Chemical substances that attract or repel cells. The concept denotes especially those factors released as a result of tissue injury, microbial invasion, or immunologic activity, that attract LEUKOCYTES; MACROPHAGES; or other cells to the site of infection or insult.
The movement of leukocytes in response to a chemical concentration gradient or to products formed in an immunologic reaction.
C5 plays a central role in both the classical and the alternative pathway of COMPLEMENT ACTIVATION. C5 is cleaved by C5 CONVERTASE into COMPLEMENT C5A and COMPLEMENT C5B. The smaller fragment C5a is an ANAPHYLATOXIN and mediator of inflammatory process. The major fragment C5b binds to the membrane initiating the spontaneous assembly of the late complement components, C5-C9, into the MEMBRANE ATTACK COMPLEX.
Cytotaxins liberated from normal or invading cells that specifically attract eosinophils; they may be complement fragments, lymphokines, neutrophil products, histamine or other; the best known is the tetrapeptide ECF-A, released mainly by mast cells.
Granular leukocytes having a nucleus with three to five lobes connected by slender threads of chromatin, and cytoplasm containing fine inconspicuous granules and stainable by neutral dyes.
The movement of cells or organisms toward or away from a substance in response to its concentration gradient.
Effective in the initiation of protein synthesis. The initiating methionine residue enters the ribosome as N-formylmethionyl tRNA. This process occurs in Escherichia coli and other bacteria as well as in the mitochondria of eucaryotic cells.
A formylated tripeptide originally isolated from bacterial filtrates that is positively chemotactic to polymorphonuclear leucocytes, and causes them to release lysosomal enzymes and become metabolically activated.
The minor fragment formed when C5 convertase cleaves C5 into C5a and COMPLEMENT C5B. C5a is a 74-amino-acid glycopeptide with a carboxy-terminal ARGININE that is crucial for its spasmogenic activity. Of all the complement-derived anaphylatoxins, C5a is the most potent in mediating immediate hypersensitivity (HYPERSENSITIVITY, IMMEDIATE), smooth MUSCLE CONTRACTION; HISTAMINE RELEASE; and migration of LEUKOCYTES to site of INFLAMMATION.
A member of the CXC chemokine family that plays a role in the regulation of the acute inflammatory response. It is secreted by variety of cell types and induces CHEMOTAXIS of NEUTROPHILS and other inflammatory cells.
A transplantable carcinoma of the rat that originally appeared spontaneously in the mammary gland of a pregnant albino rat, and which now resembles a carcinoma in young transplants and a sarcoma in older transplants. (Stedman, 25th ed)
Group of chemokines without adjacent cysteines that are chemoattractants for lymphocytes only.
Granular leukocytes with a nucleus that usually has two lobes connected by a slender thread of chromatin, and cytoplasm containing coarse, round granules that are uniform in size and stainable by eosin.
The major metabolite in neutrophil polymorphonuclear leukocytes. It stimulates polymorphonuclear cell function (degranulation, formation of oxygen-centered free radicals, arachidonic acid release, and metabolism). (From Dictionary of Prostaglandins and Related Compounds, 1990)
Serum peptides derived from certain cleaved COMPLEMENT PROTEINS during COMPLEMENT ACTIVATION. They induce smooth MUSCLE CONTRACTION; mast cell HISTAMINE RELEASE; PLATELET AGGREGATION; and act as mediators of the local inflammatory process. The order of anaphylatoxin activity from the strongest to the weakest is C5a, C3a, C4a, and C5a des-arginine.
A cytotoxic member of the CYTOCHALASINS.
Large, phagocytic mononuclear leukocytes produced in the vertebrate BONE MARROW and released into the BLOOD; contain a large, oval or somewhat indented nucleus surrounded by voluminous cytoplasm and numerous organelles.
White blood cells. These include granular leukocytes (BASOPHILS; EOSINOPHILS; and NEUTROPHILS) as well as non-granular leukocytes (LYMPHOCYTES and MONOCYTES).
Serum glycoproteins participating in the host defense mechanism of COMPLEMENT ACTIVATION that creates the COMPLEMENT MEMBRANE ATTACK COMPLEX. Included are glycoproteins in the various pathways of complement activation (CLASSICAL COMPLEMENT PATHWAY; ALTERNATIVE COMPLEMENT PATHWAY; and LECTIN COMPLEMENT PATHWAY).
A colorless, syrupy, strongly acidic liquid that can form detergents with oleic acid.
The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.
Peptides composed of between two and twelve amino acids.
The movement of cells from one location to another. Distinguish from CYTOKINESIS which is the process of dividing the CYTOPLASM of a cell.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
Exudates are fluids, CELLS, or other cellular substances that are slowly discharged from BLOOD VESSELS usually from inflamed tissues. Transudates are fluids that pass through a membrane or squeeze through tissue or into the EXTRACELLULAR SPACE of TISSUES. Transudates are thin and watery and contain few cells or PROTEINS.
Chemokines that are chemoattractants for monocytes. These CC chemokines (cysteines adjacent) number at least three including CHEMOKINE CCL2.
A common name used for the genus Cavia. The most common species is Cavia porcellus which is the domesticated guinea pig used for pets and biomedical research.
The relatively long-lived phagocytic cell of mammalian tissues that are derived from blood MONOCYTES. Main types are PERITONEAL MACROPHAGES; ALVEOLAR MACROPHAGES; HISTIOCYTES; KUPFFER CELLS of the liver; and OSTEOCLASTS. They may further differentiate within chronic inflammatory lesions to EPITHELIOID CELLS or may fuse to form FOREIGN BODY GIANT CELLS or LANGHANS GIANT CELLS. (from The Dictionary of Cell Biology, Lackie and Dow, 3rd ed.)
A chemokine that is a chemoattractant for MONOCYTES and may also cause cellular activation of specific functions related to host defense. It is produced by LEUKOCYTES of both monocyte and lymphocyte lineage and by FIBROBLASTS during tissue injury. It has specificity for CCR2 RECEPTORS.
Molecules on the surface of some B-lymphocytes and macrophages, that recognize and combine with the C3b, C3d, C1q, and C4b components of complement.
The study of the structure, behavior, growth, reproduction, and pathology of cells; and the function and chemistry of cellular components.
Electrophoresis applied to BLOOD PROTEINS.
One of the HISTAMINE H1 ANTAGONISTS with little sedative action. It is used in treatment of hay fever, rhinitis, allergic dermatoses, and pruritus.
A family of G-protein-coupled receptors that was originally identified by its ability to bind N-formyl peptides such as N-FORMYLMETHIONINE LEUCYL-PHENYLALANINE. Since N-formyl peptides are found in MITOCHONDRIA and BACTERIA, this class of receptors is believed to play a role in mediating cellular responses to cellular damage and bacterial invasion. However, non-formylated peptide ligands have also been found for this receptor class.
Group of chemokines with paired cysteines separated by a different amino acid. CXC chemokines are chemoattractants for neutrophils but not monocytes.
The serous fluid of ASCITES, the accumulation of fluids in the PERITONEAL CAVITY.
An acute hypersensitivity reaction due to exposure to a previously encountered ANTIGEN. The reaction may include rapidly progressing URTICARIA, respiratory distress, vascular collapse, systemic SHOCK, and death.
A soluble factor produced by MONOCYTES; MACROPHAGES, and other cells which activates T-lymphocytes and potentiates their response to mitogens or antigens. Interleukin-1 is a general term refers to either of the two distinct proteins, INTERLEUKIN-1ALPHA and INTERLEUKIN-1BETA. The biological effects of IL-1 include the ability to replace macrophage requirements for T-cell activation.
A major alkaloid from Colchicum autumnale L. and found also in other Colchicum species. Its primary therapeutic use is in the treatment of gout, but it has been used also in the therapy of familial Mediterranean fever (PERIODIC DISEASE).
Elements of limited time intervals, contributing to particular results or situations.
Serum globulins that migrate to the gamma region (most positively charged) upon ELECTROPHORESIS. At one time, gamma-globulins came to be used as a synonym for immunoglobulins since most immunoglobulins are gamma globulins and conversely most gamma globulins are immunoglobulins. But since some immunoglobulins exhibit an alpha or beta electrophoretic mobility, that usage is in decline.
A dermal inflammatory reaction produced under conditions of antibody excess, when a second injection of antigen produces intravascular antigen-antibody complexes which bind complement, causing cell clumping, endothelial damage, and vascular necrosis.
Class of pro-inflammatory cytokines that have the ability to attract and activate leukocytes. They can be divided into at least three structural branches: C; (CHEMOKINES, C); CC; (CHEMOKINES, CC); and CXC; (CHEMOKINES, CXC); according to variations in a shared cysteine motif.
Virus diseases caused by the TOGAVIRIDAE.
A specific protein kinase C inhibitor, which inhibits superoxide release from human neutrophils (PMN) stimulated with phorbol myristate acetate or synthetic diacylglycerol.
Leukocytes with abundant granules in the cytoplasm. They are divided into three groups according to the staining properties of the granules: neutrophilic, eosinophilic, and basophilic. Mature granulocytes are the NEUTROPHILS; EOSINOPHILS; and BASOPHILS.
Chromatography on non-ionic gels without regard to the mechanism of solute discrimination.
Soluble protein factors generated by activated lymphocytes that affect other cells, primarily those involved in cellular immunity.
Adherence of cells to surfaces or to other cells.
A CXC chemokine with specificity for CXCR2 RECEPTORS. It has growth factor activities and is implicated as a oncogenic factor in several tumor types.
The phenomenon by which dissociated cells intermixed in vitro tend to group themselves with cells of their own type.
A phospholipid derivative formed by PLATELETS; BASOPHILS; NEUTROPHILS; MONOCYTES; and MACROPHAGES. It is a potent platelet aggregating agent and inducer of systemic anaphylactic symptoms, including HYPOTENSION; THROMBOCYTOPENIA; NEUTROPENIA; and BRONCHOCONSTRICTION.
Toxins closely associated with the living cytoplasm or cell wall of certain microorganisms, which do not readily diffuse into the culture medium, but are released upon lysis of the cells.
A membrane or barrier with micrometer sized pores used for separation purification processes.
The decrease in a measurable parameter of a PHYSIOLOGICAL PROCESS, including cellular, microbial, and plant; immunological, cardiovascular, respiratory, reproductive, urinary, digestive, neural, musculoskeletal, ocular, and skin physiological processes; or METABOLIC PROCESS, including enzymatic and other pharmacological processes, by a drug or other chemical.
The process in which the neutrophil is stimulated by diverse substances, resulting in degranulation and/or generation of reactive oxygen products, and culminating in the destruction of invading pathogens. The stimulatory substances, including opsonized particles, immune complexes, and chemotactic factors, bind to specific cell-surface receptors on the neutrophil.
The sum of the weight of all the atoms in a molecule.
An increased reactivity to specific antigens mediated not by antibodies but by cells.
Abnormal increase of EOSINOPHILS in the blood, tissues or organs.
A pathological process characterized by injury or destruction of tissues caused by a variety of cytologic and chemical reactions. It is usually manifested by typical signs of pain, heat, redness, swelling, and loss of function.
Phenomenon of cell-mediated immunity measured by in vitro inhibition of the migration or phagocytosis of antigen-stimulated LEUKOCYTES or MACROPHAGES. Specific CELL MIGRATION ASSAYS have been developed to estimate levels of migration inhibitory factors, immune reactivity against tumor-associated antigens, and immunosuppressive effects of infectious microorganisms.
A cytokine produced by activated T-LYMPHOCYTES that stimulates the migration of CD4-POSITIVE LYMPHOCYTES and monocytes. It has been reported to suppress HIV replication.
The number of WHITE BLOOD CELLS per unit volume in venous BLOOD. A differential leukocyte count measures the relative numbers of the different types of white cells.
The outer covering of the body that protects it from the environment. It is composed of the DERMIS and the EPIDERMIS.
Culture media containing biologically active components obtained from previously cultured cells or tissues that have released into the media substances affecting certain cell functions (e.g., growth, lysis).
A phorbol ester found in CROTON OIL with very effective tumor promoting activity. It stimulates the synthesis of both DNA and RNA.
Molecules found on the surface of some, but not all, B-lymphocytes, T-lymphocytes, and macrophages, which recognize and combine with the Fc (crystallizable) portion of immunoglobulin molecules.
A di-isopropyl-fluorophosphate which is an irreversible cholinesterase inhibitor used to investigate the NERVOUS SYSTEM.
Highly reactive compounds produced when oxygen is reduced by a single electron. In biological systems, they may be generated during the normal catalytic function of a number of enzymes and during the oxidation of hemoglobin to METHEMOGLOBIN. In living organisms, SUPEROXIDE DISMUTASE protects the cell from the deleterious effects of superoxides.
The science and application of a double-beam transmission interference microscope in which the illuminating light beam is split into two paths. One beam passes through the specimen while the other beam reflects off a reference mirror before joining and interfering with the other. The observed optical path difference between the two beams can be measured and used to discriminate minute differences in thickness and refraction of non-stained transparent specimens, such as living cells in culture.
Serum that contains antibodies. It is obtained from an animal that has been immunized either by ANTIGEN injection or infection with microorganisms containing the antigen.
Molecular sites on or in some B-lymphocytes and macrophages that recognize and combine with COMPLEMENT C3B. The primary structure of these receptors reveal that they contain transmembrane and cytoplasmic domains, with their extracellular portion composed entirely of thirty short consensus repeats each having 60 to 70 amino acids.
An ionophorous, polyether antibiotic from Streptomyces chartreusensis. It binds and transports CALCIUM and other divalent cations across membranes and uncouples oxidative phosphorylation while inhibiting ATPase of rat liver mitochondria. The substance is used mostly as a biochemical tool to study the role of divalent cations in various biological systems.
A basic enzyme that is present in saliva, tears, egg white, and many animal fluids. It functions as an antibacterial agent. The enzyme catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. EC 3.2.1.17.
Techniques used to separate mixtures of substances based on differences in the relative affinities of the substances for mobile and stationary phases. A mobile phase (fluid or gas) passes through a column containing a stationary phase of porous solid or liquid coated on a solid support. Usage is both analytical for small amounts and preparative for bulk amounts.
Preparations made from animal tissues or organs (ANIMAL STRUCTURES). They usually contain many components, any one of which may be pharmacologically or physiologically active. Tissue extracts may contain specific, but uncharacterized factors or proteins with specific actions.
The relationship between the dose of an administered drug and the response of the organism to the drug.
Carbon-containing phosphonic acid compounds. Included under this heading are compounds that have carbon bound to either OXYGEN atom or the PHOSPHOROUS atom of the (P=O)O2 structure.
Serum glycoprotein produced by activated MACROPHAGES and other mammalian MONONUCLEAR LEUKOCYTES. It has necrotizing activity against tumor cell lines and increases ability to reject tumor transplants. Also known as TNF-alpha, it is only 30% homologous to TNF-beta (LYMPHOTOXIN), but they share TNF RECEPTORS.
The complex formed by the binding of antigen and antibody molecules. The deposition of large antigen-antibody complexes leading to tissue damage causes IMMUNE COMPLEX DISEASES.
Lipid-containing polysaccharides which are endotoxins and important group-specific antigens. They are often derived from the cell wall of gram-negative bacteria and induce immunoglobulin secretion. The lipopolysaccharide molecule consists of three parts: LIPID A, core polysaccharide, and O-specific chains (O ANTIGENS). When derived from Escherichia coli, lipopolysaccharides serve as polyclonal B-cell mitogens commonly used in laboratory immunology. (From Dorland, 28th ed)
Any inflammation of the skin.
Regulatory proteins and peptides that are signaling molecules involved in the process of PARACRINE COMMUNICATION. They are generally considered factors that are expressed by one cell and are responded to by receptors on another nearby cell. They are distinguished from HORMONES in that their actions are local rather than distal.
The rate dynamics in chemical or physical systems.
A subclass of EXOPEPTIDASES that act on the free N terminus end of a polypeptide liberating a single amino acid residue. EC 3.4.11.
An oxidative decarboxylation process that converts GLUCOSE-6-PHOSPHATE to D-ribose-5-phosphate via 6-phosphogluconate. The pentose product is used in the biosynthesis of NUCLEIC ACIDS. The generated energy is stored in the form of NADPH. This pathway is prominent in tissues which are active in the synthesis of FATTY ACIDS and STEROIDS.
Small polyhedral outpouchings along the walls of the alveolar sacs, alveolar ducts and terminal bronchioles through the walls of which gas exchange between alveolar air and pulmonary capillary blood takes place.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
Presence of warmth or heat or a temperature notably higher than an accustomed norm.
The engulfing and degradation of microorganisms; other cells that are dead, dying, or pathogenic; and foreign particles by phagocytic cells (PHAGOCYTES).
Granulated cells that are found in almost all tissues, most abundantly in the skin and the gastrointestinal tract. Like the BASOPHILS, mast cells contain large amounts of HISTAMINE and HEPARIN. Unlike basophils, mast cells normally remain in the tissues and do not circulate in the blood. Mast cells, derived from the bone marrow stem cells, are regulated by the STEM CELL FACTOR.
A CC-type chemokine that is specific for CCR3 RECEPTORS. It is a potent chemoattractant for EOSINOPHILS.
Cell surface molecules on cells of the immune system that specifically bind surface molecules or messenger molecules and trigger changes in the behavior of cells. Although these receptors were first identified in the immune system, many have important functions elsewhere.
Glycoproteins which contain sialic acid as one of their carbohydrates. They are often found on or in the cell or tissue membranes and participate in a variety of biological activities.
Condensed areas of cellular material that may be bounded by a membrane.
White blood cells formed in the body's lymphoid tissue. The nucleus is round or ovoid with coarse, irregularly clumped chromatin while the cytoplasm is typically pale blue with azurophilic (if any) granules. Most lymphocytes can be classified as either T or B (with subpopulations of each), or NATURAL KILLER CELLS.
Soluble mediators of the immune response that are neither antibodies nor complement. They are produced largely, but not exclusively, by monocytes and macrophages.
A defect of leukocyte function in which phagocytic cells ingest but fail to digest bacteria, resulting in recurring bacterial infections with granuloma formation. When chronic granulomatous disease is caused by mutations in the CYBB gene, the condition is inherited in an X-linked recessive pattern. When chronic granulomatous disease is caused by CYBA, NCF1, NCF2, or NCF4 gene mutations, the condition is inherited in an autosomal recessive pattern.
A specific immune response elicited by a specific dose of an immunologically active substance or cell in an organism, tissue, or cell.
Proteins prepared by recombinant DNA technology.
Non-antibody proteins secreted by inflammatory leukocytes and some non-leukocytic cells, that act as intercellular mediators. They differ from classical hormones in that they are produced by a number of tissue or cell types rather than by specialized glands. They generally act locally in a paracrine or autocrine rather than endocrine manner.
Techniques for removal by adsorption and subsequent elution of a specific antibody or antigen using an immunosorbent containing the homologous antigen or antibody.
Techniques used for determining the values of photometric parameters of light resulting from LUMINESCENCE.
The diffusion or accumulation of neutrophils in tissues or cells in response to a wide variety of substances released at the sites of inflammatory reactions.
A layer of epithelium that lines the heart, blood vessels (ENDOTHELIUM, VASCULAR), lymph vessels (ENDOTHELIUM, LYMPHATIC), and the serous cavities of the body.
A basic element found in nearly all organized tissues. It is a member of the alkaline earth family of metals with the atomic symbol Ca, atomic number 20, and atomic weight 40. Calcium is the most abundant mineral in the body and combines with phosphorus to form calcium phosphate in the bones and teeth. It is essential for the normal functioning of nerves and muscles and plays a role in blood coagulation (as factor IV) and in many enzymatic processes.
Organic compounds that contain two nitro groups attached to a phenol.
Signal molecules that are involved in the control of cell growth and differentiation.
The processes triggered by interactions of ANTIBODIES with their ANTIGENS.
A protease of broad specificity, obtained from dried pancreas. Molecular weight is approximately 25,000. The enzyme breaks down elastin, the specific protein of elastic fibers, and digests other proteins such as fibrin, hemoglobin, and albumin. EC 3.4.21.36.
A group of compounds with the heterocyclic ring structure of benzo(c)pyridine. The ring structure is characteristic of the group of opium alkaloids such as papaverine. (From Stedman, 25th ed)
A MANNOSE/GLUCOSE binding lectin isolated from the jack bean (Canavalia ensiformis). It is a potent mitogen used to stimulate cell proliferation in lymphocytes, primarily T-lymphocyte, cultures.
A glycoprotein that is central in both the classical and the alternative pathway of COMPLEMENT ACTIVATION. C3 can be cleaved into COMPLEMENT C3A and COMPLEMENT C3B, spontaneously at low level or by C3 CONVERTASE at high level. The smaller fragment C3a is an ANAPHYLATOXIN and mediator of local inflammatory process. The larger fragment C3b binds with C3 convertase to form C5 convertase.
Centrifugation with a centrifuge that develops centrifugal fields of more than 100,000 times gravity. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Established cell cultures that have the potential to propagate indefinitely.
A CC chemokine with specificity for CCR1 RECEPTORS and CCR5 RECEPTORS. It is a chemoattractant for NK CELLS; MONOCYTES; and a variety of other immune cells. This chemokine is encoded by multiple genes.
Either of the pair of organs occupying the cavity of the thorax that effect the aeration of the blood.
Cell-surface glycoprotein beta-chains that are non-covalently linked to specific alpha-chains of the CD11 family of leukocyte-adhesion molecules (RECEPTORS, LEUKOCYTE-ADHESION). A defect in the gene encoding CD18 causes LEUKOCYTE-ADHESION DEFICIENCY SYNDROME.
One of the virulence factors produced by BORDETELLA PERTUSSIS. It is a multimeric protein composed of five subunits S1 - S5. S1 contains mono ADPribose transferase activity.
Group of chemokines with adjacent cysteines that are chemoattractants for lymphocytes, monocytes, eosinophils, basophils but not neutrophils.
An adhesion-promoting leukocyte surface membrane heterodimer. The alpha subunit consists of the CD11b ANTIGEN and the beta subunit the CD18 ANTIGEN. The antigen, which is an integrin, functions both as a receptor for complement 3 and in cell-cell and cell-substrate adhesive interactions.
Cell surface glycoproteins that bind to chemokines and thus mediate the migration of pro-inflammatory molecules. The receptors are members of the seven-transmembrane G protein-coupled receptor family. Like the CHEMOKINES themselves, the receptors can be divided into at least three structural branches: CR, CCR, and CXCR, according to variations in a shared cysteine motif.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A set of BACTERIAL ADHESINS and TOXINS, BIOLOGICAL produced by BORDETELLA organisms that determine the pathogenesis of BORDETELLA INFECTIONS, such as WHOOPING COUGH. They include filamentous hemagglutinin; FIMBRIAE PROTEINS; pertactin; PERTUSSIS TOXIN; ADENYLATE CYCLASE TOXIN; dermonecrotic toxin; tracheal cytotoxin; Bordetella LIPOPOLYSACCHARIDES; and tracheal colonization factor.
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
The sequential activation of serum COMPLEMENT PROTEINS to create the COMPLEMENT MEMBRANE ATTACK COMPLEX. Factors initiating complement activation include ANTIGEN-ANTIBODY COMPLEXES, microbial ANTIGENS, or cell surface POLYSACCHARIDES.
Soluble factors which stimulate growth-related activities of leukocytes as well as other cell types. They enhance cell proliferation and differentiation, DNA synthesis, secretion of other biologically active molecules and responses to immune and inflammatory stimuli.
A CXC chemokine that is chemotactic for T-LYMPHOCYTES and MONOCYTES. It has specificity for CXCR4 RECEPTORS. Two isoforms of CXCL12 are produced by alternative mRNA splicing.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Proteins that bind specific drugs with high affinity and trigger intracellular changes influencing the behavior of cells. Drug receptors are generally thought to be receptors for some endogenous substance not otherwise specified.
Heparin-binding proteins that exhibit a number of inflammatory and immunoregulatory activities. Originally identified as secretory products of MACROPHAGES, these chemokines are produced by a variety of cell types including NEUTROPHILS; FIBROBLASTS; and EPITHELIAL CELLS. They likely play a significant role in respiratory tract defenses.
Altered reactivity to an antigen, which can result in pathologic reactions upon subsequent exposure to that particular antigen.
The property of blood capillary ENDOTHELIUM that allows for the selective exchange of substances between the blood and surrounding tissues and through membranous barriers such as the BLOOD-AIR BARRIER; BLOOD-AQUEOUS BARRIER; BLOOD-BRAIN BARRIER; BLOOD-NERVE BARRIER; BLOOD-RETINAL BARRIER; and BLOOD-TESTIS BARRIER. Small lipid-soluble molecules such as carbon dioxide and oxygen move freely by diffusion. Water and water-soluble molecules cannot pass through the endothelial walls and are dependent on microscopic pores. These pores show narrow areas (TIGHT JUNCTIONS) which may limit large molecule movement.
Electrophoresis in which a pH gradient is established in a gel medium and proteins migrate until they reach the site (or focus) at which the pH is equal to their isoelectric point.
Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).
A hemeprotein from leukocytes. Deficiency of this enzyme leads to a hereditary disorder coupled with disseminated moniliasis. It catalyzes the conversion of a donor and peroxide to an oxidized donor and water. EC 1.11.1.7.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Single pavement layer of cells which line the luminal surface of the entire vascular system and regulate the transport of macromolecules and blood components.
A sulfur-containing essential L-amino acid that is important in many body functions.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Connective tissue cells which secrete an extracellular matrix rich in collagen and other macromolecules.
Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
Washing liquid obtained from irrigation of the lung, including the BRONCHI and the PULMONARY ALVEOLI. It is generally used to assess biochemical, inflammatory, or infection status of the lung.
An acidic glycoprotein of MW 23 kDa with internal disulfide bonds. The protein is produced in response to a number of inflammatory mediators by mesenchymal cells present in the hemopoietic environment and at peripheral sites of inflammation. GM-CSF is able to stimulate the production of neutrophilic granulocytes, macrophages, and mixed granulocyte-macrophage colonies from bone marrow cells and can stimulate the formation of eosinophil colonies from fetal liver progenitor cells. GM-CSF can also stimulate some functional activities in mature granulocytes and macrophages.
A serine endopeptidase that is formed from TRYPSINOGEN in the pancreas. It is converted into its active form by ENTEROPEPTIDASE in the small intestine. It catalyzes hydrolysis of the carboxyl group of either arginine or lysine. EC 3.4.21.4.

Non-serum-dependent chemotactic factors produced by Candida albicans stimulate chemotaxis by binding to the formyl peptide receptor on neutrophils and to an unknown receptor on macrophages. (1/1836)

Serum-free culture filtrates of six Candida species and Saccharomyces cerevisiae were found to contain chemoattractants for human polymorphonuclear leukocytes (PMNs) and a mouse macrophage-like cell line, J774. The chemotactic factors differed for the PMN and J774 cells, however, in terms of heat stability, kinetics of liberation by the yeast cells, and divalent cation requirements for production. The chemoattractant in Candida albicans culture filtrates appeared to act through the formyl peptide receptor (FPR) of PMNs, since it was found to induce chemotaxis of Chinese hamster ovary (CHO) cells that were expressing the human FPR but did not induce chemotaxis of wild-type CHO cells. The C. albicans culture filtrates also induced migration of PMNs across confluent monolayers of a human gastrointestinal epithelial cell line, T84; migration occurred in the basolateral-to-apical direction but not the reverse direction, unless the epithelial tight junctions were disrupted. J774 cells did not migrate toward the formylated peptide (fMet-Leu-Phe; fMLF), and chemotaxis toward the C. albicans culture filtrate was not inhibited by an FPR antagonist (t-butoxycarbonyl-Met-Leu-Phe), suggesting that a different receptor mediated J774 cell chemotaxis. In conclusion, we have identified a receptor by which a non-serum-dependent chemotactic factor (NSCF) produced by C. albicans induced chemotaxis of PMNs. Additionally, we have shown that NSCF was active across epithelial monolayers. These findings suggest that NSCFs produced by C. albicans and other yeast species may influence host-pathogen interactions at the gastrointestinal tract mucosal surface by inducing phagocytic-cell infiltration.  (+info)

Acetyl-CoA:1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine acetyltransferase is directly activated by p38 kinase. (2/1836)

Acetyl-CoA:1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine acetyltransferase, along with phospholipase A2, is a key regulator of platelet-activating factor biosynthesis via the remodeling pathway. We have now obtained evidence in human neutrophils indicating that this enzyme is regulated by a specific member of the mitogen-activated protein kinases, namely the p38 kinase. We earlier demonstrated that tumor necrosis factor-alpha (TNF-alpha) as well as N-formyl-methionyl-leucyl-phenylalanine treatment leads to increased phosphorylation and activation of p38 kinase in human neutrophils. Strikingly, in the present study these stimuli increased the catalytic activity of acetyltransferase up to 3-fold, whereas 4-phorbol 12-myristate 13-acetate, which activates the extracellular-regulated kinases (ERKs) but not p38 kinase, had no effect. Furthermore, a selective inhibitor of p38 kinase, SB 203580, was able to abolish the TNF-alpha- and N-formyl-methionyl-leucyl-phenylalanine-induced activation of acetyltransferase. The same effect was not observed in the presence of an inhibitor that blocked ERK activation (PD 98059). Complementing the findings in intact cells, we have shown that recombinant, activated p38 kinase added to microsomes in the presence of Mg2+ and ATP increased acetyltransferase activity to the same degree as in microsomes obtained from TNF-alpha-stimulated cells. No activation of acetyltransferase occurred upon treatment of microsomes with either recombinant, activated ERK-1 or ERK-2. Finally, the increases in acetyltransferase activity induced by TNF-alpha could be ablated by treating the microsomes with alkaline phosphatase. Thus acetyltransferase appears to be a downstream target for p38 kinase but not ERKs. These data from whole cells as well as cell-free systems fit a model wherein stimulus-induced acetyltransferase activation is mediated by a phosphorylation event catalyzed directly by p38 kinase.  (+info)

Isolation of novel GRO genes and a phylogenetic analysis of the CXC chemokine subfamily in mammals. (3/1836)

Approximately 15 different alpha, or CXC, chemokines have thus far been isolated from 11 species of mammals. Among the best studied chemokines are the 12 human proteins that are encoded by 11 paralogous genes. In order to better understand the evolution and function of this group of genes, we isolated and characterized six novel GRO and GRO-related cDNA sequences from the cow (Bos taurus), the sheep (Ovis aries), the rabbit (Oryctolagus cuniculus), and the guinea pig (Cavia porcellus). The amino acid sequence of the diverged guinea pig GRO or KC gene is only 50%-60% similar to presumed orthologs from other species, while the sheep and cow GRO proteins are 90%-99% similar to each other. The presence of multiple GRO genes in the cow, the rabbit, and the sheep is consistent with what has been observed for humans. Phylogenetic analyses of amino acid sequences from 44 proteins indicate that genes orthologous to many of the 11 known from humans exist in other species. One such gene, interleukin 8, or IL8, has been isolated from nine species, including the rodent guinea pig; however, this gene is absent in the rat and the mouse, indicating a unique gene loss event in the rat/mouse (muroid rodent) lineage. The KC (or MIP2) gene of rodents appears to be orthologous to the GRO gene found in other taxonomic orders. Combined evidence from different sources suggests that IP10 and MIG share sister taxon relationships on the evolutionary tree, while the remaining paralogous genes represent independent lineages, with limited evidence for kinship between them. This observation indicates that these genes originated nearly contemporaneously via a series of gene duplication events. Relative-rate tests for synonymous and nonsynonymous nucleotide substitutions in the KC and IL8 genes did not detect rate heterogeneity; however, there are several notable features regarding the IL8 genes. For example, the IL8 proteins from two Old World monkeys are as similar to one another as they are to the IL8 protein from humans, and all observed nucleotide differences between the IL8 genes of the two monkeys cause amino acid changes; in other words, there are no synonymous differences between them.  (+info)

Car: a cytoplasmic sensor responsible for arginine chemotaxis in the archaeon Halobacterium salinarum. (4/1836)

A new metabolic signaling pathway for arginine, both a chemoeffector and a fermentative energy source, is described for Halobacterium salinarum. Systematic screening of 80+ potentially chemotactic compounds with two behavioral assays identified leucine, isoleucine, valine, methionine, cysteine, arginine and several peptides as strong chemoattractants. Deletion analysis of a number of potential halobacterial transducer genes led to the identification of Car, a specific cytoplasmic arginine transducer which lacks transmembrane helices and was biochemically shown to be localized in the cytoplasm. Flow assays were used to show specific adaptive responses to arginine and ornithine in wild-type but not Deltacar cells, demonstrating the role of Car in sensing arginine. The signaling pathway from external arginine to the flagellar motor of the cell involves an arginine:ornithine antiporter which was quantitatively characterized for its transport kinetics and inhibitors. By compiling the chemotactic behavior, the adaptive responses and the characteristics of the arginine:ornithine antiporter to arginine and its analogs, we now understand how the combination of arginine uptake and its metabolic conversion is required to build an effective sensing system. In both bacteria and the archaea this is the first chemoeffector molecule of a soluble methylatable transducer to be identified.  (+info)

Rho-kinase in human neutrophils: a role in signalling for myosin light chain phosphorylation and cell migration. (5/1836)

The role of a Rho-associated coiled-coil forming kinase in migration of neutrophils has been investigated. Rho-associated coiled-coil forming kinase I was expressed in human neutrophils. Chemotactic peptide led to a Rho-associated coiled-coil forming kinase-dependent increase in phosphorylation of myosin light chain. This was determined with the help of an antibody directed against serine 19-phosphorylated myosin light chain and an inhibitor of Rho-associated coiled-coil forming kinase (Y-27632). Y-27632 suppressed myosin light chain phosphorylation and chemotactic peptide-induced development of cell polarity and locomotion with similar potency (ED50 0.5-1.1 microM). The data strongly suggest that a Rho-associated coiled-coil forming kinase isoform, activated in human neutrophils exposed to chemotactic peptide, is important for motile functions of these cells.  (+info)

Chemotactic, mitogenic, and angiogenic actions of UTP on vascular endothelial cells. (6/1836)

Endothelial cells express receptors for ATP and UTP, and both UTP and ATP elicit endothelial release of vasoactive compounds such as prostacyclin and nitric oxide; however, the distinction between purine and pyrimidine nucleotide signaling is not known. We hypothesized that UTP plays a more important role in endothelial mitogenesis and chemotaxis than does ATP and that UTP is angiogenic. In cultured endothelial cells from guinea pig cardiac vasculature (CEC), both UTP and vascular endothelial growth factor (VEGF) were significant mitogenic and chemotactic factors; in contrast, ATP demonstrated no significant chemotaxis in CEC. In chick chorioallantoic membranes (CAM), UTP and VEGF treatments produced statistically significant increases in CAM vascularity compared with controls. These findings are the first evidence of chemotactic or angiogenic effects of pyrimidines; they suggest a role for pyrimidine nucleotides that is distinct from those assumed by purine nucleotides and provide for the possibility that UTP serves as an extracellular signal for processes such as endothelial repair and angiogenesis.  (+info)

Deficiency of the hematopoietic cell-specific Rho family GTPase Rac2 is characterized by abnormalities in neutrophil function and host defense. (7/1836)

In mammals, the Rho family GTPase Rac2 is restricted in expression to hematopoietic cells, where it is coexpressed with Rac1. Rac2-deficient mice were created to define the physiological requirement for two near-identical Rac proteins in hematopoietic cells. rac2-/- neutrophils displayed significant defects in chemotaxis, in shear-dependent L-selectin-mediated capture on the endothelial substrate Glycam-1, and in both F-actin generation and p38 and, unexpectedly, p42/p44 MAP kinase activation induced by chemoattractants. Superoxide production by rac2-/- bone marrow neutrophils was significantly reduced compared to wild type, but it was normal in activated peritoneal exudate neutrophils. These defects were reflected in vivo by baseline neutrophilia, reduced inflammatory peritoneal exudate formation, and increased mortality when challenged with Aspergillus fumigatus. Rac2 is an essential regulator of multiple specialized neutrophil functions.  (+info)

A functional granulocyte colony-stimulating factor receptor is required for normal chemoattractant-induced neutrophil activation. (8/1836)

Granulocyte colony-stimulating factor (G-CSF) is a hematopoietic growth factor that is widely used to treat neutropenia. In addition to stimulating polymorphonuclear neutrophil (PMN) production, G-CSF may have significant effects on PMN function. Because G-CSF receptor (G-CSFR)-deficient mice do not have the expected neutrophilia after administration of human interleukin-8 (IL-8), we examined the effect of the loss of G-CSFR on IL-8-stimulated PMN function. Compared with wild-type PMNs, PMNs isolated from G-CSFR-deficient mice demonstrated markedly decreased chemotaxis to IL-8. PMN emigration into the skin of G-CSFR-deficient mice in response to IL-8 was also impaired. Significant chemotaxis defects were also seen in response to N-formyl-methionyl-leucyl-phenylalanine, zymosan-activated serum, or macrophage inflammatory protein-2. The defective chemotactic response to IL-8 does not appear to be due to impaired chemoattractant receptor function, as the number of IL-8 receptors and chemoattractant-induced calcium influx, actin polymerization, and release of gelatinase B were comparable to those of wild-type PMNs. Chemoattractant-induced adhesion of G-CSFR-deficient PMNs was significantly impaired, suggesting a defect in beta2-integrin activation. Collectively, these data demonstrate that selective defects in PMN activation are present in G-CSFR-deficient mice and indicate that G-CSF plays an important role in regulating PMN chemokine responsiveness.  (+info)

TY - JOUR. T1 - Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino-terminal sequence. AU - Teizo, Yoshimura. AU - Robinson, Elizabeth A.. AU - Appella, Ettore. AU - Matsushima, Kouji. AU - Showalter, Stephen D.. AU - Skeel, Alison. AU - Leonard, Edward J.. PY - 1989/1. Y1 - 1989/1. N2 - Human monocyte-derived neutrophil chemotactic factor (MDNCF) was purified from culture supernatant of lipopolysaccharide-stimulated human peripheral blood mononuclear leukocytes on a column of Sepharose-bound murine monoclonal anti-MDNCF. About 65% of the culture fluid chemotactic activity was bound to the column. The unbound 35% probably represents chemotactic activity of other cytokines in the culture fluid. More than 85% of the bound activity was eluted by pH 2.5 glycine buffer. When this material was applied to an HPLC-CM column, gradient elution produced four well-separated A280 peaks, each of which had chemotactic activity. N-terminal amino ...
Define macrophage chemotactic factor (MCF). macrophage chemotactic factor (MCF) synonyms, macrophage chemotactic factor (MCF) pronunciation, macrophage chemotactic factor (MCF) translation, English dictionary definition of macrophage chemotactic factor (MCF). n. Any of various large, phagocytic white blood cells that develop from monocytes, are found in the spleen, liver, and other tissues, and have a variety of...
Treatment of serum with 10 mg/ml of nanoparticle carbon black generated substances that induced a 1.8-fold increase in macrophage migration (P < 0.001) compared with untreated serum. This effect was partially inhibited by antioxidant intervention. Serum treated with an equivalent mass of fine carbon black did not display any chemotactic potential. tBHP treatment of the serum did not result in the generation of macrophage chemotactic factors ...
Inflammatory cytokines induce synthesis and secretion of gro protein and a neutrophil chemotactic factor but not beta 2-microglobulin in human synovial cells an
Primobolan side effects is a selective agonist of beta2-adrenergic receptors. At therapeutic doses it acts on beta2-adrenergic receptors of smooth muscles of the bronchi, providing pronounced bronchodilator effect, prevents and relieves bronchospasm, increases lung capacity. It prevents the release of histamine, slow reacting substances from mast cells and neutrophil chemotactic factors. It is a small …. Read more ...
Primobolan side effects is a selective agonist of beta2-adrenergic receptors. At therapeutic doses it acts on beta2-adrenergic receptors of smooth muscles of the bronchi, providing pronounced bronchodilator effect, prevents and relieves bronchospasm, increases lung capacity. It prevents the release of histamine, slow reacting substances from mast cells and neutrophil chemotactic factors. It is a small …. Read more ...
Shop Leukocyte cell-derived chemotaxin ELISA Kit, Recombinant Protein and Leukocyte cell-derived chemotaxin Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Lect2 - Lect2 (untagged) - Mouse leukocyte cell-derived chemotaxin 2 (Lect2), (10ug) available for purchase from OriGene - Your Gene Company.
1988 chev trans takes high rpm to shift from 1st to 2nd and some times it wont down shift when you slow down and - Chevrolet 1988 C1500 question
Kimball Medical Center News 2013, 2014. Barnabas Health delivers comprehensive healthcare services to the residents of New Jersey. Cancer, pediatrics, cardiac, and womens health treatments available.
TY - JOUR. T1 - Differential regulation of the expression of cytokine-induced neutrophil chemoattractant by mouse macrophages. AU - Crippen, Tawni L.. AU - Riches, David W H. AU - Hyde, Dallas M.. PY - 1998. Y1 - 1998. N2 - The production of cytokine-induced neutrophil chemoattractant (CINC) by functionally diverse mouse bone-marrow-derived macrophages was determined. Studies showed that β1,3-glucan, IL-1β, TNFα and IFNγ/TNFα induced expression and production of CINC in macrophages while neither IFNγ nor TGFβ alone induced detectable CINC expression. Pretreatment or simultaneous treatment of macrophages with TGFβ resulted in suppression of CINC protein production. These studies demonstrate that IFNγ and TNFα, found early during the inflammatory response, induce production of CINC, as well as induce macrophages into a cytocidal state that are capable of killing transformed cells, parasites and bacteria, and recruiting neutrophils. In contrast, TGFβ, found during reparative stages of ...
If you wish to reuse any or all of this article please use the link below which will take you to the Copyright Clearance Centers RightsLink service. You will be able to get a quick price and instant permission to reuse the content in many different ways.. ...
CP002355.PE262 Location/Qualifiers FT CDS_pept 251606..252700 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Sulku_0263 FT /product=methyl-accepting chemotaxis sensory transducer FT /note=COGs: COG0840 Methyl-accepting chemotaxis protein; FT InterPro IPR004090: IPR004089; KEGG: cla:Cla_1032 FT MCP-domain signal transduction protein; PFAM: chemotaxis FT sensory transducer; SMART: chemotaxis sensory transducer; FT SPTR: Methyl-accepting chemotaxis protein; PFAM: FT Methyl-accepting chemotaxis protein (MCP) signaling domain; FT Myosin-like coiled-coil protein FT /db_xref=EnsemblGenomes-Gn:Sulku_0263 FT /db_xref=EnsemblGenomes-Tr:ADR32930 FT /db_xref=GOA:E4TY17 FT /db_xref=InterPro:IPR004089 FT /db_xref=InterPro:IPR004090 FT /db_xref=InterPro:IPR025991 FT /db_xref=UniProtKB/TrEMBL:E4TY17 FT /protein_id=ADR32930.1 FT /translation=MGWFSDDTELKEELSVLQKENTALRDENQELARKLQECEAKIAKE FT DERHRCENASMIMTYQNEQLKKNLVDVQGNMASSVASSKENIAQSTALLENIVELGQKA FT ...
The presence of neutrophils in the synovial joint of patients with rheumatoid arthritis (RA) is thought to be due to the activity of chemotactic factors released by activated cells in the joint. We have shown in this report, for the first time, the abundance of one such factor, interleukin 8 (IL 8), in the synovial fluid of patients both with RA and other non-RA joint diseases, and the spontaneous production of IL 8 mRNA by RA synovial cells in culture. There was no correlation between the levels of chemotactic activity and IL 8 protein, suggesting that other factors with similar neutrophil chemotactic activity are also present in the synovial fluid exudate. In support of this concept neither the level of chemotactic activity nor IL 8 protein levels correlated with neutrophil or leukocyte infiltration, indicating that the mechanism of migration into the inflammatory environment of the joint is complex. Such migration is likely to be due to a number of chemotactic signals in addition to IL 8, which may
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Rat CXCL2/MIP-2 (macrophage inflammatory protein-2) is a 69-amino acid CXC chemokine. MIP-2 is induced during acute inflammation in rat models of disease. It is a potent neutrophil chemotactic factor both |i|in vitro|/i| and|i| in vivo|/i|.
The recruitment of mononuclear leukocytes, and the migration, growth and activation of macrophages, lymphocytes and smooth muscle cells within lesions, are critical features of the chronic inflammatory response that typifies atherogenesis. Chemokines are members of a superfamily of small polypeptides that mediate not only migration, but also growth and activation of leukocytes and a variety of other cells. Monocyte chemoattractant and activating protein-1 was the first chemokine to be implicated in leukocyte-mediated inflammation in atherosclerosis. This review emphasizes new information on the potential atherogenic roles of monocyte chemoattractant and activating protein-1 and several other closely related chemokines of the C-C subfamily. We focus particular attention on the newly recognized atherogenic role of a subgroup of closely related chemokines of the C-X-C subfamily that includes interleukin-8 and growth regulated oncogene alpha. We also discuss new studies that reveal how CD40 ligand ...
Bacterial lipopolysaccharides (LPS) derived from a variety of organisms effectively induced C consumption in humans, bovines, and porcines with developmental agammaglobulinemia; birds with experimental agammaglobulinemia; and humans with agammaglobulinemia syndromes. This interaction proceeded even in precolostral piglet sera which contained less than 2.5 x 10-6 mg/ml gamma globulin, and led to generation of neutrophil chemotactic factor and anaphylatoxin in these sera. Hence, the LPS-C interaction can proceed in sera markedly deficient in immunoglobulin. The question of whether immunoglobulins can be bypassed in the LPS-C interaction, or whether they are regularly utilized in a way so efficient that their participation is masked, was considered. ...
Methods Quiescent cultured RASMCs were pretreated with E2 or vehicle for 24 hours before tumor necrosis factor (TNF)-α was added. After 6 hours of treatment, total RNA was extracted from cells using TRIzol reagent, and SYBR green real-time RT-PCR was used to detect expression of CINC-2 mRNA. Conditioned media was collected and concentrated to measure CINC-2 protein level by ELISA. To assess neutrophil chemotactic activity of conditioned media, in vitro chemotaxis assays were performed using differentiated HL-60 cells in a 96-well modified Boyden chamber appropriate for the evaluation of leukocyte chemotaxis. The nonselective ER antagonist ICI-182780 was given to cells 2 hours prior to E2 incubation to study the mechanism of E2 effect. ...
PH-domain translocation with uniform stimulus. Kinetic analysis of the translocation from the cytoplasm to the plasma membrane of GFP-tagged CRAC (Cytosolic Regulator of Adenylyl Cyclase-a PH domain containing protein) in response to a uniform increase in chemoattractant concentration. Frames were taken every 2 seconds. The chemoattractant was added just before the cell goes out of focus. From C.A. Parent and P.N. Devreotes, Johns Hopkins Medical Institutions ...
During chemotaxis large eosinophils from newts exhibit a gradient of [Ca2+]i from rear to front. The direction of the gradient changes on relocation of the chemoattractant source, suggesting that the Ca2+ signal may trigger the cytoskeletal reorganization required for cell reorientation during chemotaxis. The initial stimulatory effect of chemoattractant on [Ca2+]i and the opposite orientations of the intracellular Ca2+ gradient and the external stimulus gradient suggest that more than one chemoattractant-sensitive messenger pathway may be responsible for the generation of spatially graded Ca2+ signals. To identify these messengers, Ca2+ changes were measured in single live cells stimulated with spatially uniform chemoattractant. On stimulation spatially averaged [Ca2+]i increased rapidly from | or = 100 nM to | or = 400 nM and was accompanied by formation of lamellipods. Subsequently cells flattened, polarized and crawled, and [Ca2+]i fluctuated around a mean value of approximately 200 nM. The initial
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
The mobilisation of leukocytes to inflammatory sites is crucial to host defense. Over the years a wealth of information has evolved concerning the mechanism of leukocyte locomotion and factors with...
DI-fusion, le Dépôt institutionnel numérique de lULB, est loutil de référencementde la production scientifique de lULB.Linterface de recherche DI-fusion permet de consulter les publications des chercheurs de lULB et les thèses qui y ont été défendues.
Affiliation:熊本大学,医学部,助手, Research Field:Experimental pathology, Keywords:Immunohistochemistry,組織分布,Chemotactic factor,Hageman factor,Dhemical mediator,アレルギー,血管透過因子,Kinetics,Delayed hypersensitivity,血管透過性亢進, # of Research Projects:1, # of Research Products:0
An apparatus and method of use for assaying cellular motility in response to a concentration gradient of a chemotactic agent. Generally, the apparatus includes a chamber having a region for receiving
Definition of Eosinophil Chemotactic Factor in the Financial Dictionary - by Free online English dictionary and encyclopedia. What is Eosinophil Chemotactic Factor? Meaning of Eosinophil Chemotactic Factor as a finance term. What does Eosinophil Chemotactic Factor mean in finance?
Looking for eosinophil chemotactic factor? Find out information about eosinophil chemotactic factor. A peptide released from mast cell granules that stimulates chemotaxis of eosinophils; may be responsible for accumulation of eosinophils at sites of... Explanation of eosinophil chemotactic factor
Im doing a project for my cell class (sorry if this is in the wrong forum--I couldnt find a homework forum) about the eosinophil chemotactic factor. I was wondering if someone could point me in the right direction for a few answers. My professor seemed to think everything could be found online and I dont doubt him, Im just getting conflicting answers. Heres what I have so far ...
Cultured rabbit aortic and human carotid artery endothelial cells produced a factor that was chemotactic for monocytes but not for neutrophils. Checkerboard analysis showed that the activity was due to chemotaxis and not to chemokinesis. The factor was produced in both serum-containing and serumless media. Treatment with carboxypeptidase and trypsin resulted in inhibition of chemotactic activity, indicating that the factor is a peptide. Medium from cultures of rabbit aortic, human carotid artery, and human umbilical vein endothelial cells previously exposed to beta migrating very low density lipoprotein (beta-VLDL) had substantially more chemotactic activity than medium from untreated cells or cells exposed to low density lipoprotein. beta-VLDL alone had no chemotactic activity. We conclude that large vessel endothelial cells produce a monocyte chemotactic factor that is increased after exposure of the cells to beta-VLDL. ...
TY - JOUR. T1 - Antigenic identification of chemotactic factor inactivator in normal human serum and bronchoalveolar lavage fluid. AU - Robbins, Richard A.. AU - Rasmussen, Julie K.. AU - Clayton, Marcia E.. AU - Gossman, Gail L.. AU - Kendall, Todd J.. AU - Rennard, Stephen I.. PY - 1987/9. Y1 - 1987/9. N2 - Several proteins have been described that can modulate the activity of the complement component C5a, a potent chemoattractant for neutrophils. One of these inhibitors has been termed chemotactic factor inactivator (CFI). We hypothesized that CFI was antigenically present in normal human serum and that antigenic levels would correlate with the ability of serum to inhibit C5a. To test this hypothesis, CFI was purified from normal human serum, antibodies to CFI were developed in rabbits, and these reagents were used to develop an enzyme-linked immunoadsorbent assay to measure CFI. Sera from 32 normal volunteers were assayed for CFI and found to contain 77 ± 29 μg/ml (range 17 to 137 μg/ml). ...
Four subjects with clinical histories of milk-induced asthma were studied (three allergic to cows milk; one to soya milk). In each instance, skin prick tests, RAST (IgE and IgG4), the basophil histamine release, and serum precipitins, using appropri
Studies in Dictyostelium have shown that the p110-related phosphatidylinositol-3-kinases PI3K1 and PI3K2 are required for proper development, pinocytosis chemotaxis, and chemoattractant-mediated activation of PKB. Insights into the mechanism by which PI3K regulates chemotaxis derive from studies on PKB in mammalian leukocytes and Dictyostelium cells. PKB activation requires its translocation to the plasma membrane by binding of its PH domain to PtdIns(3,4,5)P3 and PtdIns(3,4)P2 produced upon activation of PI3K, leading to PKB activation. In leukocytes and Dictyostelium cells, chemoattractants mediate PKB activation through a G-protein-coupled pathway that requires the activity of the respective PI3Ks. Chemoattractant stimulation of neutrophils and Dictyostelium cells results in a transient localization of a GFP fusion of the PH domains from the Dictyostelium and mammalian PKBs to the plasma membrane. When these cells are placed in a chemoattractant gradient, membrane localization of the ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Chemokines play the key role in initiating immune responses by regulating the attraction and homing of immune cells to the lymphoid and nonlymphoid tissues. CXCL14 is a chemokine that in tumors may act as chemoattractant for monocytes and dendritic cells (DC), which may modulate antitumor immune responses in certain cancers. In this study, we investigated the mechanisms of loss of CXCL14 in prostate cancer cells. Cell treatment with the demethylating agent 5-aza-2-deoxycytidine resulted in the recovery of CXCL14 mRNA and protein expression. Hypermethylated CpG island sequences encompassing the CXCL14 gene promoter were identified. The restoration of CXCL14 by 5-aza-2-deoxycytidine treatment had functional impact, based on the DC chemoattractant activity of conditioned medium from drug-treated cells. Conversely, CXCL14 removal from conditioned media by affinity chromatography abolished its chemotactic properties, confirming that functionally active CXCL14 was generated in prostate cancer cells by ...
We demonstrated that PRT-201 fragments elastin, a protein present in blood vessel walls. The fragmentation of elastin in the outside wall of the blood vessel is thought to inhibit formation of neointimal hyperplasia thereby reducing the risk of patency loss. Elastase causes localized fragmentation of elastin protein fibers present in blood vessel walls. The elastin fragments generated by elastase are chemoattractants for scar forming cells, meaning that the fragments attract these scar forming cells, inhibiting their migration to the lumen. The cells recognize the elastin fragments via receptors present on the cell surface that bind to specific elastin fragment sub-types. The importance of elastin fragments in vascular biology, including the response to vascular injury has been established in the scientific literature over three decades. Published academic studies conducted in animals provide evidence that fragmentation of elastin in the outer wall of the blood vessels from administration of ...
Chemerin is a leukocyte chemoattractant and adipokine with important immune and metabolic roles. Chemerin, secreted in an inactive form prochemerin, undergoes C-terminal proteolytic cleavage to generate active chemerin, a ligand for the chemokine-like receptor-1 (CMKLR1). We previously identified that adipocytes secrete and activate chemerin. Following treatment with the obesity-associated inflammatory mediator TNF alpha, unknown adipocyte mechanisms are altered resulting in an increased ratio of active to total chemerin production. Based on these findings we hypothesized adipocytes produce proteases capable of modifying chemerin and its ability to activate CMKRL1. 3T3-L1 adipocytes expressed mRNA of immunocyte and fibrinolytic proteases known to activate chemerin in vitro. Following treatment with a general protease inhibitor cocktail (PIC), the TNF alpha-stimulated increase in apparent active chemerin concentration in adipocyte media was amplified 10-fold, as measured by CMKLR1 activation. ...
If you are a society or association member and require assistance with obtaining online access instructions please contact our Journal Customer Services team ...
Human IL-16 (hIL-16) is a homotetrameric cytokine with chemotactic properties towards cells expressing the CD4 receptor. This chemotactic cytokine plays an important role in attracting cells of the immune system to the site where CD8+ T-cells were activated for example by a foreign antigen. In addition to the chemotactic activity, hIL-16 also induces expression of IL-2 receptor, increasing the responsiveness to IL-2 and therefore implying a role for specific expansion of the CD4+ T-cell population in an area of induced inflammation. In this report we describe the cloning, sequencing and the expression of feline IL-16 (fIL-16). At the nucleotide level, fIL-16 shows 84.6 and 84.5%, on the amino acid level 93 and 91.5% identity to the human and African green monkey (agm) IL-16, respectively. ...
购买GRO gamma山羊多克隆抗体(ab10367),GRO gamma抗体经WB,ELISA验证,可与人,小鼠,大鼠样本反应。产品出库一年都在质保范围内。中国现货速达。
Principal Investigator:SHOJI Shunsuke, Project Period (FY):1993 - 1995, Research Category:Grant-in-Aid for General Scientific Research (C), Research Field:Respiratory organ internal medicine
Reactivity: Chicken, Cow, Human and more. Compare 11 different LECT1 ELISA Kits & buy the right one directly at antibodies-online.com!
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP ...
小鼠GRO alpha ELISA试剂盒(CXCL1) ELISA试剂盒datasheet (ab100717).Abcam抗体、ELISA、激动剂拮抗剂、表观遗传试剂、蛋白多肽,使用效果保证,中国70%以上现货。
References for Abcams Recombinant human GRO alpha protein (ab73810). Please let us know if you have used this product in your publication
Dirofilaria immitis neutrophil chemotactic factor: aa sequence given in first source; isolated from the adult worm; GenBank D11438
The heterogeneity of the H460 large cell lung cancer cell line was investigated by selecting for chemokinetic cells from a CON population that demonstrated both chemokinesis and chemotaxis. Using Boyden chambers, cells that migrated under chemokinetic conditions were collected and their numbers expanded. Time-lapsed microscopy under isotropic conditions showed that KINE cells moved faster and changed directions more frequently than CON confirming their chemokinetic character. KINE cells which lacked stable focal adhesion were also less adhesive to culture plates compared to CON cells which had focal adhesions at the leading edge shown by phospho-Paxillin-tyr118 antibody labeling. Weak substrate adhesion in KINE cells may account for motile characteristics of rapid and random movement [16-19]. Furthermore, the selection for increased chemokinesis did not compromise the ability of KINE cells to chemotax. KINE cells were also significantly more invasive compared to CON.. These results underscore ...
Bachem offers H-4606 Interferon-Inducible T Cell α-Chemoattractant (human) for your research. Find all specific details here. Find product specific information including available pack sizes, CAS, detailed description and references here.
Combined influence of quartz dust, ozone and NO₂ on chemotactic mobility, release of chemotactic factors and other cytokines by macrophages in ...
TNF-α (tumor necrosis factor) is an endogenous pyrogen, able to induce fever, sepsis, cachexia, inflammation and it is implicated in many auto-immune diseases and is linked to cancer progression.. IL-8 (inteleukin-8) causes neutrophils and granulocyte to migrate toward the site of infection. IL-8 is also known to be a potent promoter of angiogenesis.. MCP-1 (monocyte chemotactic protine-1; CCL2) regulates migration and infiltration of monocytes/macrophages. It is implicated in pathogeneses of diseases such as atherosclerosis and neuroinflammatory diseases. Its also highly elevated in breast cancer cells.. RANTES (regulated and normal T cell expressed and secreted) plays an important role in allergic inflammatory processes, carcinogenesis, and are markedly elevated in primary tumor and metastatic lesions from patients with breast or cervical cancer. GROα (CXCL1) has neutrophil chemoattractant activity. It is involved in angiogenesis, inflammation, wound healing and tumorigenesis. ...
CCL5 is an 8kDa protein classified as a chemotactic cytokine or chemokine. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. With the help of particular cytokines (i.e., IL-2 and IFN-γ) that are released by T cells, CCL5 also induces the proliferation and activation of certain natural-killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells.[6] It is also an HIV-suppressive factor released from CD8+ T cells[citation needed]. This chemokine has been localized to chromosome 17 in humans.[5]. RANTES was first identified in a search for genes expressed late (3-5 days) after T cell activation. It was subsequently determined to be a CC chemokine and expressed in more than 100 human diseases. RANTES expression is regulated in T lymphocytes by Kruppel like factor 13 (KLF13).[7][8][9][10] RANTES, along with the related chemokines MIP-1alpha and MIP-1beta, has been identified as a natural HIV-suppressive ...
Bacterial chemotaxis, a remarkable behavioral trait which allows bacteria to sense and respond to chemical gradients in the environment, has implications in a broad range of fields including but not limited to disease pathogenesis, in-situ bioremediation and marine biogeochemistry. And therefore, studying bacterial chemotaxis is of significant importance to scientists and engineers alike. Microfluidics has revolutionized the way we study the motile behavior of cells by enabling observations at high spatial and temporal resolution in carefully controlled microenvironments. This thesis aims to explore the potential of microfluidic technology in studying bacterial behavior by investigating different aspects of bacterial chemotaxis on a microfluidic platform. We quantified population-scale transport parameters of bacteria using videomicroscopy and cell tracking in controlled chemoattractant gradients. Previously, transport parameters have been derived theoretically from single-cell swimming behavior ...
The interactions of tumorigenic cells with the extracellular matrix play a critical role in the establishment of metastases. Thrombospondin (TSP) is prominent at sites of tissue injury and promotes the attachment, spreading, and motility of several cell types. We have investigated the relationship between human carcinoma cell metastatic potential and TSP-mediated cell motility by comparing highly metastatic 11B carcinoma cells with a nonmetastatic counterpart, 22B carcinoma cells. 11B cells demonstrated motility in response to soluble TSP with a maximal effect observed at 1 µm TSP. Checkerboard analysis indicated that motility was directional with a significant chemokinetic component. Monoclonal antibody C6.7, specific for the distal COOH terminus of TSP, inhibited chemotaxis by 60%. Studies with TSP fragments demonstrated that the Mr 140,000 COOH-terminal domain (140K) supported chemotaxis to the same extent as intact TSP. The NH2-terminal heparin-binding domain was ineffective in stimulating ...
Abcams GRO alpha ELISA Kit suitable for Cell culture supernatant, Serum, Plasma in mouse. Reliably quantify 1 pg/ml of GRO alpha.
Synthetic peptide MMK-1 is a highly specific chemotactic agonist for leukocyte FPRL1.: Human phagocytic leukocytes express the seven-transmembrane G-protein-cou
Recruitment of macrophages to sites of cell death is critical for induction of an immunologic response. Calcium concentrations in extracellular fluids vary markedly, and are particularly high at sites of injury or infection. We hypothesized that extracellular calcium participates in modulating the i …
K 76 carboxylic acid: effective in blocking formation of chemotactic factor for tumor cells from human complement; oxidized product of sesquiterpene derivative K 76 from fungus Stachybotrys complementi; do not confuse with hydroxamic acid K-76
Define attractant: a substance (such as a pheromone) that attracts specific animals (such as insects or individuals of the opposite sex)
View Notes - Bio 201 F11 Lect 16 (True) v2r from BIO 201 at SUNY Stony Brook. BiologyintheNews[seefolderonBB] Whyaresomeplantspeciesverysuccessful atinvadingnewgeographicalareas(e.g. NorthAmericafromA
Monocytes: inhibit their migration response to chemotactic factors and release of pro-inflammatory mediators. Lymphocytes: ... complement components C5a and C3a which are chemotactic factors formed during the activation of the host's blood complement ... foreign organism-derived N-formylated oligopeptide chemotactic factors (e.g. N-formylmethionine-leucyl-phenylalanine); b) ... Barnig C, Levy BD (2015). "Innate immunity is a key factor for the resolution of inflammation in asthma". European Respiratory ...
The growth of these axons is also governed by chemotactic factors secreted from Schwann cells. Injury to the peripheral nervous ... All these factors contribute to the formation of what is known as a glial scar, which axons cannot grow across. The proximal ... Growth factors are not expressed or re-expressed; for instance, the extracellular matrix is lacking laminins. Glial scars ... Fansa H, Schneider W, Wolf G, Keilhoff G (July 2002). "Influence of insulin-like growth factor-I (IGF-I) on nerve autografts ...
After the release of vasoactive and chemotactic factors, angiogenesis and the proliferation of tenocytes are initiated. ... basic fibroblast growth factor (bFGF), and transforming growth factor beta (TGF-β). These growth factors all have different ... insulin-like growth factor 1 (IGF-I), platelet-derived growth factor (PDGF), vascular endothelial growth factor (VEGF), ... Tendinopathies may be caused by several intrinsic factors including age, body weight, and nutrition. The extrinsic factors are ...
... or pathogens such as chemotactic factors, cytokines, growth factors, and even certain eicosanoids. The activated cells then ... chemotactic factor for and activator of leukocytes; inflammation. studies to date shown no clear benefits of LTB4 receptor ... chemotactic factor for and activator of eosinophils. studies needed to determine if inhibiting its production or action ... cPLA2 may also release the lysophospholipid that becomes platelet-activating factor.[28] ...
Warheit D. B.; Hill L. H.; George G.; Brody A. R. (1986). "Time Course of chemotactic factor generation and the macrophage ... The cytokines, transforming growth factor beta and tumor necrosis factor alpha, appear to play major roles in the development ... local immune system and provoke an inflammatory reaction dominated by lung macrophages that respond to chemotactic factors ... "Transforming Growth Factor-β1 overexpression in Tumor Necrosis Factor-α receptor knockout mice induces fibroproliferative lung ...
Part of this cell response is brought on by inflammatory mediators such as chemotactic factors. Other processes involved with ... The primary risk factor for COPD globally is tobacco smoking.[9] Of those who smoke, about 20% will get COPD,[44] and of those ... The most common cause of COPD is tobacco smoking, with a smaller number of cases due to factors such as air pollution and ... Definition, epidemiology, and risk factors". BMJ. 332 (7550): 1142-4. doi:10.1136/bmj.332.7550.1142. PMC 1459603. PMID 16690673 ...
Part of this cell response is brought on by inflammatory mediators such as chemotactic factors. Other processes involved with ... Other genetic factors are being investigated, of which many are likely. A number of other factors are less closely linked to ... The primary risk factor for COPD globally is tobacco smoking. Of those who smoke, about 20% will get COPD, and of those who are ... Birth factors such as low birth weight may also play a role, as do a number of infectious diseases, including HIV/AIDS and ...
... tumor necrosis factor alpha, C-reactive protein, and monocyte chemotactic protein-1 all being found to be elevated in those ... However, it is also likely that this connection is also due in part to depression and inflammation sharing many risk factors ... Similar to their shared risk factors, social support has been found to reduce the risk of both depression and pro-inflammatory ... Although not as strong as a risk factor as social adversity, illness is often associated with depression. Compared to the ...
... factor VIII, fibrinogen, fibronectin, platelet-derived growth factor, and chemotactic agents. Delta granules, or dense bodies, ... fibroblast growth factor, insulin-like growth factor 1, platelet-derived epidermal growth factor, and vascular endothelial ... Platelets release platelet-derived growth factor (PDGF), a potent chemotactic agent; and TGF beta, which stimulates the ... Tissue factor also binds to factor VII in the blood, which initiates the intrinsic coagulation cascade to increase thrombin ...
... potent chemotactic factor, LTB4, and possibly also weaker chemotactic factor, 5S-HETE, which serve to attract and otherwise ... For example, chemotactic factors stimulate human neutrophils to raise cytosolic Ca2+ which triggers cPLA2s, particularly the α ... On the other hand, 5-oxo-ETrE is almost as potent as 5-oxo-ETE as an eosinophil chemotactic factor and may thereby contribute ... LTB4, 5-HETE, and 5-oxoETE may contribute to the innate immune response as leukocyte chemotactic factors, i.e. they recruit and ...
Platelets release a multitude of growth factors including platelet-derived growth factor (PDGF), a potent chemotactic agent, ... insulin-like growth factor 1, platelet-derived epidermal growth factor, and vascular endothelial growth factor. Local ... Other healing-associated growth factors produced by platelets include basic fibroblast growth factor, ... Both of these growth factors have been shown to play a significant role in the repair and regeneration of connective tissues. ...
... then the release of too many pro-inflammatory factors and a decrease in too many anti-inflammatory factors often result in a ... chemotactic/chemoattractant adipokines; and prostaglandins (eicosanoids). From an anti-inflammatory standpoint, fat tissue ... growth factor production; (6) glucose metabolism; (6) production of factors that affect blood pressure (such as those ... produces factors including: (1) adipokines with cytokine activity such as leptin, interleukins, and tumor necrosis factor alpha ...
Second, as inflammation nears completion, macrophage and mast cells release fibroblast growth and chemotactic factors to ... Overview of involved growth factorsEdit. Following are the main growth factors involved in wound healing: Growth factor. ... Factors affecting wound healingEdit. Many factors controlling the efficacy, speed, and manner of wound healing fall under two ... Macrophages also secrete a number of factors such as growth factors and other cytokines, especially during the third and fourth ...
The underlying idea that target cells secrete attractive or inducing factors and that their growth cones have a chemotactic ... An atrophic factor is a force that causes a cell to die. Only natural forces on the cell are considered to be atrophic factors ... Experiments that further supported this theory led to the identification of the first neurotrophic factor, nerve growth factor ... It has also been shown that in mice null for the proapoptotic factor Bax (Bcl-2-associated X protein) a larger percentage of ...
... for the Prostaglandin DP2 receptor which is more closely related in amino acid sequence and functionality to chemotactic factor ...
Initially thought to be a second and low affinity receptor for the neutrophil tripeptide chemotactic factor, N-formyl-met-leu- ... 12-HHT stimulates chemotactic responses in mouse bone marrow mast cells, which naturally express BLT2 receptors, as well as in ... 12-HHT was reported to inhibit the chemotaxis-blocking effect of a human monocyte-derived factor on human moncytes[16] while ... and mouse keratinocyte migration by a BLT2 receptor-dependent mechanism that involved the production of tumor necrosis factor α ...
Fujie T., Katoh S., Oura M., Urano Y., and Arase S. The chemotactic effect of a dermal papilla cell-derived factor on outer ... Ito C., Saitoh Y., Fujita Y., Yamazaki Y., Imamura T., Oka S. and Suzuki S. Decapeptide with fibroblast growth factor (FGF)-5 ... Shimaoka S., Imai R. and Ogawa H. Dermal papilla cells express hepatocyte growth factor. J Dermatol. Sci 7 suppl.: S79-83, 1994 ... Lachgar S., Charveron M., Gall Y., Bonafe J.L. Minoxidil upregulates the expression of vascular endothelial growth factor in ...
"Monocyte-derived neutrophil chemotactic factor (MDNCF/IL-8) resides in a gene cluster along with several other members of the ... 2000). "Permissive factors for HIV-1 infection of macrophages". J. Leukoc. Biol. 68 (3): 303-10. PMID 10985244. CS1 održavanje ... "Nuclear factor-kappaB-dependent induction of interleukin-8 gene expression by tumor necrosis factor alpha: evidence for an ... Baggiolini M, Clark-Lewis I (1992). "Interleukin-8, a chemotactic and inflammatory cytokine". FEBS Lett. 307 (1): 97-101. PMID ...
... including eosinophil chemotactic factor of anaphylaxis, leukotriene B4 and serotonin mediated release of eosinophil granules ... The location of the causal factor can be used to classify eosinophilia into two general types: extrinsic, in which the factor ... with a translocation between chromosomes 5 and 14 or alterations in the genes which encode platelet-derived growth factor ...
Suppression of IL-1 & TNF-alpha, induce apoptosis of inflammatory cells and increase chemotactic factors. csDMARD. ... Furthermore, should DMARDs fail, tocilizumab can be used for tumor necrosis factor (TNF) inhibitor treatments in NICE guidance. ... raised rheumatoid factor level and more recently, a raised C-reactive protein level.[citation needed] More recently, the term ...
... may refer to: Corticotropin-releasing factor family, a family of related neuropeptides in vertebrates Corticotropin- ... the difference between the radiation budget components for average cloud conditions and cloud-free conditions Chemotactic range ... Capital recovery factor, a financial concept Consolidated Revenue Fund, the main government bank account in many Commonwealth ... a type of graphical model Constant Rate Factor, used by many video encoders such as x264, x265, and VP9 Cardiorespiratory ...
Because both naive T cells and dendritic cells express CCR7, they are drawn into the paracortex by the same chemotactic factors ... also allows exchange of material with blood through the high endothelial venules and provides the growth and regulatory factors ...
Suzuki J, Yamazaki Y, Li G, Kaziro Y, Koide H, Guang L (Jul 2000). "Involvement of Ras and Ral in chemotactic migration of ... "Activation of phospholipase D1 by direct interaction with ADP-ribosylation factor 1 and RalA". FEBS Letters. 430 (3): 231-5. ... "Activation of phospholipase D1 by direct interaction with ADP-ribosylation factor 1 and RalA". FEBS Letters. 430 (3): 231-5. ... a pleckstrin homology domain containing guanine nucleotide exchange factor for Ral". The Journal of Biological Chemistry. 275 ( ...
DP2, is related to members of the chemotactic factor class of GPCRs, sharing an amino acid sequence identity of 29% with the ...
It has chemotactic properties for monocytes and eosinophils and is expressed by macrophages, basophils and some tissue cells. ... Menten P, Wuyts A, Van Damme J (December 2002). "Macrophage inflammatory protein-1". Cytokine & Growth Factor Reviews. 13 (6): ... Macrophage Inflammatory Proteins (MIP) belong to the family of chemotactic cytokines known as chemokines. In humans, there are ... MIP-1 are best known for their chemotactic and proinflammatory effects but can also promote homeostasis. Biophysical analyses ...
... and they have direct chemotactic effects on tissue remodeling. ... growth factors and as "promiscuous" growth factors due to their ... Wikimedia Commons has media related to Fibroblast growth factors (FGF).. *Fibroblast+Growth+Factors at the US National Library ... FGF1 and FGF2 are more potent angiogenic factors than vascular endothelial growth factor (VEGF) or platelet-derived growth ... FGF1 is also known as acidic fibroblast growth factor, and FGF2 is also known as basic fibroblast growth factor. ...
... monocyte chemotactic protein-1 may also be involved. Signalling via the receptor-activated Nuclear factor kB or receptor- ... A growth factor, colony-stimulating factor 1, produced by the dental follicle, encourages the differentiation of monocytes into ... The initiation of differentiation is controlled by a number of different extracellular factors, such as growth factors, cell- ... A high level of transcription factor Runt-related transcription factor- 2, that is involved in osteoblast differentiation and ...
... is an 8kDa protein classified as a chemotactic cytokine or chemokine. CCL5 is chemotactic for T cells, eosinophils, and ... cellular response to fibroblast growth factor stimulus. • neutrophil chemotaxis. • response to tumor necrosis factor. • ... RANTES expression is regulated in T lymphocytes by Kruppel like factor 13 (KLF13).[7][8][9][10] RANTES, along with the related ... cellular response to tumor necrosis factor. • positive regulation of activation of Janus kinase activity. • regulation of ...
Both cell types produce IFN-γ as their principle cytokine and require the transcription factor T-bet to do so. Both cells can ... NK cells express many cell-surface receptors that can be activating, inhibitory, adhesion, cytokine, or chemotactic. The ... It does this via reducing activity of E-box transcription factors (E2A, E2-2, and HEB), critical in B and T cell development. ... The development of ILCs is initiated in response to the presence of transcription factors that are switched on due to the ...
Removal of plaque retentive factors: Local plaque retentive factors such as mal-positioned teeth, overhanging restorations, ... An impaired ability of peripheral blood lymphocytes to react to chemotactic stimuli is found in the majority of patients ... Virulence factors are the attributes of microorganisms that enable it to colonise a particular niche in its host, overcome the ... Many studies have shown that genetic factors contribute to the pathogenesis of this disease.[21] In this case, the ...
Chemical factors produced during inflammation attract phagocytes, especially neutrophils.[5] Neutrophils then trigger other ... and chemotactic cytokines into the environment. Histamine dilates blood vessels, causing the signs of inflammation, and ... Inflammation is stimulated by chemical factors released by injured cells. It sets up a physical barrier against the spread of ...
... where they induce IFN production with the presence of a particular transcription factor and activate transcription factor 2. ... or chemotactic cytokines into the environment. Histamine dilates blood vessels, causing the characteristic signs of ... Chemical factors produced during inflammation (histamine, bradykinin, serotonin, leukotrienes, and prostaglandins) sensitize ... Inflammation is stimulated by chemical factors released by injured cells and serves to establish a physical barrier against the ...
Enhanced expression of elongation factor EF-1 alpha". J. Biol. Chem. 263 (8): 3546-9. PMID 3346208.. CS1 одржавање: Експлицитна ... 3 and 5 affect their anti-HIV-1 activity and chemotactic potencies for neutrophils and eosinophils". Eur. J. Immunol. 31 (7): ... 1990). „Retropseudogenes constitute the major part of the human elongation factor 1 alpha gene family". Nucleic Acids Res. 18 ( ... 1989). „Murine elongation factor 1 alpha (EF-1 alpha) is posttranslationally modified by novel amide-linked ethanolamine- ...
Granule contents of basophils are abundant with histamine, heparin, chondroitin sulfate, peroxidase, platelet-activating factor ... There is usually a granulocyte chemotactic defect in individuals suffering from insulin-dependent diabetes mellitus. ... vascular endothelial growth factor (VEGF), TNF, prostaglandins, leukotrienes, and varieties of chemokines and cytokines some of ...
... potent chemotactic factor, LTB4, and possibly also weaker chemotactic factor, 5S-HETE, which serve to attract and otherwise ... For example, chemotactic factors stimulate human neutrophils to raise cytosolic Ca2+ which triggers cPLA2s, particularly the α ... On the other hand, 5-oxo-ETrE is almost as potent as 5-oxo-ETE as an eosinophil chemotactic factor and may thereby contribute ... LTB4, 5-HETE, and 5-oxoETE may contribute to the innate immune response as leukocyte chemotactic factors, i.e. they recruit and ...
Their name is derived from their ability to induce directed chemotaxis in nearby responsive cells; they are chemotactic cyto ... Platelet factor-4 superfamily or intercrines. Some chemokines are considered pro-inflammatory and can be induced during an ... "Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells". Science ...
The factors that dictate whether an infection triggers a Th1 or Th2 type response are not fully understood, but the response ... via chemotactic signals, to the T cell-enriched lymph nodes. During migration, dendritic cells undergo a process of maturation ... Over the last century, two important factors have been developed to combat their spread: sanitation and immunization.[5] ... The system is highly adaptable because of two factors. First, somatic hypermutation is a process of accelerated random genetic ...
... its production appears necessary for epidermal growth factor and tumor growth factor α to stimulate cultured BT-20 human breast ... Henricks, P. A; Engels, F; Van Der Vliet, H; Nijkamp, F. P (1991). "9- and 13-hydroxy-linoleic acid possess chemotactic ... Further studies suggest that 13(S)-HODE contributes to plaque formation by activating the transcription factor, PPARγ (13(R)- ... and increases the proliferation response of prostate cancer cells to epidermal growth factor and insulin-like growth factor 1 ...
transcription factor activity, sequence-specific DNA binding. • transcription coactivator activity. • zinc ion binding. • ... negative regulation of monocyte chemotactic protein-1 production. • positive regulation of glucose import in response to ... transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding. • chenodeoxycholic acid binding. • ... RNA polymerase II transcription factor activity, sequence-specific DNA binding. Cellular component. • nuclear euchromatin. • ...
After the release of vasoactive and chemotactic factors, angiogenesis and the proliferation of tenocytes are initiated. ... basic fibroblast growth factor (bFGF), and transforming growth factor beta (TGF-β).[35] These growth factors all have different ... insulin-like growth factor 1 (IGF-I), platelet-derived growth factor (PDGF), vascular endothelial growth factor (VEGF), ... Tendinopathies may be caused by several intrinsic factors including age, body weight, and nutrition. The extrinsic factors are ...
In the alternative pathway, C3b binds to Factor B. Factor D releases Factor Ba from Factor B bound to C3b. The complex of C3b(2 ... C5a is an important chemotactic protein, helping recruit inflammatory cells. C3a is the precursor of an important cytokine ( ... complement factor B, and complement factor I, as well as deletion of complement factor H-related 3 and complement factor H- ... The surface-bound C3b may now bind factor B to form C3bB. This complex in the presence of factor D will be cleaved into Ba and ...
Chemotactic properties: The large surface area available on collagen fibers can attract fibrogenic cells which help in healing. ... Many bacteria and viruses secrete virulence factors, such as the enzyme collagenase, which destroys collagen or interferes with ... Structure factors determination, evaluation of Isomorphous Replacement methods and other modeling. PhD Thesis, Université ...
Characterization of synthetic human granulocyte chemotactic protein 2: usage of chemokine receptors CXCR1 and CXCR2 and in vivo ... Human and bovine granulocyte chemotactic protein-2: complete amino acid sequence and functional characterization as chemokines ...
CXCL8 (IL-8) forms a chemotactic gradient that directs leukocytes towards site of tissue injury/infection (CCL2 has a similar ... This is assisted through juxtacrine activation of integrins by chemokines and soluble factors released by endothelial cells. In ... Once in the interstitial fluid, leukocytes migrate along a chemotactic gradient towards the site of injury or infection. ... Intracellular integrin domains associate with the leukocyte cytoskeleton, via mediation with cytosolic factors such as talin, α ...
Other chemotactic signals such as formyl Met-Leu-Phe (fMLF) may also guide spermatozoa.[26] ... and chemotactic gradients of progesterone have been confirmed as the signal emanating from the cumulus oophorus cells ... "Evidence for the presence of specific receptors for N-formyl chemotactic peptides on human spermatozoa". J Clin Endocrinol ...
Un factor atrófico é unha factor natural que causa que unha célula morra. Son factores atróficos comúns:[17] ... Constantino, Sotelo (2002). "The chemotactic hypothesis of Cajal: a century behind". Progress in Brain Research 136: 11-20. doi ... á identificación do primeiro factor neurotrófico, o factor de crecemento dos nervios (NGF).[29] ... Cowan, WN (2001). "Viktor Hamburger and Rita Levi-Montalcini: the path to the discovery of nerve growth factor". Annual Review ...
... is chemotactic for activated T cells. Its gene is located on human chromosome 4 along with many other members of the CXC ...
... macrophage chemotactic factor (MCF) synonyms, macrophage chemotactic factor (MCF) pronunciation, macrophage chemotactic factor ... English dictionary definition of macrophage chemotactic factor (MCF). n. Any of various large, phagocytic white blood cells ... Related to macrophage chemotactic factor (MCF): neutrophil chemotactic factor mac·ro·phage. (măk′rə-fāj′). n.. Any of various ... Macrophage chemotactic factor (MCF) - definition of macrophage chemotactic factor (MCF) by The Free Dictionary https://www. ...
Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino-terminal ... Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino-terminal ... Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino-terminal ... title = "Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino- ...
tBHP treatment of the serum did not result in the generation of macrophage chemotactic factors. Conclusions: High doses of ... in the form of tBHP are not adequate to generate chemotactic factors in serum. ... nanoparticle carbon black have the capacity to cause chemotactic factor generation in serum, by a mechanism involving ROS ... To assess whether fine and ultrafine particles (nanoparticles) have the capacity to activate factors in serum that would induce ...
It prevents the release of histamine, slow reacting substances from mast cells and neutrophil chemotactic factors. It is a ...
Chemotactic Factors. Cytotaxins liberated from normal or invading cells that specifically attract macrophages. They may be ...
Over the years a wealth of information has evolved concerning the mechanism of leukocyte locomotion and factors with... ... Van Epps, D.E., Potter, J.W. and Durant, D.A. (1983). Production of a human T-lymphocyte chemotactic factor by T-cell ... Isolation of lymphocyte chemotactic factors from PPD-induced delayed hypersensitivity skin reaction site in the guinea pig, ... 1982). A human lymphocyte chemotactic factor produced by the mixed lymphocyte reaction. J. Lab. Clin. Med., 100, 558-565.Google ...
Eosinophil chemotactic factor of anaphylaxis definition at Dictionary.com, a free online dictionary with pronunciation, ... eosinophil chemotactic factor of anaphylaxis in Medicine Expand. eosinophil chemotactic factor of anaphylaxis n. Abbr. ECF-A A ...
... chemotactic factor(s) (alveolar macrophage-derived chemotactic factor[s] [AMCF]) with relatively more activity for neutrophils ... Checker-board analysis of the AMCF revealed that the factor was primarily chemotactic and not chemokinetic for neutrophils. The ... Human Alveolar Macrophage-derived Chemotactic Factor for Neutrophils: STIMULI AND PARTIAL CHARACTERIZATION. ... Human Alveolar Macrophage-derived Chemotactic Factor for Neutrophils: STIMULI AND PARTIAL CHARACTERIZATION. ...
Molecular cloning of a novel receptor (CMKLR1) with homology to the chemotactic factor receptors.. Gantz I1, Konda Y, Yang YK, ...
The enhanced PMN response resulting from exposure to chemotactic factor was observed with several chemotactic stimuli, ... Exposure of human polymorphonuclear leukocytes (PMN) to chemotactic factor, as well as the migration of PMN through a 5-μm pore ... Enhancement of Neutrophil Function as a Result of Prior Exposure to Chemotactic Factor. ... Enhancement of Neutrophil Function as a Result of Prior Exposure to Chemotactic Factor. ...
eosinophil chemotactic factor help. Discussion of all aspects of cellular structure, physiology and communication. ... about the eosinophil chemotactic factor. I was wondering if someone could point me in the right direction for a few answers. My ... 1. Name of signal (I assume this is obvious: Eosinophil chemotactic peptide). 2. Type of signal (peptide?). 3. Mode of signal ...
Dirofilaria immitis neutrophil chemotactic factor: aa sequence given in first source; isolated from the adult worm; GenBank ... Dirofilaria immitis neutrophil chemotactic factor. Subscribe to New Research on Dirofilaria immitis neutrophil chemotactic ...
eosinophil chemotactic factor help. Discussion of all aspects of cellular structure, physiology and communication. ... eosinophil chemotactic factor help. by relamberth » Tue Dec 01, 2009 11:23 pm ... about the eosinophil chemotactic factor. I was wondering if someone could point me in the right direction for a few answers. My ... 1. Name of signal (I assume this is obvious: Eosinophil chemotactic peptide). 2. Type of signal (peptide?). 3. Mode of signal ...
What is Eosinophil Chemotactic Factor? Meaning of Eosinophil Chemotactic Factor as a finance term. What does Eosinophil ... Definition of Eosinophil Chemotactic Factor in the Financial Dictionary - by Free online English dictionary and encyclopedia. ... Related to Eosinophil Chemotactic Factor: neutrophil chemotactic factor, eosinophil chemotactic factor of anaphylaxis ... factor. (redirected from Eosinophil Chemotactic Factor). Also found in: Dictionary, Thesaurus, Medical, Legal, Acronyms, ...
annotations (the reliablity of the annotated protein expression using immunohistochemically (IH) stained on human tissues, the reliablity of the annotated protein expression in immunofluorescently (IF) stained human cell lines, tissue specificity (the distribution of antibody staining or protein expression in human cell types), cell line specificity (the distribution of RNA abundance in cell lines) and subcellular location (based on immunofluorescent staining of cell lines ...
Human endothelial cells produced a neutrophil chemotactic factor (NCF) upon stimulation with tumor necrosis factor-alpha (TNF- ... Endothelial cell gene expression of a neutrophil chemotactic factor by TNF-alpha, LPS, and IL-1 beta ... Endothelial cell gene expression of a neutrophil chemotactic factor by TNF-alpha, LPS, and IL-1 beta ... Endothelial cell gene expression of a neutrophil chemotactic factor by TNF-alpha, LPS, and IL-1 beta ...
Monocyte chemotactic factor produced by large vessel endothelial cells in vitro.. J A Berliner, M Territo, L Almada, A Carter, ... Monocyte chemotactic factor produced by large vessel endothelial cells in vitro.. J A Berliner, M Territo, L Almada, A Carter, ... Monocyte chemotactic factor produced by large vessel endothelial cells in vitro.. J A Berliner, M Territo, L Almada, A Carter, ... Cultured rabbit aortic and human carotid artery endothelial cells produced a factor that was chemotactic for monocytes but not ...
If you wish to reuse any or all of this article please use the link below which will take you to the Copyright Clearance Centers RightsLink service. You will be able to get a quick price and instant permission to reuse the content in many different ways.. ...
You need to be signed in to access email alerts. If you have an account log in with your user name and password. If you dont have an account you can just enter your email address in the email box below ...
... chemotactic and oxidative responses to the chemotactic factor formylmethionyl-leucyl-phenylalanine (fMet-Leu-Phe). Evidence was ... Chemotactic Factor-Induced Recruitment and Activation of Tec Family Kinases in Human Neutrophils. II. Effects of LFM-A13, a ... Chemotactic Factor-Induced Recruitment and Activation of Tec Family Kinases in Human Neutrophils. II. Effects of LFM-A13, a ... Chemotactic Factor-Induced Recruitment and Activation of Tec Family Kinases in Human Neutrophils. II. Effects of LFM-A13, a ...
IL-1 alpha or tumor necrosis factor-alpha stimulate release of three NAP-1/IL-8-related neutrophil chemotactic proteins in ... IL-1 alpha or tumor necrosis factor-alpha stimulate release of three NAP-1/IL-8-related neutrophil chemotactic proteins in ... IL-1 alpha or tumor necrosis factor-alpha stimulate release of three NAP-1/IL-8-related neutrophil chemotactic proteins in ... IL-1 alpha or tumor necrosis factor-alpha stimulate release of three NAP-1/IL-8-related neutrophil chemotactic proteins in ...
BRAK/CXCL14 Is a Potent Inhibitor of Angiogenesis and a Chemotactic Factor for Immature Dendritic Cells. Thomas D. ... BRAK/CXCL14 Is a Potent Inhibitor of Angiogenesis and a Chemotactic Factor for Immature Dendritic Cells ... BRAK/CXCL14 Is a Potent Inhibitor of Angiogenesis and a Chemotactic Factor for Immature Dendritic Cells ... BRAK/CXCL14 Is a Potent Inhibitor of Angiogenesis and a Chemotactic Factor for Immature Dendritic Cells ...
The preincubation of rabbit neutrophils with the chemotactic factor F-Met-Leu-Phe and the subsequent addition of cytochalasin B ... Chemotactic Factors / pharmacology*. Cytochalasin B / pharmacology*. Lysosomes / enzymology. Muramidase / secretion. ... The chemotactic factors induced movement of calcium and sodium across rabbit neutrophil membranes: effect of densensitization ... 0/Chemotactic Factors; 14930-96-2/Cytochalasin B; 7440-23-5/Sodium; 7440-70-2/Calcium; EC 3.2.1.17/Muramidase ...
... of the chemotactic activity could be recovered in the aqueous phase. This indicates that the major chemotactic factor in these ... Chemotactic factors. To determine whether the chemotactic activity in Lyme disease synovial fluids could be attributed to C5a, ... Chemotactic factors in Lyme disease synovial fluid. A, Effect of immunoadsorption with antibody to C5a on the chemotactic ... Neutrophil chemotactic factors in synovial fluids of patients with lyme disease.. код для вставки. код для вставки на сайт или ...
Stimulation of human neutrophil leukocyte aerobic glucose metabolism by purified chemotactic factors. J Clin Invest. 1974 Feb; ... Stimulation of human neutrophil leukocyte aerobic glucose metabolism by purified chemotactic factors. ... Stimulation of human neutrophil leukocyte aerobic glucose metabolism by purified chemotactic factors. ...
... growth factors, and cytokines, resulting in an increased ability to respond to a variety of chemotactic factors. ... growth factors, and cytokines, resulting in an increased ability to respond to a variety of chemotactic factors. ... Abca1−/− macrophages also exhibit a greater ability to respond to a variety of chemotactic factors. The results from these ... Increased Cholesterol Deposition, Expression of Scavenger Receptors, and Response to Chemotactic Factors in Abca1-Deficient ...
... ... platelet-derived growth factor, granulocyte colony-stimulating factor (G-CSF), or fibroblast growth factor 2 (FGF-2) on the ... Although many chemotactic factors have been investigated for different mesenchymal stem cells, their effect on SCAP migration ... G-CSF appears to be well suited to be further investigated as a key chemotactic factor in cell homing-based regenerative ...
Generation of a factor chemotactic for polymorphonuclear leukocytes ... Chemotactic factor to polymorphonuclear leukocytes in the human lens 6. chemotactic factor in low molecular weight fractions. ... "Endotoxoids" deficient in complement-firing activity were also deficient in chemotactic factor generation. Chemotactic factor ... The relationship of the chemotactic behavior of the complement-derived factors, C3a, C5a, and C567, and a bacterial chemotactic ...
... alveolar macrophage-derived chemotactic factor for airway epithelial cells.However, the significant chemotactic activity has ... 1)Bronchial epithelial cells release fibronectin as a chemotactic factor for mast cells.. We cultured bovine bronchial ... The chemotactic activity was then purified by three serial column chromatographies using HPLC,and finally identified as bovine ... The supernatant had significantly more chemotactic activity for the rat basophilic leukemia(RBL-2H3) cells and rat peritoneal ...
Neutrophil chemotactic factors in the tears of giant papillary conjunctivitis patients. S A Elgebaly; P C Donshik; F Rahhal; W ... Neutrophil chemotactic factors in the tears of giant papillary conjunctivitis patients. You will receive an email whenever this ... S A Elgebaly, P C Donshik, F Rahhal, W Williams; Neutrophil chemotactic factors in the tears of giant papillary conjunctivitis ... This study was designed to determine the presence of neutrophil chemotactic factors in the tears of patients with giant ...
... chemotactic factors, and adhesion molecules. One key element is the in vivo movement of T cells that express LFA-1 into the ... and adds recent results dealing with coordinate regulation at the gene-transcriptional level of keratinocyte chemotactic factor ... The role of adhesion molecules, chemotactic factors, and cytokines in inflammatory and neoplastic skin disease--1990 update.. @ ... article{Nickoloff1990TheRO, title={The role of adhesion molecules, chemotactic factors, and cytokines in inflammatory and ...
Find out information about eosinophil chemotactic factor. A peptide released from mast cell granules that stimulates chemotaxis ... Related to eosinophil chemotactic factor: neutrophil chemotactic factor, eosinophil chemotactic factor of anaphylaxis ... Eosinophil chemotactic factor , Article about eosinophil chemotactic factor by The Free Dictionary https://encyclopedia2. ... a href=https://encyclopedia2.thefreedictionary.com/eosinophil+chemotactic+factor,eosinophil chemotactic factor,/a,. *Facebook ...
Chemotactic migration and lysosomal enzyme release elicited by chemotactic factors were inhibited by pertussis toxin with a ... D W Goldman, F H Chang, L A Gifford, E J Goetzl, H R Bourne; Pertussis toxin inhibition of chemotactic factor-induced calcium ... Chemotactic factors stimulate a rapid increase in the cytosolic concentration of intracellular calcium ions ([Ca2+]in) in human ... Pertussis toxin inhibition of chemotactic factor-induced calcium mobilization and function in human polymorphonuclear ...
  • Human monocyte-derived neutrophil chemotactic factor (MDNCF) was purified from culture supernatant of lipopolysaccharide-stimulated human peripheral blood mononuclear leukocytes on a column of Sepharose-bound murine monoclonal anti-MDNCF. (elsevier.com)
  • To assess whether fine and ultrafine particles (nanoparticles) have the capacity to activate factors in serum that would induce macrophage migration. (napier.ac.uk)
  • tBHP treatment of the serum did not result in the generation of macrophage chemotactic factors. (napier.ac.uk)
  • Serum treated with an equivalent mass of fine carbon black did not display any chemotactic potential. (napier.ac.uk)
  • High doses of nanoparticle carbon black have the capacity to cause chemotactic factor generation in serum, by a mechanism involving ROS generation, although ROS alone, in the form of tBHP are not adequate to generate chemotactic factors in serum. (napier.ac.uk)
  • The unbound 35% probably represents chemotactic activity of other cytokines in the culture fluid. (elsevier.com)
  • About 65% of the culture fluid chemotactic activity was bound to the column. (elsevier.com)
  • When this material was applied to an HPLC-CM column, gradient elution produced four well-separated A 280 peaks, each of which had chemotactic activity. (elsevier.com)
  • The majority of research in this area has centred on the chemotactic response of neutrophils (PMN) and to a lesser extent on the response of monocytes and macrophages. (springer.com)
  • Activation of human neutrophils with 1-0-hexadecyl/octadecyl-2-acetyl-Sn-glyceryl-3-phosphorylcholine (platelet activating factor). (springer.com)
  • To evaluate the potential role of alveolar macrophages in modulating the migration of neutrophils to the lung, normal human alveolar macrophages obtained from volunteers by bronchopulmonary lavage, were exposed for various periods of time in vitro to heat-killed microorganisms, and noninfectious particulates, immune complexes, and the macrophage supernates were evaluated for chemotactic activity. (jci.org)
  • After incubation with each of these stimuli, alveolar macrophages released low molecular weight (400-600) chemotactic factor(s) (alveolar macrophage-derived chemotactic factor[s] [AMCF]) with relatively more activity for neutrophils than monocytes or eosinophils. (jci.org)
  • Checker-board analysis of the AMCF revealed that the factor was primarily chemotactic and not chemokinetic for neutrophils. (jci.org)
  • These studies suggest that a wide variety of potentially pathogenic stimuli induce normal alveolar macrophages to generate a low molecular weight chemotactic factor(s) that preferentially attracts neutrophils. (jci.org)
  • Cultured rabbit aortic and human carotid artery endothelial cells produced a factor that was chemotactic for monocytes but not for neutrophils. (ahajournals.org)
  • Chemotactic Factor-Induced Recruitment and Activation of Tec Family Kinases in Human Neutrophils. (jimmunol.org)
  • Tyrosine phosphorylation events play major roles in the initiation and regulation of several functional responses of human neutrophils stimulated by chemotactic factors such as the bacterially derived tripeptide formylmethionyl-leucyl-phenylalanine (fMet-Leu-Phe). (jimmunol.org)
  • The activation of the human polymorphonuclear neutrophils by the vast majority of the agents inducing its directed migration to sites of injury or infection (chemotactic factors and chemokines) is mediated by their interaction with G protein-coupled receptors (GPCRs) 3 ( 1 ). (jimmunol.org)
  • Of particular relevance to the subject of the present investigation, stimulation of human neutrophils by chemotactic factors has very recently been observed to be associated with the translocation and activation of the PH domain-containing tyrosine kinases of the Tec family termed Tec, Btk and Bmx ( 16 ). (jimmunol.org)
  • All purified cytokine preparations were found to be chemotactic for human neutrophils. (jimmunol.org)
  • The preincubation of rabbit neutrophils with the chemotactic factor F-Met-Leu-Phe and the subsequent addition of cytochalasin B has previously been shown to induce a time, concentration and calcium dependent loss of secretory responsiveness in neutrophils. (biomedsearch.com)
  • In addition, these results provide information about the sequence of events involved in the cytochalasin B and chemotactic factor induced release of lysosomal enzymes in neutrophils. (biomedsearch.com)
  • The smoke extract contained culture supernatant contained significantly more chemotactic activity for human peripheral blood-derived neutrophils compared with the supernatant without smoke extract. (nii.ac.jp)
  • Cytokines, such as granulocyte macrophage-colony stimulating factor (GM-CSF) and interleukin (IL)-8 attract neutrophils into inflammatory sites. (mdc-berlin.de)
  • After the LPS injection, changes in the concentration of CINC/gro, chemotactic activity, and the number of neutrophils in the air pouch exudate were determined. (core.ac.uk)
  • The chemotactic activity of neutrophils was augmented before practical neutrophil infiltration. (core.ac.uk)
  • KAY, A B . / CHEMOTACTIC FACTOR-INDUCED LOW-DENSITY NEUTROPHILS EXPRESS ENHANCED COMPLEMENT (CR-1 AND CR3) RECEPTORS AND INCREASED COMPLEMENT-DEPENDENT CYTOTOXICITY . (elsevier.com)
  • Neutrophils are first in infiltrating infection sites and could act either favoring or protecting against infection, depending on factors such as the genetic background of the host or the parasite species. (frontiersin.org)
  • IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. (abcam.com)
  • and factors released from dead neutrophils in the exudate. (brainscape.com)
  • To test the effect of the chicken soup, the researchers separated the chemotactic factors and neutrophils in a lab. (webmd.com)
  • After mixing the soup with the neutrophils, they checked to see whether it stopped the cells' tendency to move toward the chemotactic factors. (webmd.com)
  • In 2004, Brinkmann and colleagues reported that neutrophils can release nuclear chromatin together with granule proteins to form an extracellular mesh that binds and kills bacteria while also degrading virulence factors ( 2 ). (frontiersin.org)
  • PF4 is chemotactic for neutrophils, fibroblasts and monocytes, and interacts with a splice variant of the chemokine receptor CXCR3, known as CXCR3B. (wikipedia.org)
  • Monocyte chemotactic peptide receptor: Functional characteristics and ligand-induced regulation. (springer.com)
  • A peptide chemotactic for eosinophils and released from disrupted mast cells. (dictionary.com)
  • Treatment with carboxypeptidase and trypsin resulted in inhibition of chemotactic activity, indicating that the factor is a peptide. (ahajournals.org)
  • The chemotactic activity was heat-sensitive and was not inhibited by antibody to C5a or antibody to interleukin-8, or by a competitive inhibitor of the chemotactic peptide f-Met-Leu-Phe. (docme.ru)
  • MDNCF is a human monocyte-derived, 72-residue chemotactic peptide, which has sequence similarity with members of a family of pro-inflammatory cytokines. (elsevier.com)
  • The peptide was synthesized by the solid-phase method, and is identical to the natural peptide in amino acid composition, sequence and chemotactic potency. (elsevier.com)
  • The chemotactic response to the synthetic chemotactic peptide, N-formyl-methionyl-leucyl-phenylalanine (FMLP), was unimpaired. (elsevier.com)
  • N-Formylmethionyl-leucyl-phenylalanine (FMLP) or N-formyl-met-leu-phe) is a N-formylated tripeptide and sometimes simply referred to as chemotactic peptide is a potent polymorphonuclear leukocyte (PMN) chemotactic factor and is also a macrophage activator. (wikipedia.org)
  • In this study, it is shown that a classic chemotactic factor, the bacterial chemotactic peptide N-formyl-methionyl-leucylphenyl-alanine (fMLF), rapidly induced a protein-kinase-C-mediated serine phosphorylation and down-regulation of the chemokine receptor CCR5, which serves as a major human immunodeficiency virus (HIV)-1 coreceptor. (bloodjournal.org)
  • 6-10 Human monocytes express a wide variety of 7-transmembrane (STM), G-protein-coupled chemoattractant receptors including chemokine receptors and the receptors for classic chemotactic factors such as the bacterial chemotactic peptide N-formyl-methionyl-leucyl-phenylalanine (fMLF), activated complement component 5 (C5a), and leukotriene B4 (LTB4). (bloodjournal.org)
  • Since monocyte recruitment and activation under inflammatory conditions are probably the result of a concerted reaction to multiple stimulants, we investigated the effects of cell activation by bacterial chemotactic peptide on the expression and function of CCR5. (bloodjournal.org)
  • This study shows that CCR5 in monocytes can be rapidly phosphorylated and subsequently desensitized by stimulation of the cells with the bacterial chemotactic peptide fMLF, causing reduced cell susceptibility to HIV-1 entry and infection. (bloodjournal.org)
  • In many cases, specific receptors for these various chemotactic factors have been defined on both PMNs and monocytes (6-10). (springer.com)
  • Heterogeneity of human polymorphonuclear leukocyte receptors for leukotriene B4: Identification of a subset of high affinity receptors that transduce the chemotactic response. (springer.com)
  • Molecular cloning of a novel receptor (CMKLR1) with homology to the chemotactic factor receptors. (nih.gov)
  • Pertussis toxin modification of a membrane protein of PMNL analogous to Gi thus simultaneously alters chemotactic receptors and attenuates the changes in cytosolic calcium concentration and PMNL function caused by chemotactic factors. (rupress.org)
  • FMLP led to the first discovery of a leukocyte receptor for a chemotactic factor, defined three different types of FMLP receptors that have complimentary and/or opposing effects on inflammatory responses as well as many other activities, and helped define the stimulus-response coupling mechanisms by which diverse chemotactic factors and their G protein coupled receptors induce cellular function. (wikipedia.org)
  • Research encompasses a wide spectrum of experimental approaches, from the structural determination of immune receptors to the live cell image analysis of the behavior of chemotactic receptors. (nih.gov)
  • Because alveolar macrophages are normal residents of alveoli, it is likely that by releasing this factor(s) macrophages play a significant role in amplifying the inflammatory processes seen in many acute and chronic lung diseases. (jci.org)
  • These changes, together with the proinflammatory condition present in ABCA1-deficient mice and increased reactivity of macrophages to chemotactic factors, play a key role in the development and progression of atherosclerosis. (ahajournals.org)
  • A low molecular weight eosinophil chemotactic factor (ECF) which has previously been found within mast cells and polymorphonuclear cells is shown to be released from highly purified rat peritoneal macrophages on exposure to the calcium ionophore A 23187 or after phagocytosis of zymosan coated with complement (Z x). (naver.com)
  • Vascular endothelial growth factor (VEGF), oncostatin M (OSM), and granulocyte chemotactic protein-2 (GCP-2/CXCL6) are up-regulated in U937 macrophages and peripheral blood macrophages exposed to LPS, beta-adrenergic receptor (ß2-AR) agonists (e.g. zilpaterol, and clenbuterol) and some other agents that induce intracellular cAMP (prostaglandin E2, forskolin, and butyryl cAMP). (wur.nl)
  • Defective chemotactic response of human alveolar and colostral macrophages. (nih.gov)
  • When such fibers reach the alveoli (air sacs) in the lung, where oxygen is transferred into the blood, the foreign bodies (asbestos fibers) cause the activation of the lungs' local immune system and provoke an inflammatory reaction dominated by lung macrophages that respond to chemotactic factors activated by the fibers. (wikipedia.org)
  • CXCL17 is a major chemotactic factor for lung macrophages. (jax.org)
  • Chemotactic factors stimulate a rapid increase in the cytosolic concentration of intracellular calcium ions ([Ca2+]in) in human polymorphonuclear leukocytes (PMNL), which may be an event that is critical to the expression of chemotaxis and other PMNL functions. (rupress.org)
  • Peripheral monocytes obtained from hypercholesterolemic patients demonstrate increased adhesion to the endothelium 1-3 and an increased chemotactic response to chemokines. (ahajournals.org)
  • This study describes previously unreported expression patterns of lymphangiogenic growth factors and chemokines in conjunctival melanoma, as well as previously unreported lymphatic vessel growth patterns in this tumor. (lww.com)
  • We investigated the associations between the plasma levels of growth factors and chemokines that regulate myeloid cell homeostasis and function and the risk of first-time acute coronary events in middle-aged persons. (lu.se)
  • Although the primary function of chemokines is considered to be chemotactic, many studies suggest that they have complex regulatory functions that extend beyond leukocyte trafficking ( 2 )( 3 )( 4 )( 5 ). (rupress.org)
  • Specific receptor sites for chemotactic peptides on human polymorphonuclear leukocytes. (springer.com)
  • Exposure of human polymorphonuclear leukocytes (PMN) to chemotactic factor, as well as the migration of PMN through a 5-μm pore-size membrane, results in a PMN population with enhanced chemiluminescence, enhanced capacity for superoxide anion production, and increased Escherichia coli bactericidal activity. (jci.org)
  • Pertussis toxin inhibition of chemotactic factor-induced calcium mobilization and function in human polymorphonuclear leukocytes. (rupress.org)
  • Using a Boyden chemotactic assay, we studied the effect of freezing and lyophilization of rabbit corneas on the in vitro release of chemotactic factors for both polymorphonuclear leukocytes (PMNs) and keratocytes. (elsevier.com)
  • Various naturally occurring and synthetic chemotactic factors for PMNs and monocytes have been described and they include complement fragments such as C5a (1), products of arachidonic acid metabolism such as leukotriene B 4 (2), as well as other cell-derived lipids, such as acetyl glyceryl ether phosphorylcholine (platelet activating factor) (3). (springer.com)
  • 6 Additional reports 7,8 suggest that plasma lipoproteins differentially control monocyte function, and that monocytes from hypercholesterolemic subjects are hyper-responsive to chemotactic stimuli, suggesting a close relationship between plasma lipids and monocyte function. (ahajournals.org)
  • RANTES is a member of the 8-kDa cytokine family that has been shown to possess chemotactic activity for monocytes and CD4 T cells. (utmb.edu)
  • SPA induced the release of monocyte and leukocyte chemotactic factors by human monocytes. (elsevier.com)
  • Human monocytes stimulated with SPA exhibited the increased mRNA expression of monocyte chemoattractant protein 1 (MCP-1) and a neutrophil chemotactic factor, interleukin-8 (IL-8). (elsevier.com)
  • A major chemotactic factor for PMN is the activated fifth component of complement, C5a, formed in serum by its interaction with immune complexes (7). (docme.ru)
  • Monocyte chemotactic factor produced by large vessel endothelial cells in vitro. (ahajournals.org)
  • We conclude that large vessel endothelial cells produce a monocyte chemotactic factor that is increased after exposure of the cells to beta-VLDL. (ahajournals.org)
  • Polymyxin B had almost no effect on the release of monocyte chemotactic factor, but a monoclonal antibody against SPA markedly inhibited it. (elsevier.com)
  • Neutrophil chemotactic factors in synovial fluids of patients with lyme disease. (docme.ru)
  • Neutrophil chemotactic factors in the tears of giant papillary conjunctivitis patients. (arvojournals.org)
  • This study was designed to determine the presence of neutrophil chemotactic factors in the tears of patients with giant papillary conjunctivitis (BPC) secondary to contact lenses. (arvojournals.org)
  • The authors determined whether injured conjunctival cells participate in this process by releasing neutrophil chemotactic factors. (arvojournals.org)
  • Isolated rabbit bulbar conjunctiva incubated with culture medium for 4 and 6 hr released high levels of neutrophil chemotactic factors. (arvojournals.org)
  • The enhanced PMN response resulting from exposure to chemotactic factor was observed with several chemotactic stimuli, including a mixture of casein and autologous serum, chemotactic C5 fragment, and formyl-l-methionyl-l-leucine-l-phenylalanine (f-Met-Leu-Phe). (jci.org)
  • We found that RANTES is chemotactic for eosinophils at 10 -9 to 10 -8 M concentrations. (utmb.edu)
  • Thus, we established that RANTES is a chemotactic and activating factor for eosinophils. (utmb.edu)
  • Immature eosinophils with donut-type ring nuclei were generally observed in those extra-medulla hemopoietic foci, whereas mature eosinophil with polymorphic nuclei were generally observed in the eosinophilic granulomatous lesions, indicating that those eosinophils were recruited there by chemotactic factors. (nii.ac.jp)
  • Compared to PMN from normal rabbits, peripheral blood PMN from rabbits injected with endotoxin showed diminished chemotactic responsiveness to two endogenous peptides, C5a (complement) and platelet-derived growth factor, and to two endogenous lipids, leukotriene B 4 and platelet-activating factor. (elsevier.com)
  • ECF-L is the eosinophil chemotactic cytokine that belong to the chitinase family proteins. (nii.ac.jp)
  • In the present study, we identified the role of eosinophil chemotactic cytokine ECF-L in Schistosoma or Mesocestoides-infected mouse. (nii.ac.jp)
  • These studies demonstrated that endothelial cells may participate in neutrophil-mediated inflammation by synthesizing a chemotactic factor in response to specific monokines and LPS. (sciencemag.org)
  • Level of neutrophil chemotactic factor CINC/gro, a member of the interleukin-8 family, associated with lipopolysaccharide-induced inflammation in rats. (core.ac.uk)
  • Human monocyte-derived neutrophil chemotactic factor (MDNCF) was purified from culture supernatant of lipopolysaccharide-stimulated human peripheral blood mononuclear leukocytes on a column of Sepharose-bound murine monoclonal anti-MDNCF. (elsevier.com)
  • Indeed, the ligands for this receptor, I-309 in humans and T cell activation-specific gene 3 (TCA3) in mice, are chemotactic for Th2 cells in vitro ( 11 ). (rupress.org)
  • 1)Bronchial epithelial cells release fibronectin as a chemotactic factor for mast cells. (nii.ac.jp)
  • The treatment of isolated human endometriosis epithelial cells with estradiol, medroxyprogesterone acetate, tumor necrosis factor-alpha, and interferon-gamma stimulated measurable eotaxin secretion into the conditioned media. (biomedsearch.com)
  • Chemotactic migration and lysosomal enzyme release elicited by chemotactic factors were inhibited by pertussis toxin with a concentration-dependence similar to that for inhibition of the increase in [Ca2+]in, without an effect on lysosomal enzyme release induced by the ionophore A23187 and phorbol myristate acetate. (rupress.org)
  • Stimulation of human neutrophil leukocyte aerobic glucose metabolism by purified chemotactic factors. (harvard.edu)
  • In the rat corneal micropocket assay, BRAK was a potent inhibitor of in vivo angiogenesis stimulated by multiple angiogenic factors, including interleukin 8, basic fibroblast growth factor, and vascular endothelial growth factor. (aacrjournals.org)
  • They include agents like vascular endothelial growth factor (VEGF) and blood vessel fibroblastic growth factor (bFGF). (thefreedictionary.com)
  • The following proangiogenic factors were examined: vascular endothelial growth factor (VEGF), high mobility group box 1 (HMGB1) and chemokine (C-X-C motif) ligand 12 (CXCL12). (mdpi.com)
  • Substances in the exudate include clotting factors, which help prevent the spread of infectious agents throughout the body. (britannica.com)
  • On the other hand, SPA induced the release of IL-1, IL-6, and tumor necrosis factor (TNF) and enhanced the expression of IL-1α, IL-1β, IL-6, and TNF alpha (TNF-α) mRNAs. (elsevier.com)
  • One of the major chemotactic factors in Lyme disease synovial fluid had a calculated molecular weight of 13,900. (docme.ru)
  • Molecular sieve chromatography and sucrose density gradient ultracentrifugation demonstrated that the chemotactic factor was a relatively low molecular weight product (15,000-30,000) and as such different from previously scribed C' system-derived chemotactic factors. (eurekamag.com)
  • and high-molecular-weight kininogen, also called Fitzgerald , Flaujeac , or Williams factor , or contact activation cofactor . (thefreedictionary.com)
  • These factors are active in healing wounds, chronic inflammatory conditions, retrolental fibroplasia, and malignant tumors, which require new blood vessels for continued growth. (thefreedictionary.com)
  • Extensive scientific research shows that two major etiological factors involved in PUD are infection with H.pylori and ingestion of non-inflammatory drugs (NSAIDs), a careful history of NSAIDs use is also important. (issuu.com)
  • This study aimed to comparatively evaluate the effect of stromal cell-derived factor 1 (SDF-1), transforming growth factor beta 1 (TGF-β1), platelet-derived growth factor, granulocyte colony-stimulating factor (G-CSF), or fibroblast growth factor 2 (FGF-2) on the migration and differentiation of SCAPs. (ovid.com)
  • The release of these factors from injured conjunctiva support the premise that physical trauma of conjunctival cells induced by contact lenses may be an important component of the pathophysiology of giant papillary conjunctivitis. (arvojournals.org)
  • Future perspective would be the incorporation of HMGB1 into PCL polymer for the realization of a slow factor release. (mdpi.com)
  • The chemotactic factor induced by endotoxin was heat stable and nondialyzable. (eurekamag.com)
  • At a 1:4 (vol/vol) dilution, the plasma either 1 or 24 h after the endotoxin injection inhibited normal PMN chemotactic responses to C5a but not to FMLP. (elsevier.com)
  • RANTES elicited 65% of the chemotactic response to 10 -7 M platelet-activating factor in all experiments. (utmb.edu)
  • Quantitative and qualitative analysis of platelet GPIb and von Willebrand factor in liver cirrhosis. (nih.gov)
  • Platelet Factor 4" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (harvard.edu)
  • This graph shows the total number of publications written about "Platelet Factor 4" by people in Harvard Catalyst Profiles by year, and whether "Platelet Factor 4" was a major or minor topic of these publication. (harvard.edu)
  • Below are the most recent publications written about "Platelet Factor 4" by people in Profiles. (harvard.edu)
  • 6 7 It is currently believed that heparin-induced thrombocytopenia (HIT) is mediated by antibodies directed at complexes that form between heparin or other anionic mucopolysaccharides and platelet factor 4 (PF4) in plasma, on the surface of platelets, and/or on the endothelium. (bloodjournal.org)
  • The human platelet factor 4 kills malaria parasites within erythrocytes by selectively lysing the parasite's digestive vacuole. (wikipedia.org)
  • Here, we review growth factors and chemotactic factors expressed by parasitic helminths and discuss their recognised and potential roles in immunomodulation and/or parasite development. (nih.gov)
  • Chemotactic response to human C3a and C5a anaphylatoxins. (springer.com)
  • Although B burgdorferi has been cultured from joint fluid and identified in synovial lesions in a few cases (1,5), the scarcity of organisms in the synovial lesions, the wide spectrum of joint involvement, and the slow response, if any, of chronic arthritis to antibiotic therapy suggest that host factors play a major role in the pathogenesis of Lyme arthritis (5). (docme.ru)
  • The mechanism(s) whereby dyslipidemia and other atherosclerotic risk factors influence monocyte phenotype, migration, adhesion, and differentiation is less clear. (ahajournals.org)
  • Although many chemotactic factors have been investigated for different mesenchymal stem cells, their effect on SCAP migration and differentiation is not fully understood. (ovid.com)
  • Maximum migration was observed with G-CSF or FGF-2, which was significantly greater than the effects observed by the other tested factors. (ovid.com)
  • Matrices listed below were spiked with certain level of recombinant Eosinophil Chemotactic Factor (ECF) and the recovery rates were calculated by comparing the measured value to the expected amount of Eosinophil Chemotactic Factor (ECF) in samples. (cloud-clone.us)
  • 2017. https://nursing.unboundmedicine.com/nursingcentral/view/Tabers-Dictionary/742490/all/eosinophil_chemotactic_factor. (unboundmedicine.com)