its binding motif on the myosin L chain kinase (MLCK) promoter region, leading to the activation of MLCK promoter activity and gene transcription. (jimmunol.org)
  • Claudin-2 expression induces cation-selective channels in tight junctions of epithelial cells. (nih.gov)
  • The expression of claudin-2 is restricted to the liver and kidney, with small amounts also found in the brain. (fishersci.com)
  • The density of small tight junction pores varies among cell types and is increased by expression of claudin-2. (semanticscholar.org)
  • Here we report that elevated claudin-2 expression in stage II/III colorectal tumors is associated with poor recurrence-free survival following 5-FU-based chemotherapy, an outcome in which CSC play an instrumental role. (aacrjournals.org)
  • Next-generation sequencing in ALDHHigh cells revealed that claudin-2 regulated expression of nine microRNAs known to control stem cell signaling. (aacrjournals.org)
  • We show that the EMT transcription factor Snail elicits collective migration in squamous cell carcinoma by inducing the expression of a tight junctional protein, claudin-11. (nature.com)
  • Claudin 6 expression is useful to distinguish myxofibrosarcomas from other myxoid soft tissue tumors. (nih.gov)
  • Title: TLR2 activation induced by H. pylori LPS promotes the differential expression of claudin-4, -6, -7 and -9 via either STAT3 and ERK1/2 in AGS cells. (nih.gov)
  • The expression of miR-1303 and claudin-18 in GC tissues and gastric cancer cell lines were detected by qRT-PCR and western blotting, respectively. (springer.com)
  • miR-1303 could bind to the putative binding sites in CLDN18 mRNA 3′-UTR and visibly lower the expression of claudin-18. (springer.com)
  • Ripasudil also contributed to the stability of claudin-5 expression by both transcriptional enhancement and degradation suppression in inflammatory cytokine-stimulated endothelium. (diabetesjournals.org)
  • In turn, claudin-5 becomes anchored to the actin cytoskeleton via zonula occludens protein-1 (ZO-1), resulting in its stable expression on cell membranes ( 14 ). (diabetesjournals.org)
  • Prolonged experimental hypoxia or HIF1A knockdown suppressed HIF-1α-dependent claudin-1 expression and epithelial barrier function, as documented in 3D organotypic epithelial cultures. (jci.org)
  • L2-IL5OXA mice with EoE-relevant allergic inflammation displayed localized eosinophil oxygen metabolism, tissue hypoxia, and impaired claudin-1 barrier via repression of HIF-1α/claudin-1 signaling, which was restored by transgenic expression of esophageal epithelial-targeted stabilized HIF-1α. (jci.org)
  • Claudin-low tumors are characterized by the low to absent expression of luminal differentiation markers, high enrichment for epithelial-to-mesenchymal transition markers, immune response genes and cancer stem cell-like features. (nih.gov)
  • Altered expression of claudin-3 (CLDN3), a key cytoskeletal structural protein of the tight junctions in the epithelium, is associated with the development and metastasis of various human cancers. (medsci.org)
  • Jun, Kim, Jung, Choi, Chin: Expression of claudin-7 and loss of claudin-18 correlate with poor prognosis in gastric cancer. (antikoerper-online.de)
  • Our data suggest, for the first time, that the claudin-6 and MMP-2 are up-regulated in ovarian papillary serous carcinomas, MMP-2 expression was enhanced with increased clinical stage and metastasis. (biomedcentral.com)
  • Significantly, in invasive human breast tumours, high levels of Snail and Slug correlated with low levels of Claudin - 1 expression. (biochemj.org)
  • The results of western blot analysis showed that omeprazole significantly suppressed claudin (Cldn)-7 and -12, but not Cldn-2, expression in Caco-2 cells . (bvsalud.org)
  • By using apical solution of pH 5.5, 6.0, 6.5, and 7.0, we found that apical acidity markedly increased passive Mg2+ transport, Mg2+ affinity of the paracellular channel, and Cldn-7 and -12 expression in Caco-2 monolayers. (bvsalud.org)
  • Extracellular signal-regulated kinase (ERK) 1/2 activation by hepatocyte growth factor treatment of MDCK strain II cells inhibited claudin-2 expression and transiently increased TER. (uab.edu)
  • Transfection of constitutively active mitogen-activated protein kinase/extracellular signal-regulated kinase kinase into MDCK strain II cells also inhibited claudin-2 expression and increased TER. (uab.edu)
  • U0126 treatment of MDCK strain I cells decreased active ERK 1/2 levels, induced expression of claudin-2 protein, and decreased TER by ∼20-fold. (uab.edu)
  • U0126 treatment also induced claudin-2 expression and decreased TER in a high resistance mouse cortical collecting duct cell line (94D). (uab.edu)
  • These data show for the first time that the ERK 1/2 signaling pathway negatively controls claudin-2 expression in mammalian renal epithelial cells and provide evidence for regulation of tight junction paracellular transport by alterations in claudin composition within tight junction complexes. (uab.edu)
  • This is consistent with the claudin-2 abnormal expression at the plasma membrane of intestinal epithelial cells observed in AIEC-infected CEABAC10 mice. (uca.fr)
  • However, the expression of claudin-6 in breast invasive ductal carcinomas and correlation with clinical behavior or expression of other markers is unclear. (biomedcentral.com)
  • We have investigated the expression of claudin-6, MeCP2, HDAC1, H3Ac and H4Ac in 100 breast invasive ductal carcinoma tissues and 22 mammary gland fibroadenoma tissues using immunohistochemistry. (biomedcentral.com)
  • Claudin-6 expression was inversely correlated with lymph node metastasis ( P = 0.021). (biomedcentral.com)
  • Deletion of claudin-7 reduced integrin α2 expression and altered its localization. (aacrjournals.org)
  • Together, our data support the hypothesis that glutamate released during seizures signals an increase in MMP-2 and MMP-9 protein expression and activity levels, resulting in blood-brain barrier leakage. (jneurosci.org)
  • We demonstrate that seizures trigger a pathway that involves glutamate signaling through cytosolic phospholipase A 2 , which increases MMP levels and decreases tight junction protein expression levels, resulting in barrier leakage. (jneurosci.org)
  • Two clone systems were analyzed, exhibiting high or low claudin-2 expression, respectively. (nih.gov)
  • Alteration in claudin protein expression pattern is associated with several types of cancer (2,3). (cellsignal.com)
  • 2016. Effect of junctional adhesion molecule-2 expression on cell growth, invasion and migration in human colorectal cancer . (cardiff.ac.uk)
  • There is no evident difference in renal phenotypes between patients with mutations in CLDN16 and CLDN19, however, severe ocular involvement has been described in CLDN19 patients that might be attributed to extra-renal expression of claudin-19 in nervous system and retina [ 3 ]. (biomedcentral.com)
  • In addition, there was also a transient increase in claudin‑1 expression in the cervix of 2‑month‑old K14E7 mice, and claudin‑10 accumulated at the border of cells in the upper layer of the cervix in FvB mice treated with E2, and in K14E7 mice treated with or without E2. (spandidos-publications.com)
  • Inhibition of Src and p38 MAP kinases suppresses the change of claudin expression induced on dedifferentiation of primary cultured parotid acinar cells. (semanticscholar.org)
  • The expression of counter-balancing pore-closing claudin-1 was unchanged in vehicle-treated animals. (elsevier.com)
  • Results showed early reversible loss of sharp paracellular claudin-5 expression 90, 105, and 120 min following 3-chloropropanediol (500 μM) treatment. (aspetjournals.org)
  • However, AKT inhibitors only prevented the early changes in claudin-5 expression. (aspetjournals.org)
  • This mechanistic study provides a greater understanding of the intracellular signaling pathways mediating tight junction protein expression and supports a hypothesis that two independent pathways triggered by PI3K mediate early and late loss of paracellular claudin-5 expression. (aspetjournals.org)
  • Xenopus claudin expression pattern studied by in situ hybridization. (xenbase.org)
  • The expression patterns of claudin-1, -2, -3, -4, -5, -7 and -8, E-cadherin and β-catenin were analyzed in the non-inflamed mucosa and inflamed mucosa of ICRPs and colorectal mucosa of control dogs by immunoblotting. (pubmedcentralcanada.ca)
  • This study was therefore aimed to define external cell signaling and transcription factors relating to high COX-2 expression in colon cancer tissue. (biomedcentral.com)
  • COX-2 expression in tumor and normal colon tissue was quantified including microarray analyses on tumor mRNA accounting for high and low tumor COX-2 expression. (biomedcentral.com)
  • Numerous genes with altered expression appeared in tumors of high COX-2 expression compared to tumors of low COX-2. (biomedcentral.com)
  • COX-2 expression in normal colon was increased in patients with tumors of high COX-2 compared to normal colon from patients with tumors of low COX-2. (biomedcentral.com)
  • Transcription and external cell signaling factors are altered as covariates to COX-2 expression in colon cancer tissue, but DNA methylation of the COX-2 promoter region was not a significant factor behind COX-2 expression in tumor and normal colon tissue. (biomedcentral.com)
  • Therefore, the aim of the present study was to relate well-recognized external cell- and transcription factor expression to elevated tumor COX-2 expression in colorectal cancer tissue at primary operations aimed at cure. (biomedcentral.com)
  • and decreased tumoral expression of COX-2 and phospho-p65. (aacrjournals.org)
  • Olfactory neuroepithelial injury included loss of olfactory neurons that showed reduced expression of the 2,3- pentanedione -metabolizing enzyme, dicarbonyl/L-xylulose reductase, relative to sustentacular cells. (cdc.gov)
  • An additional group of rats inhaling 270 ppm 2,3- pentanedione for 6 hours 41 minutes showed increased expression of IL-6 and nitric oxide synthase-2 and decreased expression of vascular endothelial growth factor A in the OB, striatum, hippocampus, and cerebellum using real-time PCR. (cdc.gov)
  • Claudin-1 expression increased in the OB and striatum. (cdc.gov)
  • Notably, the anti-VEGF agent and the ROCK inhibitor were synergic in suppressing cytokine upregulation, monocyte/macrophage infiltration, macrophage/microglia activation, and claudin-5 redistribution. (diabetesjournals.org)
  • Thus, IL-22-induced claudin-2 upregulation drives diarrhea and pathogen clearance. (elsevier.com)
  • In ovarian carcinoma cells, Claudin-3 and Claudin-4 exhibit upregulation at both mRNA and protein levels. (thermofisher.com)
  • Here, we identified a regulatory axis whereby the oxygen-sensing transcription factor HIF-1α orchestrated epithelial barrier integrity, selectively controlling tight junction CLDN1 (claudin-1). (jci.org)
  • uc.173 specifically stimulated translation of the tight junction (TJ) claudin-1 (CLDN1) by associating with miR-29b rather than by binding directly to CLDN1 mRNA. (asm.org)
  • However, confocal microscopy revealed a marked subjunctional localization of claudin-1 in C11 cells, indicating that claudin-1 is not functionally related to the low tight junctional resistance of C11 cells. (nih.gov)
  • Hence, with regular Ringer's, Na(+) conductivity was 0.2 mS cm(-2) in vector controls and 1.7 mS cm(-2) in claudin-2-transfected cells, while Cl(-) conductivity was 0.2 mS cm(-2) in both cells. (nih.gov)
  • In patient-derived organoids, primary cells, and cell lines, claudin-2 promoted CRC self-renewal in vitro and in multiple mouse xenograft models. (aacrjournals.org)
  • In MDCK II cells, barrier improvement by claudin-8 is accompanied by a reduction of endogenous claudin-2 protein at the tight junction. (deepdyve.com)
  • To test whether replacement of cation-permeable claudin-2 mediates the effect of claudin-8 on the electrophysiological phenotype of the host cell line, we expressed claudin-8 in high-resistance MDCK I cells, which lack endogenous claudin-2. (deepdyve.com)
  • Immunologic and chemical targeting of the tight-junction protein Claudin-6 eliminates tumorigenic human pluripotent stem cells. (nih.gov)
  • Here, we demonstrated that knockout of Cldn18, a claudin family member highly expressed in lung alveolar epithelium, leads to lung enlargement, parenchymal expansion, increased abundance and proliferation of known distal lung progenitors, the alveolar epithelial type II (AT2) cells, activation of Yes-associated protein (YAP), increased organ size, and tumorigenesis in mice. (jci.org)
  • Cell lysates from Huh7.5.1 cells were pulled down by GST-claudin-1 tail or GST followed by Western blotting. (asm.org)
  • D and E) Immunoblots showing the association of Sec24C with claudin-1 in transfected HEK293T cells by a coimmunoprecipitation assay. (asm.org)
  • HEK293T cells were transfected with Flag-claudin-1, Flag-SRB1, or PCMV-Tag2 empty vector for 48 h. (asm.org)
  • F) Coimmunoprecipitation of endogenous claudin-1 with Sec24C in Huh7.5.1 cells. (asm.org)
  • G) Colocalization of claudin-1 with Sec24C in Huh7.5.1 cells. (asm.org)
  • Huh7.5.1 cells were fixed by PFA and immunofluorescently labeled for claudin-1 (green) and Sec24C (red). (asm.org)
  • B) Huh7.5 cells treated with Sec24C siRNA or a control siRNA for 72 h were stained with antibodies against claudin-1 (green) and the tight junction marker ZO-1 (red). (asm.org)
  • C) Cell surface claudin-1 was quantified by FACS assay in nonpermeabilized cells. (asm.org)
  • D) Intercellular claudin-1 was quantified by FACS assay in permeabilized cells. (asm.org)
  • A) Huh7.5 cells treated with different concentrations of XN for 12 h were fixed with methanol and stained with antibodies against claudin-1 (red) and the tight junction marker ZO-1 (green). (asm.org)
  • Bile duct adenocarcinoma cells overexpress claudin-18 via the EGFR (zeige EGFR Antikörper )/ RAS / ERK (zeige EPHB2 Antikörper ) pathway, contributing to cell proliferation and invasion. (antikoerper-online.de)
  • Because TJs of basal cells are primarily composed of claudin-11, claudin-11-deficient (Cld11 -/- ) mice were generated with an expectation that the compartmentalization in stria vascularis in these mice would be affected. (biologists.org)
  • MDCK strain I cells have higher levels of active ERK 1/2 than do MDCK strain II cells. (uab.edu)
  • A major difference between HT29 and MDCK I cells, which have low and high basal transepithelial electrical resistance, respectively, was the absence of claudin 2 in the latter. (deepdyve.com)
  • 2. Mechanically attach cells and their cytoskeletons to their neighbors or to the ECM. (brainscape.com)
  • Further, when we mimicked experimentally this loss, we found that tubular cells had augmented production of fibrosis-generating mediators, suggesting that claudin-2 is a regulator of this important process. (kidney.ca)
  • First, using cultured tubular cells, we wish to define the cellular and molecular pathways through which claudin-2 controls epithelial activity and production of harmful mediators. (kidney.ca)
  • Claudin-7 is a unique TJ membrane protein in that it has a stronger basolateral membrane distribution than that of apical TJs in epithelial cells. (aacrjournals.org)
  • We found that claudin-7 knockdown (KD) cells showed disrupted cell-matrix interactions. (aacrjournals.org)
  • Consequently, when claudin-7 KD cells were plated on the uncoated glass surface, they were unable to attach to the glass and died the day after plating. (aacrjournals.org)
  • This cell-matrix defect can be rescued by transfecting claudin-7 or integrin β1 back to the claudin-7 KD cells. (aacrjournals.org)
  • We therefore characterized claudin-3 by stable transfection of MDCK II kidney tubule cells with human claudin-3 cDNA. (nih.gov)
  • Claudin-1 is expressed primarily in keratinocytes (4) and normal mammary epithelial cells, but is absent or reduced in breast carcinomas and breast cancer cell lines (5,6). (cellsignal.com)
  • Targeting the Infiltrating Immune Cells in Claudin-low and Basal-type Tumors" is co-led by Jon Serody, MD and Claire Dees, MD. (unclineberger.org)
  • Our group has found that the claudin-low subtype, medullary cancer and some basal-like tumors are heavily infiltrated with immune cells. (unclineberger.org)
  • The current project will focus on enhancing our understanding of how these immune cells potentiate local and metastatic tumor growth of claudin-low, medullary cancer and basal-like tumors. (unclineberger.org)
  • In this study, we evaluated the effects of RSV on oxidative stress induced by H 2 O 2 in IPEC-J2 cells. (hindawi.com)
  • In September 2018, Kozi Bio announced its clinical data on the treatment of gastric cancer/pancreatic cancer with CAR-Claudin 18.2 T cells. (selfgrowth.com)
  • A single dose of ketamine resulted in a significant increase in the number of 5-bromo-2-deoxyuridine-positive (BrdU + ) cells in the dentate gyrus (DG) of rats at 24 h, but not at 28 days, after treatment completion. (chemweb.com)
  • Claudin-1 is expressed primarily in keratinocytes and normal mammary epithelial cells. (ptglab.com)
  • Here, we address how the interaction of heterologously expressed claudin-8 with endogenous claudin isoforms impacts epithelial barrier properties. (deepdyve.com)
  • This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. (acris-antibodies.com)
  • Our findings provide a novel mechanism by which microbial-derived butyrate promotes barrier through IL-10RA-dependent repression of claudin-2. (jimmunol.org)
  • Collectively, these studies reveal HIF-1α's critical role in maintaining barrier and highlight the HIF-1α/claudin-1 axis as a potential therapeutic target for EoE. (jci.org)
  • The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 (zeige IL13 Antikörper ) downregulates claudin-18 . (antikoerper-online.de)
  • We found that exposing isolated rat brain capillaries to glutamate increased MMP-2 and MMP-9 protein and activity levels, and decreased tight junction protein levels, which resulted in barrier leakage. (jneurosci.org)
  • Thus, in a kidney model epithelium, claudin-3 acts as a general barrier-forming protein. (nih.gov)
  • Strain MDCK-C7, which endogenously does not express junctional claudin-2, was transfected with claudin-2 cDNA. (nih.gov)
  • Thus, presence of junctional claudin-2 causes the formation of cation-selective channels sufficient to transform a 'tight' tight junction into a leaky one. (nih.gov)
  • Since it has been shown that ameloblasts repeatedly alternate between an SA and an RA morphology during enamel maturation, the presence of claudin-1 in the Golgi cisterns may indicate the presence of tight junction precursors before transportation to the junctional area. (frontiersin.org)
  • Claudin-2 (IPR005411) Claudin-2 was initially isolated as a peptide fragment from TJ-enriched junctional cell fractions. (ebi.ac.uk)
  • Here, we comprehensively characterize the recently identified claudin-low tumor subtype. (nih.gov)
  • Finally, we confirm that a prognostically relevant differentiation hierarchy exists across all breast cancers in which the claudin-low subtype most closely resembles the mammary epithelial stem cell. (nih.gov)
  • Patients with this subtype termed "claudin-low" have the poorest survival compared to patients with the other intrinsic subtypes. (unclineberger.org)
  • Normal plasma magnesium concentrations typically run between 1.7 and 2.2 mg/dL, 0.75 to 0.95 mmol/L, or 1.5 to 1.9 mEq/L, depending on the units reported (Mg molecular weight=24.3, valence=+2). (renalandurologynews.com)
  • In these studies, the in vitro intestinal epithelial model system (Caco-2 monolayers) was used to delineate the cellular and molecular mechanisms, and a complementary in vivo mouse model system (intestinal perfusion) was used to assess the in vivo relevance of the in vitro findings. (jimmunol.org)
  • In mammals, humans have 23 claudin genes, whereas rats and mice have 24 genes ( Lal-Nag and Morin, 2009 ). (frontiersin.org)
  • Relative to wild-type, claudin-2-deficient mice experienced severe disease, including increased mucosal colonization by C. rodentium, prolonged pathogen shedding, exaggerated cytokine responses, and greater tissue injury. (elsevier.com)
  • Chemically induced osmotic diarrhea reduced colitis severity and C. rodentium burden in claudin-2-deficient, but not transgenic, mice, demonstrating that claudin-2-mediated protection is the result of enhanced water efflux. (elsevier.com)
  • We confirmed these findings in vivo in rats after status epilepticus and in brain capillaries from male mice lacking cytosolic phospholipase A 2 . (jneurosci.org)
  • Here we generated claudin-1-deficient mice and found that the animals died within 1 d of birth with wrinkled skin. (rupress.org)
  • First, we show a reduction of Rsk1 and 2 protein levels in the striatum of two HD mouse models, R6/1 and Hdh Q7/Q111 knock-in mice, at ages when they suffer from motor disturbances. (chemweb.com)
  • Rsk1 and 2 levels were also reduced in the striatum of BDNF heterozygous mice, and upon BDNF neutralization in striatal cultures, suggesting that striatal loss of BDNF could be involved in the decrease of Rsk levels. (chemweb.com)
  • PI3K inhibitors LY294002 (2.5-25 μM) and PI-828 (0.1-10 μM) prevented the 3-chloropropanediol-induced AKT (Thr308) phosphorylation and both early and late loss of paracellular claudin-5. (aspetjournals.org)
  • The activation of p38 kinase caused phosphorylation and activation of p38 kinase substrate, activating transcription factor (ATF)-2. (jimmunol.org)
  • While several of these biological processes are features of the CSC phenotype, a role for claudin-2 in the regulation of these has not been identified. (aacrjournals.org)
  • Among these, miR-222-3p was instrumental for the regulation of self-renewal by claudin-2, and enhancement of this self-renewal required activation of YAP, most likely upstream from miR-222-3p. (aacrjournals.org)
  • Bioinformatic analysis reveals potential properties of human Claudin-6 regulation and functions. (nih.gov)
  • Down-regulation of claudin-18 is associated with the proliferative and invasive potential of gastric cancer. (antikoerper-online.de)
  • This, in turn, was related to a disproportional up-regulation of the pore-forming tight-junction protein claudin-2 throughout the small bowel," explained Dr. Verbeke. (elsevier.com)
  • The clinical, pathological and biological features of claudin-low tumors were compared to the other tumor subtypes using an updated human tumor database and multiple independent data sets. (nih.gov)
  • These main features of claudin-low tumors were also evaluated in a panel of breast cancer cell lines and genetically engineered mouse models. (nih.gov)
  • Clinically, the majority of claudin-low tumors are poor prognosis estrogen receptor (ER)-negative, progesterone receptor (PR)-negative, and epidermal growth factor receptor 2 (HER2)-negative (triple negative) invasive ductal carcinomas with a high frequency of metaplastic and medullary differentiation. (nih.gov)
  • These results should help to improve our understanding of the biologic heterogeneity of breast cancer and provide tools for the further evaluation of the unique biology of claudin-low tumors and cell lines. (nih.gov)
  • miR-1303 was significantly overexpressed whereas claudin-18 was downregulated in GC tissues and cell lines, which was significantly associated with tumor size, location invasion, histologic type and tumor-node-metastasis stage. (springer.com)
  • 51.5% of gastric cancer tissues had reduced claudin-18 . (antikoerper-online.de)
  • Claudin-4 is also overexpressed in pancreatic cancer tissues and cell lines, and in other epithelial cancers. (thermofisher.com)
  • Claudin-2, a component of the tight junction, forms a paracellular water channel. (semanticscholar.org)
  • We conclude that claudin-2, but not claudin-10b, forms a paracellular water channel and thus mediates paracellular water transport in leaky epithelia. (biologists.org)
  • Distal junction area of ruffle-ended ameloblasts (RA) and the Golgi apparatus of a sub-population of smooth-ended ameloblasts (SA) and RAs stained positive with anti-claudin-1 antibodies. (frontiersin.org)
  • Over 50 different formats of bispecific antibodies are now available for therapeutic and diagnostic applications [ 2 ]. (jcancer.org)
  • Claudin-2 enhanced self-renewal of ALDHHigh CSC and increased their proportion in CRC cell populations, limiting their differentiation and promoting the phenotypic transition of non-CSC towards the ALDHHigh phenotype. (aacrjournals.org)
  • Interestingly, we show that a group of highly utilized breast cancer cell lines, and several genetically engineered mouse models, express the claudin-low phenotype. (nih.gov)
  • Knockdown of claudin-7 by lentivirus claudin-7 shRNA downregulated integrin β1 at both mRNA and protein levels. (aacrjournals.org)
  • Suppression of claudin-7 also upregulated matrix metalloproteinase-3 (MMP-3) at both mRNA and protein levels and downregulated several collagens, such as type V α1, type XV α1, and type XVI α1, at the mRNA level. (aacrjournals.org)
  • CLDN18 and YAP interacted and colocalized at cell-cell contacts, while loss of CLDN18 decreased YAP interaction with Hippo kinases p-LATS1/2. (jci.org)
  • H ) IP with anti-p-LATS1/2 Ab shows decreased p-LATS1/2 and decreased association of p-LATS1/2 with p-YAP in Cldn18 -/- (lane 4) compared with WT (lane 3) AT2 cell membranes. (jci.org)
  • IgG = negative control IP with WT and Cldn18 -/- lysates (lanes 1 and 2, respectively). (jci.org)
  • Auf www.antikoerper-online.de finden Sie aktuell 60 Claudin 18 (CLDN18) Antikörper von 14 unterschiedlichen Herstellern. (antikoerper-online.de)
  • Claudin-6: a novel tight junction molecule is developmentally regulated in mouse embryonic epithelium. (semanticscholar.org)
  • By immunohistochemistry, claudin-2, -3, -4, -5 and -7, E-cadherin and β-catenin were expressed in the colorectal epithelium within the inflamed mucosa, but not in granulation tissue. (pubmedcentralcanada.ca)
  • Distributions of claudin-2, -3, -4, -5, and -7, E-cadherin and β-catenin in the colonic epithelium were not different between MDs with ICRPs and control dogs. (pubmedcentralcanada.ca)
  • Claudin-1 levels were significantly elevated in the ileum of INT-747-treated animals (P ≤0.02). (elsevier.com)
  • The expressions of each of claudin, E-cadherin and β-catenin were not significantly different between control dogs and non-inflamed colonic mucosa from MDs with ICRPs. (pubmedcentralcanada.ca)
  • Claudin extracellular domains determine paracellular charge selectivity and resistance but not tight junction fibril architecture. (semanticscholar.org)
  • Recent investigations revealed that a highly conserved glycine-leucine-tryptophan ( 115 G-L-W 117 ) motif in the first extracellular segment (ESC1) of claudin 16 might be essential for stabilization of the appropriately folded ECS1 structure and conservation of normal claudin 16 function. (biomedcentral.com)
  • B) The putative Xenopus Claudin protein has four transmembrane domains, two extracellular loops, one intracellular loop, and a cytoplasmic carboxyl-terminus. (xenbase.org)
  • The tight junction (TJ) protein claudin-2 is overexpressed in human CRC where it enhances cell proliferation, colony formation, and chemoresistance in vitro. (aacrjournals.org)
  • Furthermore, in vitro analysis confirmed that claudin-5 redistribution depends on ROCK2 but not on ROCK1. (diabetesjournals.org)
  • Consistent with these in vitro findings, we observed fluorescence tracer extravasation, increased gelatinolytic activity, and elevated interstitial MMP-2 levels in ischemic subcortical tissue after 2 h MCAO. (qxmd.com)
  • Claudin-1 was transported from the ER in an in vitro budding assay. (asm.org)
  • Methods for using modulating agents to enhance or inhibit claudin-mediated cell adhesion in a variety of in vivo and in vitro contexts are provided. (justia.com)
  • By contrast, claudin-10b transfection did not alter water flux. (biologists.org)
  • The EGF receptor (EGFR) signaling pathway, which has been implicated in a range of cancers, including breast, lung, and colon carcinomas ( 1, 2 ), has been a particular focus of pathway-targeted therapeutics ( 3 ). (aacrjournals.org)
  • Obesity induces chronic inflammation and is an established risk and progression factor for triple-negative breast cancers, including basal-like (BL) and claudin-low (CL) subtypes. (aacrjournals.org)
  • Claudin-2 functions as a paracellular channel with cation (Na+) selectivity at tight junctions. (fishersci.com)
  • In the high-claudin-2 system, claudin-3 reduced claudin-2-induced cation selectivity, while in the low-claudin-2 system no charge preference was observed, the latter thus reflecting the "intrinsic" action of claudin-3. (nih.gov)
  • In this study, the localization of claudin-1 in maturation ameloblasts was examined using immunofluorescence microscopy. (frontiersin.org)
  • Localization of claudin-1 in the Golgi apparatus may reflect rapid tight junction turnover during enamel maturation. (frontiersin.org)
  • Claudin-4 is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. (thermofisher.com)
  • Manner of interaction of heterogeneous claudin species within and between tight junction strands. (ebi.ac.uk)
  • Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands. (ebi.ac.uk)
  • 13050-1-AP targets Claudin 1 in IF, WB, ELISA applications and shows reactivity with human, mouse, dog samples. (ptglab.com)
  • Claudin-6 shares ~25-70% overall similarity with other claudin family members at the amino acid level, displaying highest similarity to claudin-9. (ebi.ac.uk)
  • Moreover, thermodynamic stability of dimer A were investigated by calculating PMFs and compared among seven members of claudin family. (syr.edu)
  • DNA methylation of claudin-6 promotes breast cancer cell migration and invasion by recruiting MeCP2 and deacetylating H3Ac and H4Ac. (nih.gov)
  • Methylation status of up-stream COX-2 promoter region was evaluated. (biomedcentral.com)
  • Mechanistically, tyrosine-phosphorylated claudin-11 activates Src, which suppresses RhoA activity at intercellular junctions through p190RhoGAP, maintaining stable cell-cell contacts. (nature.com)
  • Role of claudin species-specific dynamics in reconstitution and remodeling of the zonula occludens. (ebi.ac.uk)
  • During HCV infection claudin-1 is highly expressed in liver and believed to be associated with HCV virus entry after HCV binding with or without co-receptor CD81. (biomedcentral.com)
  • The dysfunction of claudin leads to partial or complete loss of tight junction function, which eventually causes abnormalities and diseases throughout the body including skin, liver, kidney, lungs, and brain. (syr.edu)
  • In head and neck cancer patients, the Snail-claudin-11 axis prompts the formation of circulating tumour cell clusters, which correlate with tumour progression. (nature.com)
  • Che J, Yue D, Zhang B, Zhang H, Huo Y, Gao L, Zhen H, Yang Y, Cao B. Claudin-3 Inhibits Lung Squamous Cell Carcinoma Cell Epithelial-mesenchymal Transition and Invasion via Suppression of the Wnt/β-catenin Signaling Pathway. (medsci.org)
  • Non-small cell lung cancer (NSCLC) accounts for approximately 85% of lung cancer cases and mainly includes three distant histological subtypes, i.e., lung adenocarcinoma (AC), lung squamous cell carcinoma (SqCC), and large cell carcinoma [ 2 ] . (medsci.org)
  • Knocking down Sec24C reduced the cell surface level of claudin-1. (asm.org)
  • Blocking COPII transport by XN decreased the cell surface level of claudin-1. (asm.org)
  • Most cell types express more than two claudin species in various combinations to constitute TJ strands. (biologists.org)
  • Moreover, an inverse correlation in the levels of Claudin - 1 and Slug transcripts were observed in breast cancer cell lines. (biochemj.org)
  • E-box elements in the Claudin - 1 promoter were found to play a critical negative regulatory role in breast cancer cell lines that expressed low levels of Claudin - 1 transcript. (biochemj.org)
  • Thus, our current study highlights a novel non-TJ function of claudin-7 in maintaining epithelial cell-matrix interactions by interacting with integrins. (aacrjournals.org)
  • it also creates cell proliferation, tumor suppression, cell death propagation, and survival-modulating signals 2 . (thermofisher.com)
  • C-F) Xcla mRNA in the animal pole of 2-, 4-, 8-, and 128-cell embryos. (xenbase.org)
  • Claudin-8 also affects the trafficking of claudin-2, which was displaced specifically from the junctions at which claudin-8 was inserted. (deepdyve.com)
  • Claudin-1 is an integral membrane protein component of tight junctions. (biochemj.org)
  • What are the 2 functions of anchoring junctions? (brainscape.com)
  • The claudin-1 assembly with tight junctions is regulated by post translational modifications. (biomedcentral.com)
  • and Thr 191 may provide an on/off switch to regulate assembly of claudin-1 at tight junctions. (biomedcentral.com)
  • Functionally, the paracellular resistance of claudin-3-transfected monolayers was strongly elevated, causing an increase in transepithelial resistance compared to vector controls. (nih.gov)