Cellulomonas
Gram-Positive Asporogenous Rods
Actinomycetales
Glucan 1,4-beta-Glucosidase
Cellulose
A polysaccharide with glucose units linked as in CELLOBIOSE. It is the chief constituent of plant fibers, cotton being the purest natural form of the substance. As a raw material, it forms the basis for many derivatives used in chromatography, ion exchange materials, explosives manufacturing, and pharmaceutical preparations.
Cellulase
beta-Glucosidase
Xylan Endo-1,3-beta-Xylosidase
Cellvibrio
Xylosidases
A group of enzymes that catalyze the hydrolysis of alpha- or beta-xylosidic linkages. EC 3.2.1.8 catalyzes the endo-hydrolysis of 1,4-beta-D-xylosidic linkages; EC 3.2.1.32 catalyzes the endo-hydrolysis of 1,3-beta-D-xylosidic linkages; EC 3.2.1.37 catalyzes the exo-hydrolysis of 1,4-beta-D-linkages from the non-reducing termini of xylans; and EC 3.2.1.72 catalyzes the exo-hydrolysis of 1,3-beta-D-linkages from the non-reducing termini of xylans. Other xylosidases have been identified that catalyze the hydrolysis of alpha-xylosidic bonds.
Gram-Positive Rods
Ulmus
Glucan 1,3-beta-Glucosidase
Cellobiose
Endo-1,4-beta Xylanases
DNA, Ribosomal
RNA, Ribosomal, 16S
Cellulose 1,4-beta-Cellobiosidase
Korea
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Genes, rRNA
Re-evaluation of the status of the genus Oerskovia, reclassification of Promicromonospora enterophila (Jager et al. 1983) as Oerskovia enterophila comb. nov. and description of Oerskovia jenensis sp. nov. and Oerskovia paurometabola sp. nov. (1/30)
Phylogenetic analysis of Promicromonospora enterophila indicates that this taxon clusters with Cellulomonas species, adjacent to Cellulomonas turbata (basonym Oerskovia turbata). 16S rDNA analysis, DNA-DNA reassociation, riboprinting, peptidoglycan analysis and determination of phenotypic properties of various strains of P. enterophila and C turbata reveal that they form a cluster that can be distinguished unambiguously from other Cellulomonas species by morphology, amino acid composition of the cell wall and 16S rDNA signatures. As a result of thispolyphasic study, it appears taxonomically reasonable to re-establish the genus Oerskovia for C turbata and to reclassify P. enterophila as Oerskovia enterophila comb. nov.; two novel species, Oerskovia jenensis sp. nov. (type strain DSM 46000T = CIP 100330T) and Oerskovia paurometabola sp. nov. (type strain DSM 14281T = LMG 20385T), are also proposed. (+info)Extracellular acidic polysaccharide production by a two-membered bacterial coculture. (2/30)
A two-membered coculture of strains KYM-7 and KYM-8, identified as Cellulomonas cellulans and Agrobacterium tumefaciens, respectively, produced a large amount of an extracellular polysaccharide, designated APK-78, from starch. Each strain in pure culture produced only very little amount of polysaccharide from starch; the coexistence of the two strains from the early stage of cultivation was indispensable for a large amount of polysaccharide to be produced. The polysaccharide APK-78 was acidic and composed of glucose, galactose, succinic acid, and pyruvic acid with a molar ratio of 8.1:1.0:1.7:1.0, indicating that it is a succinoglycan type of polysaccharide. (+info)Cellulomonas xylanilytica sp. nov., a cellulolytic and xylanolytic bacterium isolated from a decayed elm tree. (3/30)
A Gram-positive, aerobic, non-motile bacterium was isolated from a decayed elm tree. Phylogenetic analysis based on 16S rDNA sequences revealed 99.0 % similarity to Cellulomonas humilata. Chemotaxonomic data that were determined for this isolate included cell-wall composition, fatty acid profiles and polar lipids; the results supported the placement of strain XIL11(T) in the genus Cellulomonas. The DNA G+C content was 73 mol%. The results of DNA-DNA hybridization with C. humilata ATCC 25174(T), in combination with chemotaxonomic and physiological data, demonstrated that isolate XIL11(T) should be classified as a novel Cellulomonas species. The name Cellulomonas xylanilytica sp. nov. is proposed, with strain XIL11(T) (=LMG 21723(T)=CECT 5729(T)) as the type strain. (+info)Structure and function of a family 10 beta-xylanase chimera of Streptomyces olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex. (4/30)
The catalytic domain of xylanases belonging to glycoside hydrolase family 10 (GH10) can be divided into 22 modules (M1 to M22; Sato, Y., Niimura, Y., Yura, K., and Go, M. (1999) Gene (Amst.) 238, 93-101). Inspection of the crystal structure of a GH10 xylanase from Streptomyces olivaceoviridis E-86 (SoXyn10A) revealed that the catalytic domain of GH10 xylanases can be dissected into two parts, an N-terminal larger region and C-terminal smaller region, by the substrate binding cleft, corresponding to the module border between M14 and M15. It has been suggested that the topology of the substrate binding clefts of GH10 xylanases are not conserved (Charnock, S. J., Spurway, T. D., Xie, H., Beylot, M. H., Virden, R., Warren, R. A. J., Hazlewood, G. P., and Gilbert, H. J. (1998) J. Biol. Chem. 273, 32187-32199). To facilitate a greater understanding of the structure-function relationship of the substrate binding cleft of GH10 xylanases, a chimeric xylanase between SoXyn10A and Xyn10A from Cellulomonas fimi (CfXyn10A) was constructed, and the topology of the hybrid substrate binding cleft established. At the three-dimensional level, SoXyn10A and CfXyn10A appear to possess 5 subsites, with the amino acid residues comprising subsites -3 to +1 being well conserved, although the +2 subsites are quite different. Biochemical analyses of the chimeric enzyme along with SoXyn10A and CfXyn10A indicated that differences in the structure of subsite +2 influence bond cleavage frequencies and the catalytic efficiency of xylooligosaccharide hydrolysis. The hybrid enzyme constructed in this study displays fascinating biochemistry, with an interesting combination of properties from the parent enzymes, resulting in a low production of xylose. (+info)Phenotypic and genetic characterization of clinical isolates of CDC coryneform group A-3: proposal of a new species of Cellulomonas, Cellulomonas denverensis sp. nov. (5/30)
CDC coryneform group A-3 bacteria are rare human pathogens. In this study, six group A-3 isolates (two from blood, one from cerebrospinal fluid, and one each from homograft valve, lip wound, and pilonidal cyst) were compared to the type strains of phenotypically related organisms, Cellulomonas fimi, Cellulomonas hominis, Oerskovia turbata, and Sanguibacter suarezii, and characterized by phenotypic, chemotaxonomic, and genotypic studies. DNA-DNA reassociation analysis identified two genomic groups, and phylogenetic analysis of the 16S rRNA gene sequence identified the taxonomic positions of these groups to genus level. Two groups were defined, and both were more closely related to Cellulomonas species: one group of three strains, for which we propose the new species Cellulomonas denverensis sp. nov., with the type strain W6929 (ATCC BAA-788(T) or DSM 15764(T)), was related to C. hominis ATCC 51964(T) (98.5% 16S rRNA gene sequence similarity), and the second group of three strains was related to C. hominis ATCC 51964(T) (99.8 to 99.9% 16S rRNA gene sequence similarity). The definition of this new Cellulomonas species and the confirmation of three strains as C. hominis serve to further clarify the complex taxonomy of CDC coryneform group A-3 bacteria and will assist in our understanding of the epidemiology and clinical significance of these microorganisms. (+info)Cellulomonas terrae sp. nov., a cellulolytic and xylanolytic bacterium isolated from soil. (6/30)
A bacterial strain (DB5(T)), with polysaccharide-degrading activities, was isolated from garden soil in Daejeon, Republic of Korea. The cells were Gram-positive, aerobic or facultatively anaerobic, non-motile straight rods. Phylogenetic analysis based on 16S rRNA gene sequences showed that this strain belongs to the genus Cellulomonas and that it is most closely related to Cellulomonas xylanilytica LMG 21723(T) and Cellulomonas humilata ATCC 25174(T) (98.0 and 97.9% similarity, respectively). Chemotaxonomic data also supported the classification of strain DB5(T) in the genus Cellulomonas, i.e. L-ornithine as the cell-wall diamino acid, anteiso-C(15:0) and iso-C(15:0) as the major fatty acids, MK-9(H(4)) as the predominant menaquinone and the presence of diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol and phosphatidylinositol mannosides in the polar lipid profile. The results of DNA-DNA hybridization in combination with chemotaxonomic and physiological data demonstrated that strain DB5(T) (=KCTC 19081(T)=NBRC 100819(T)) should be classified as the type strain of a novel species within the genus Cellulomonas, for which the name Cellulomonas terrae sp. nov. is proposed. (+info)Cellulomonas bogoriensis sp. nov., an alkaliphilic cellulomonad. (7/30)
An alkaliphilic, slightly halotolerant, chemo-organotrophic, Gram-positive, rod-shaped bacterium, strain 69B4(T), was isolated from the sediment of the littoral zone of Lake Bogoria, Kenya. Phylogenetically, it is a member of the genus Cellulomonas, showing less than 97.5 % sequence similarity to the type strains of other Cellulomonas species. The highest level of similarity, albeit moderate, was found with respect to Cellulomonas cellasea DSM 20118(T). Chemotaxonomic properties confirm the 16S rRNA gene-based generic affiliation, i.e. a DNA G+C content of 71.5 mol%, anteiso-C(15:0) and C(16:0) as the major fatty acids, MK-9(H(4)) as the major isoprenoid quinone, a peptidoglycan containing L-ornithine as the diamino acid and D-aspartic acid in the interpeptide bridge and phosphatidylglycerol as the only identified main polar lipid. The strain is aerobic to facultatively anaerobic, being capable of growth under strictly anaerobic conditions. Optimal growth occurs between pH values 9.0 and 10.0. On the basis of its distinct phylogenetic position and metabolic properties, strain 69B4(T) represents a novel species of the genus Cellulomonas, for which the name Cellulomonas bogoriensis sp. nov. is proposed. The type strain is 69B4(T) (=DSM 16987(T)=CIP 108683(T)). (+info)Active-site peptide "fingerprinting" of glycosidases in complex mixtures by mass spectrometry. Discovery of a novel retaining beta-1,4-glycanase in Cellulomonas fimi. (8/30)
New proteomics methods are required for targeting and identification of subsets of a proteome in an activity-based fashion. Here, we report the first gel-free, mass spectrometry-based strategy for mechanism-based profiling of retaining beta-endoglycosidases in complex proteomes. Using a biotinylated, cleavable 2-deoxy-2-fluoroxylobioside inactivator, we have isolated and identified the active-site peptides of target retaining beta-1,4-glycanases in systems of increasing complexity: pure enzymes, artificial proteomes, and the secreted proteome of the aerobic mesophilic soil bacterium Cellulomonas fimi. The active-site peptide of a new C. fimi beta-1,4-glycanase was identified in this manner, and the peptide sequence, which includes the catalytic nucleophile, is highly conserved among glycosidase family 10 members. The glycanase gene (GenBank accession number DQ146941) was cloned using inverse PCR techniques, and the protein was found to comprise a catalytic domain that shares approximately 70% sequence identity with those of xylanases from Streptomyces sp. and a family 2b carbohydrate-binding module. The new glycanase hydrolyzes natural and artificial xylo-configured substrates more efficiently than their cello-configured counterparts. It has a pH dependence very similar to that of known C. fimi retaining glycanases. (+info)
Cellulomonas
... is a genus of Gram-positive rod-shaped bacteria. One of their main distinguishing features is their ability to ... Cellulomonas comprises the following species: C. aerilata Lee et al. 2008 C. algicola Yamamura et al. 2019 C. biazotea ( ... "Cellulomonas". List of Prokaryotic names with Standing in Nomenclature (LPSN). Retrieved May 18, 2022.{{cite web}}: CS1 maint: ... uses authors parameter (link) Data related to Cellulomonas at Wikispecies Portal: Biology v t e (CS1 maint: uses authors ...
Cellulomonas denverensis
... is a bacterium from the genus Cellulomonas which has been isolated from human blood in the United ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas denverensis Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Proposal of a new species of Cellulomonas, Cellulomonas denverensis sp. nov". Journal of Clinical Microbiology. 43 (4): 1732-7 ... Thomas; Garrity, George M (2008). Parker, Charles Thomas; Garrity, George M (eds.). "Nomenclature Abstract for Cellulomonas ...
Cellulomonas persica
... is a mesophilic and cellulolytic bacterium from the genus Cellulomonas which has been isolated from forest ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas persica Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... "Cellulomonas persica sp. nov. and Cellulomonas iranensis sp. nov., mesophilic cellulose-degrading bacteria isolated from forest ... "Nomenclature Abstract for Cellulomonas persica Elberson et al. 2000". The NamesforLife Abstracts. doi:10.1601/nm.5964. "Details ...
Cellulomonas oligotrophica
... is a Gram-positive and motile bacterium from the genus Cellulomonas which has been isolated from ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas oligotrophica Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Hatayama, K; Esaki, K; Ide, T (January 2013). "Cellulomonas soli sp. nov. and Cellulomonas oligotrophica sp. nov., isolated ... "Nomenclature Abstract for Cellulomonas oligotrophica". The NamesforLife Abstracts. doi:10.1601/nm.23692. v t e (Articles with ...
Cellulomonas iranensis
... is a cellulolytic and mesophilic bacterium from the genus Cellulomonas which has been isolated from ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas iranensis Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... "Cellulomonas persica sp. nov. and Cellulomonas iranensis sp. nov., mesophilic cellulose-degrading bacteria isolated from forest ... "Nomenclature Abstract for Cellulomonas iranensis Elberson et al. 2000". The NamesforLife Abstracts. doi:10.1601/nm.5963. " ...
Cellulomonas phragmiteti
Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas phragmiteti Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Cellulomonas phragmiteti is a Gram-positive, moderately halophilic, alkalitolerant, facultatively anaerobic and motile ... "Cellulomonas phragmiteti sp. nov., a cellulolytic bacterium isolated from reed (Phragmites australis) periphyton in a shallow ... "Nomenclature Abstract for Cellulomonas phragmiteti Rusznyák et al. 2011". The NamesforLife Abstracts. doi:10.1601/nm.22185. " ...
Cellulomonas terrae
An, DS; Im, WT; Yang, HC; Kang, MS; Kim, KK; Jin, L; Kim, MK; Lee, ST (July 2005). "Cellulomonas terrae sp. nov., a ... Parte, A.C. "Cellulomonas". LPSN. Parker, Charles Thomas; Garrity, George M (2008). Parker, Charles Thomas; Garrity, George M ( ... Cellulomonas terrae is a Gram-positive, polysaccharide-degrading, cellulolytic, xylanolytic and non-motile bacterium from the ... eds.). "Nomenclature Abstract for Cellulomonas terrae An et al. 2005". The NamesforLife Abstracts. doi:10.1601/nm.9510. " ...
Cellulomonas soli
... is a Gram-positive and motile bacterium from the genus Cellulomonas which has been isolated from soil from ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas soli Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles Thomas; ... Hatayama, K; Esaki, K; Ide, T (January 2013). "Cellulomonas soli sp. nov. and Cellulomonas oligotrophica sp. nov., isolated ... Garrity, George M (2013). Parker, Charles Thomas; Garrity, George M (eds.). "Nomenclature Abstract for Cellulomonas soli". The ...
Cellulomonas massiliensis
... is a rod-shaped bacterium from the genus Cellulomonas which has been isolated from human feces from ... Parte, A.C. "Cellulomonas". LPSN. Parker, Charles Thomas; Garrity, George M (2013). Parker, Charles Thomas; Garrity, George M ( ... "Non contiguous-finished genome sequence and description of Cellulomonas massiliensis sp. nov". Standards in Genomic Sciences. 7 ... eds.). "Nomenclature Abstract for Cellulomonas massiliensis Lagier et al. 2015". The NamesforLife Abstracts. doi:10.1601/nm. ...
Cellulomonas bogoriensis
Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas bogoriensis Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Cellulomonas bogoriensis is a Gram-positive, chemoorganotrophic, alkaliphilic, slightly halotolerant and rod-shaped bacterium ... Jones, BE; Grant, WD; Duckworth, AW; Schumann, P; Weiss, N; Stackebrandt, E (July 2005). "Cellulomonas bogoriensis sp. nov., an ... from the genus Cellulomonas which has been isolated from sediments and water from the littoral zone of the Lake Bogoria in ...
Cellulomonas chitinilytica
... is a chitinolytic, Gram-positive, rod-shaped and non-motile bacterium from the genus Cellulomonas ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas chitinilytica Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Yoon, MH; Ten, LN; Im, WT; Lee, ST (August 2008). "Cellulomonas chitinilytica sp. nov., a chitinolytic bacterium isolated from ... "Nomenclature Abstract for Cellulomonas chitinilytica Yoon et al. 2008". The NamesforLife Abstracts. doi:10.1601/nm.13266. " ...
Cellulomonas marina
... is a bacterium from the genus Cellulomonas which has been isolated from deep-sea water from the Indian ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas marina Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles Thomas ... Zhang, L; Xi, L; Qiu, D; Song, L; Dai, X; Ruan, J; Huang, Y (August 2013). "Cellulomonas marina sp. nov., isolated from deep- ... Garrity, George M (2013). Parker, Charles Thomas; Garrity, George M (eds.). "Nomenclature Abstract for Cellulomonas marina". ...
Cellulomonas xylanilytica
Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas xylanilytica Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Cellulomonas xylanilytica is a Gram-positive, aerobic, cellulolytic, xylanolytic and non-motile bacterium from the genus ... Rivas, R; Trujillo, ME; Mateos, PF; Martínez-Molina, E; Velázquez, E (March 2004). "Cellulomonas xylanilytica sp. nov., a ... "Nomenclature Abstract for Cellulomonas xylanilytica Rivas et al. 2004". The NamesforLife Abstracts. doi:10.1601/nm.5967. v t e ...
Cellulomonas composti
... is a Gram-positive, cellulolytic, rod-shaped and non-motile bacterium from the genus Cellulomonas which ... Kang, MS; Im, WT; Jung, HM; Kim, MK; Goodfellow, M; Kim, KK; Yang, HC; An, DS; Lee, ST (June 2007). "Cellulomonas composti sp. ... Parte, A.C. "Cellulomonas". LPSN. Parker, Charles Thomas; Garrity, George M (2008). Parker, Charles Thomas; Garrity, George M ( ... eds.). "Nomenclature Abstract for Cellulomonas composti Kang et al. 2007". The NamesforLife Abstracts. doi:10.1601/nm.10654. " ...
Cellulomonas pakistanensis
Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas pakistanensis Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... Ahmed, I; Kudo, T; Abbas, S; Ehsan, M; Iino, T; Fujiwara, T; Ohkuma, M (July 2014). "Cellulomonas pakistanensis sp. nov., a ... Cellulomonas pakistanensis is a plant-growth-promoting, facultatively anaerobic, moderately halotolerant rod-shaped and motile ... "Nomenclature Abstract for Cellulomonas pakistanensis". The NamesforLife Abstracts. doi:10.1601/nm.25609. "Details: DSM-24792". ...
Cellulomonas aerilata
... is a Gram-positive, aerobic and motile bacterium from the genus Cellulomonas which has been isolated from ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas aerilata Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... "Nomenclature Abstract for Cellulomonas aerilata Lee et al. 2008". The NamesforLife Abstracts. doi:10.1601/nm.13265. "Details: ... "Cellulomonas aerilata sp. nov., isolated from an air sample". International Journal of Systematic and Evolutionary Microbiology ...
Cellulomonas hominis
... is a bacterium from the genus Cellulomonas which has been isolated from cerebrospinal fluid in Switzerland ... Parte, A.C. "Cellulomonas". LPSN. "Cellulomonas hominis Taxon Passport - StrainInfo". www.straininfo.net. Parker, Charles ... 1995). "Identification of some clinical strains of CDC coryneform group A-3 and A-4 bacteria as Cellulomonas species and ... "Nomenclature Abstract for Cellulomonas hominis Funke et al. 1996". The NamesforLife Abstracts. doi:10.1601/nm.5961. "Details: ...
Cellulomonas carbonis
... is a Gram-positive, aerobic, rod-shaped and motile bacterium from the genus Cellulomonas which has been ... Parte, A.C. "Cellulomonas". LPSN. "CGMCC 1.10786 Strain Passport - StrainInfo". www.straininfo.net. Parker, Charles Thomas; ... Shi, Z; Luo, G; Wang, G (August 2012). "Cellulomonas carbonis sp. nov., isolated from coal mine soil". International Journal of ... Garrity, George M (2012). Parker, Charles Thomas; Garrity, George M (eds.). "Nomenclature Abstract for Cellulomonas carbonis ...
Cellulomonadaceae
Stackebrandt E, Prauser H. (1991). "Assignment of the genera Cellulomonas, Oerskovia, Promicromonospora, and Jonesia to ...
Mannan exo-1,2-1,6-alpha-mannosidase
"Purification and characterization of exo-α-D-mannosidase from a Cellulomonas sp". Biochim. Biophys. Acta. 991: 431-437. doi: ...
Carbohydrate-binding module
... from Cellulomonas fimi. These homologous CBMs are distinct in their selectivity for binding amorphous and not crystalline ... "Structure and binding specificity of the second N-terminal cellulose-binding domain from Cellulomonas fimi endoglucanase C". ... "Structure of the N-terminal cellulose-binding domain of Cellulomonas fimi CenC determined by nuclear magnetic resonance ... "Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy". ...
Actinotalea
nov., a novel actinomycete of the suborder Micrococcineae, and reclassification of Cellulomonas fermentans Bagnara et al. 1985 ...
Demequina
nov., a novel actinomycete of the suborder Micrococcineae, and reclassification of Cellulomonas fermentans Bagnara et al. 1985 ...
Demequina aestuarii
nov., a novel actinomycete of the suborder Micrococcineae, and reclassification of Cellulomonas fermentans Bagnara et al. 1985 ...
Cellulose
Some ruminants like cows and sheep contain certain symbiotic anaerobic bacteria (such as Cellulomonas and Ruminococcus spp.) in ...
CHB HEX N-terminal domain
... this structure is similar to that found in the cellulose-binding domain of cellulase from Cellulomonas fimi. This domain may ...
List of MeSH codes (B03)
Cellulomonas MeSH B03.510.024.049.180 - Corynebacterium MeSH B03.510.024.049.180.100 - Brevibacterium flavum MeSH B03.510. ...
Búsqueda | BVS CLAP/SMR-OPS/OMS
Name Taxonomy in SILVA v123
Microlunatus aurantiacus sp. nov., a novel actinobacterium isolated from a rhizosphere soil sample | Microbiology Society
DeCS
The cba gene of C. biazotea encoding a secretory cellobiase : its sequence determination, cloning and expression - Rare &...
Investigación - Micro USAL
Browse
Pre GI: CDS description
sterile.com - The Biotechnician - Biopharm
Handbook on Coal, Coke, Cotton, Lignin, Hemicellulose, Wood, Wood-Polymer Composites, Lignocellulosic-Plastic Composites from...
Buy Max Microbe Beneficial Nutrients 16oz (pint) - Our Vision Hydro
EurekaMag PDF full texts Chapter 6194
HAMAP
Cellulomonas soli (UP000321798) Cellulomonas sp. B6 (UP000054319) Cellulomonas sp. HLT2-17 (UP000293764) Cellulomonas sp. KH9 ( ... Cellulomonas Cellulomonas aerilata (UP000321181) Cellulomonas bogoriensis 69B4 = DSM 16987 (UP000054314) Cellulomonas carbonis ... Cellulomonas composti (UP000321720) Cellulomonas denverensis (UP000581206) Cellulomonas fimi (UP000562124) Cellulomonas fimi ( ... Cellulomonas hominis (UP000321723) Cellulomonas marina (UP000199012) Cellulomonas persica (UP000321386) Cellulomonas ...
February | 2016 | CARS signal
CDD Conserved Protein Domain Family: F420-0 ABC ATP
2 ELTIAGAGTRLGGRWVVDGVDATPPAGALTGLLGPNGAGKTTLLRLVAGLLAPEAGAVlvsDPAAADpaptlpVHTMPRR 81 Cellulomonas f... jgi:Bcav_2584 17 DLRLER ... 2 ELTIAGAGTRLGGRWVVDGVDATPPAGALTGLLGPNGAGKTTLLRLVAGLLAPEAGAVlvsDPAAADpaptlpVHTMPRR 81 Cellulomonas f... jgi:Bcav_2584 17 DLRLER ... DAGAVDRALGAASAEHLADRAWSTLSGGERQRVHVARA 159 Cellulomonas f... jgi:Bcav_2584 88 ARARRIALVEQDSPTDVPLRALDVVLLGRTPFRSRWATDSPDDVELARA ... DAGAVDRALGAASAEHLADRAWSTLSGGERQRVHVARA 159 Cellulomonas f... jgi:Bcav_2584 88 ARARRIALVEQDSPTDVPLRALDVVLLGRTPFRSRWATDSPDDVELARA ...
dbCAN-seq: a database of CAZyme sequence and annotation
CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal ... CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal ... CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B ... CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal ...
Biogas microbes can produce certain gases as - Free Argumentative Essays For Students
MeSH Browser
Nutraceutical Products Manufacturer In Ahmedabad,Nutraceutical Products Supplier
Riskgroups | my.ABSA.org - For the Biosafety and Biosecurity Professional
Biomarkers Search
Rapid sequencing-based diagnosis of infectious bacterial species from meningitis patients in Zambia - PubMed
Release Date Request Code Change Type NCI Code CDISC Term Type CDISC Codelist (Short Name) CDISC Codelist (Long Name) Change...
TREE NUMBER DESCRIPTOR
Code System Concept
Cellulomonas fimi (organism) {114193009 , SNOMED-CT } Cellulomonas flavigena (organism) {114194003 , SNOMED-CT } Cellulomonas ... Cellulomonas persica (organism) {432755002 , SNOMED-CT } Cellulomonas turbata (organism) {114197005 , SNOMED-CT } Cellulomonas ... Genus Cellulomonas (organism) {114188006 , SNOMED-CT } Parent/Child (Relationship Type) Cellulomonas biazotea (organism) { ... Cellulomonas cellasea (organism) {114190007 , SNOMED-CT } Cellulomonas denverensis (organism) {768160004 , SNOMED-CT } ...
MeSH Browser
Cellulomonas Preferred Term Term UI T489607. Date04/15/2002. LexicalTag NON. ThesaurusID NLM (2003). ... Cellulomonas Preferred Concept UI. M0420312. Registry Number. txid1707. Scope Note. A genus of aerobic or facultatively ... Cellulomonas. Tree Number(s). B03.510.024.213. Unique ID. D040143. RDF Unique Identifier. http://id.nlm.nih.gov/mesh/D040143 ...
MeSH Browser
Cellulomonas Preferred Term Term UI T489607. Date04/15/2002. LexicalTag NON. ThesaurusID NLM (2003). ... Cellulomonas Preferred Concept UI. M0420312. Registry Number. txid1707. Scope Note. A genus of aerobic or facultatively ... Cellulomonas. Tree Number(s). B03.510.024.213. Unique ID. D040143. RDF Unique Identifier. http://id.nlm.nih.gov/mesh/D040143 ...
Búsqueda | Portal Regional de la BVS
c33c
t
TERM
Fimi1
- In one part of this work, the adsorption properties of the extensively studied bacterial CBD of exoglucanase xylanase Cex from Cellulomonas fimi was compared with the properties of the CBD of CBHI from T. reesei. (vtt.fi)
Oerskovia1
- Assignment of the genera Cellulomonas, Oerskovia, Promicromonospora, and Jonesia to Cellulomonadaceae fam. (microbiologyresearch.org)
Cellulolytic1
- Interaction between N2-fixing bacteria and cellulolytic bacteria such as Cellulomonas. (doctor-dr.com)
Pseudomonas1
- Stenotrophomonas acidaminiphila APG1, Pseudomonas stutzeri APG2 and Cellulomonas sp. (thebiotechnician.com)
Properties1
- 17. Kinetic properties of Cellulomonas sp. (nih.gov)