Cellobiose: A disaccharide consisting of two glucose units in beta (1-4) glycosidic linkage. Obtained from the partial hydrolysis of cellulose.Carbohydrate Dehydrogenases: Reversibly catalyze the oxidation of a hydroxyl group of carbohydrates to form a keto sugar, aldehyde or lactone. Any acceptor except molecular oxygen is permitted. Includes EC 1.1.1.; EC 1.1.2.; and 1.1.99.Cellulose: A polysaccharide with glucose units linked as in CELLOBIOSE. It is the chief constituent of plant fibers, cotton being the purest natural form of the substance. As a raw material, it forms the basis for many derivatives used in chromatography, ion exchange materials, explosives manufacturing, and pharmaceutical preparations.beta-Glucosidase: An exocellulase with specificity for a variety of beta-D-glycoside substrates. It catalyzes the hydrolysis of terminal non-reducing residues in beta-D-glucosides with release of GLUCOSE.Cellulase: An endocellulase with specificity for the hydrolysis of 1,4-beta-glucosidic linkages in CELLULOSE, lichenin, and cereal beta-glucans.DextrinsDisaccharides: Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.Phanerochaete: A genus of fungi in the family Corticiaceae, order Stereales, that degrades lignin. The white-rot fungus Phanerochaete chrysosporium is a frequently used species in research.Glucan 1,4-beta-Glucosidase: An exocellulase with specificity for the hydrolysis of 1,4-beta-glucosidic linkages of 1,4-beta-D-glucans resulting in successive removal of GLUCOSE units.Cellulose 1,4-beta-Cellobiosidase: An exocellulase with specificity for the hydrolysis of 1,4-beta-D-glucosidic linkages in CELLULOSE and cellotetraose. It catalyzes the hydrolysis of terminal non-reducing ends of beta-D-glucosides with release of CELLOBIOSE.Sporothrix: A mitosporic Ophiostomataceae fungal genus, whose species Sporothrix schenckii is a well-known animal pathogen. The conidia of this soil fungus may be inhaled causing a primary lung infection, or may infect independently via skin punctures.TetrosesRuminococcus: A genus of gram-positive bacteria in the family Lachnospiraceae that inhabits the RUMEN; LARGE INTESTINE; and CECUM of MAMMALS.Basidiomycota: A phylum of fungi that produce their sexual spores (basidiospores) on the outside of the basidium. It includes forms commonly known as mushrooms, boletes, puffballs, earthstars, stinkhorns, bird's-nest fungi, jelly fungi, bracket or shelf fungi, and rust and smut fungi.Clostridium: A genus of motile or nonmotile gram-positive bacteria of the family Clostridiaceae. Many species have been identified with some being pathogenic. They occur in water, soil, and in the intestinal tract of humans and lower animals.Glucosidases: Enzymes that hydrolyze O-glucosyl-compounds. (Enzyme Nomenclature, 1992) EC 3.2.1.-.Gram-Negative Anaerobic Straight, Curved, and Helical Rods: A group of anaerobic, rod-shaped bacteria that show up as pink (negative) when treated by the Gram-staining method.Fermentation: Anaerobic degradation of GLUCOSE or other organic nutrients to gain energy in the form of ATP. End products vary depending on organisms, substrates, and enzymatic pathways. Common fermentation products include ETHANOL and LACTIC ACID.Peptococcaceae: A family of bacteria found in the mouth and intestinal and respiratory tracts of man and other animals as well as in the human female urogenital tract. Its organisms are also found in soil and on cereal grains.Cellulases: A family of glycosidases that hydrolyse crystalline CELLULOSE into soluble sugar molecules. Within this family there are a variety of enzyme subtypes with differing substrate specificities that must work together to bring about complete cellulose hydrolysis. They are found in structures called CELLULOSOMES.Trichoderma: A mitosporic fungal genus frequently found in soil and on wood. It is sometimes used for controlling pathogenic fungi. Its teleomorph is HYPOCREA.Clostridium thermocellum: A species of gram-positive, thermophilic, cellulolytic bacteria in the family Clostridaceae. It degrades and ferments CELLOBIOSE and CELLULOSE to ETHANOL in the CELLULOSOME.GlucosidesSubstrate Specificity: A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.Glycoside HydrolasesGlucosyltransferases: Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.Mitosporic Fungi: A large and heterogenous group of fungi whose common characteristic is the absence of a sexual state. Many of the pathogenic fungi in humans belong to this group.Trisaccharides: Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.Carboxymethylcellulose Sodium: A cellulose derivative which is a beta-(1,4)-D-glucopyranose polymer. It is used as a bulk laxative and as an emulsifier and thickener in cosmetics and pharmaceuticals and as a stabilizer for reagents.Carbohydrate Metabolism: Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.XyloseRhodothermus: A genus of obligately aerobic, thermophilic, gram-negative bacteria in the family Crenotrichaceae. They were isolated from submarine alkaline HOT SPRINGS in Iceland.Polyporaceae: A family of bracket fungi, order POLYPORALES, living in decaying plant matter and timber.Rumen: The first stomach of ruminants. It lies on the left side of the body, occupying the whole of the left side of the abdomen and even stretching across the median plane of the body to the right side. It is capacious, divided into an upper and a lower sac, each of which has a blind sac at its posterior extremity. The rumen is lined by mucous membrane containing no digestive glands, but mucus-secreting glands are present in large numbers. Coarse, partially chewed food is stored and churned in the rumen until the animal finds circumstances convenient for rumination. When this occurs, little balls of food are regurgitated through the esophagus into the mouth, and are subjected to a second more thorough mastication, swallowed, and passed on into other parts of the compound stomach. (From Black's Veterinary Dictionary, 17th ed)Metabolic Engineering: Methods and techniques used to genetically modify cells' biosynthetic product output and develop conditions for growing the cells as BIOREACTORS.Kinetics: The rate dynamics in chemical or physical systems.Glucose: A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.Gram-Positive Asporogenous Rods: A gram-positive, non-spore-forming group of bacteria comprising organisms that have morphological and physiological characteristics in common.Hydrogen-Ion Concentration: The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Maltose: A dextrodisaccharide from malt and starch. It is used as a sweetening agent and fermentable intermediate in brewing. (Grant & Hackh's Chemical Dictionary, 5th ed)Hydrolysis: The process of cleaving a chemical compound by the addition of a molecule of water.Xylans: Polysaccharides consisting of xylose units.Culture Media: Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.Anaerobiosis: The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)ArbutinCellvibrio: A genus of aerobic, gram-negative, motile, slightly curved, rod-shaped bacteria. (From Bergey's Manual of Determinative Bacteriology, 9th ed)Lewis Acids: Any chemical species which accepts an electron-pair from a LEWIS BASE in a chemical bonding reaction.Catalysis: The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.Electronic Mail: Messages between computer users via COMPUTER COMMUNICATION NETWORKS. This feature duplicates most of the features of paper mail, such as forwarding, multiple copies, and attachments of images and other file types, but with a speed advantage. The term also refers to an individual message sent in this way.Electrochemistry: The study of chemical changes resulting from electrical action and electrical activity resulting from chemical changes.Phosphorylases: A class of glucosyltransferases that catalyzes the degradation of storage polysaccharides, such as glucose polymers, by phosphorolysis in animals (GLYCOGEN PHOSPHORYLASE) and in plants (STARCH PHOSPHORYLASE).Animal Nutrition Sciences: The study of NUTRITION PROCESSES, as well as the components of food, their actions, interaction, and balance in relation to health and disease in animals.

Characterization and cloning of celR, a transcriptional regulator of cellulase genes from Thermomonospora fusca. (1/307)

CelR, a protein that regulates transcription of cellulase genes in Thermomonospora fusca (Actinomycetaceae) was purified to homogeneity. A 6-kilobase NotI-SacI fragment of T. fusca DNA containing the celR gene was cloned into Esherichia coli and sequenced. The celR gene encodes a 340-residue polypeptide that is highly homologous to members of the GalR-LacI family of bacterial transcriptional regulators. CelR specifically binds to a 14-base pair inverted repeat, which has sequence similarity to the binding sites of other family members. This site is present in regions upstream of all six cellulase genes in T. fusca. The binding of CelR to the celE promoter is inhibited specifically by low concentrations of cellobiose (0.2-0.5 mM), the major end product of cellulases. The other sugars tested did not affect binding at equivalent or 50-fold higher concentrations. The results suggest that CelR may act as a repressor, and that the mechanism of induction involves a direct interaction of CelR with cellobiose.  (+info)

Growth of Azospirillum irakense KBC1 on the aryl beta-glucoside salicin requires either salA or salB. (2/307)

The rhizosphere nitrogen-fixing bacterium Azospirillum irakense KBC1 is able to grow on pectin and beta-glucosides such as cellobiose, arbutin, and salicin. Two adjacent genes, salA and salB, conferring beta-glucosidase activity to Escherichia coli, have been identified in a cosmid library of A. irakense DNA. The SalA and SalB enzymes preferentially hydrolyzed aryl beta-glucosides. A Delta(salA-salB) A. irakense mutant was not able to grow on salicin but could still utilize arbutin, cellobiose, and glucose for growth. This mutant could be complemented by either salA or salB, suggesting functional redundancy of these genes in salicin utilization. In contrast to this functional homology, the SalA and SalB proteins, members of family 3 of the glycosyl hydrolases, show a low degree of amino acid similarity. Unlike SalA, the SalB protein exhibits an atypical truncated C-terminal region. We propose that SalA and SalB are representatives of the AB and AB' subfamilies, respectively, in glycosyl hydrolase family 3. This is the first genetic implication of this beta-glucosidase family in the utilization of beta-glucosides for microbial growth.  (+info)

Carbon and electron flow in Clostridium cellulolyticum grown in chemostat culture on synthetic medium. (3/307)

Previous results indicated poor sugar consumption and early inhibition of metabolism and growth when Clostridium cellulolyticum was cultured on medium containing cellobiose and yeast extract. Changing from complex medium to a synthetic medium had a strong effect on (i) the specific cellobiose consumption, which was increased threefold; and (ii) the electron flow, since the NADH/NAD+ ratios ranged from 0.29 to 2.08 on synthetic medium whereas ratios as high as 42 to 57 on complex medium were observed. These data indicate a better control of the carbon flow on mineral salts medium than on complex medium. By continuous culture, it was shown that the electron flow from glycolysis was balanced by the production of hydrogen gas, ethanol, and lactate. At low levels of carbon flow, pyruvate was preferentially cleaved to acetate and ethanol, enabling the bacteria to maximize ATP formation. A high catabolic rate led to pyruvate overflow and to increased ethanol and lactate production. In vitro, glyceraldehyde-3-phosphate dehydrogenase, lactate dehydrogenase, and ethanol dehydrogenase levels were higher under conditions giving higher in vivo specific production rates. Redox balance is essentially maintained by NADH-ferredoxin reductase-hydrogenase at low levels of carbon flow and by ethanol dehydrogenase and lactate dehydrogenase at high levels of carbon flow. The same maximum growth rate (0.150 h-1) was found in both mineral salts and complex media, proving that the uptake of nutrients or the generation of biosynthetic precursors occurred faster than their utilization. On synthetic medium, cellobiose carbon was converted into cell mass and catabolized to produce ATP, while on complex medium, it served mainly as an energy supply and, if present in excess, led to an accumulation of intracellular metabolites as demonstrated for NADH. Cells grown on synthetic medium and at high levels of carbon flow were able to induce regulatory responses such as the production of ethanol and lactate dehydrogenase.  (+info)

Cellobiose transport by mixed ruminal bacteria from a Cow. (4/307)

The transport of cellobiose in mixed ruminal bacteria harvested from a holstein cow fed an Italian ryegrass hay was determined in the presence of nojirimycin-1-sulfate, which almost inhibited cellobiase activity. The kinetic parameters of cellobiose uptake were 14 microM for the Km and 10 nmol/min/mg of protein for the Vmax. Extracellular and cell-associated cellobiases were detected in the rumen, with both showing higher Vmax values and lower affinities than those determined for cellobiose transport. The proportion of cellobiose that was directly transported before it was extracellularly degraded into glucose increased as the cellobiose concentration decreased, reaching more than 20% at the actually observed levels of cellobiose in the rumen, which were less than 0.02 mM. The inhibitor experiment showed that cellobiose was incorporated into the cells mainly by the phosphoenolpyruvate phosphotransferase system and partially by an ATP-dependent and proton-motive-force-independent active transport system. This finding was also supported by determinations of phosphoenolpyruvate phosphotransferase-dependent NADH oxidation with cellobiose and the effects of artificial potentials on cellobiose transport. Cellobiose uptake was sensitive to a decrease in pH (especially below 6.0), and it was weakly but significantly inhibited in the presence of glucose.  (+info)

Characterization of the binding protein-dependent cellobiose and cellotriose transport system of the cellulose degrader Streptomyces reticuli. (5/307)

Streptomyces reticuli has an inducible ATP-dependent uptake system specific for cellobiose and cellotriose. By reversed genetics a gene cluster encoding components of a binding protein-dependent cellobiose and cellotriose ABC transporter was cloned and sequenced. The deduced gene products comprise a regulatory protein (CebR), a cellobiose binding lipoprotein (CebE), two integral membrane proteins (CebF and CebG), and the NH2-terminal part of an intracellular beta-glucosidase (BglC). The gene for the ATP binding protein MsiK is not linked to the ceb operon. We have shown earlier that MsiK is part of two different ABC transport systems, one for maltose and one for cellobiose and cellotriose, in S. reticuli and Streptomyces lividans. Transcription of polycistronic cebEFG and bglC mRNAs is induced by cellobiose, whereas the cebR gene is transcribed independently. Immunological experiments showed that CebE is synthesized during growth with cellobiose and that MsiK is produced in the presence of several sugars at high or moderate levels. The described ABC transporter is the first one of its kind and is the only specific cellobiose/cellotriose uptake system of S. reticuli, since insertional inactivation of the cebE gene prevents high-affinity uptake of cellobiose.  (+info)

Microbial reduction of Fe(III) in acidic sediments: isolation of Acidiphilium cryptum JF-5 capable of coupling the reduction of Fe(III) to the oxidation of glucose. (6/307)

To evaluate the microbial populations involved in the reduction of Fe(III) in an acidic, iron-rich sediment, the anaerobic flow of supplemental carbon and reductant was evaluated in sediment microcosms at the in situ temperature of 12 degrees C. Supplemental glucose and cellobiose stimulated the formation of Fe(II); 42 and 21% of the reducing equivalents that were theoretically obtained from glucose and cellobiose, respectively, were recovered in Fe(II). Likewise, supplemental H(2) was consumed by acidic sediments and yielded additional amounts of Fe(II) in a ratio of approximately 1:2. In contrast, supplemental lactate did not stimulate the formation of Fe(II). Supplemental acetate was not consumed and inhibited the formation of Fe(II). Most-probable-number estimates demonstrated that glucose-utilizing acidophilic Fe(III)-reducing bacteria approximated to 1% of the total direct counts of 4', 6-diamidino-2-phenylindole-stained bacteria. From the highest growth-positive dilution of the most-probable-number series at pH 2. 3 supplemented with glucose, an isolate, JF-5, that could dissimilate Fe(III) was obtained. JF-5 was an acidophilic, gram-negative, facultative anaerobe that completely oxidized the following substrates via the dissimilation of Fe(III): glucose, fructose, xylose, ethanol, glycerol, malate, glutamate, fumarate, citrate, succinate, and H(2). Growth and the reduction of Fe(III) did not occur in the presence of acetate. Cells of JF-5 grown under Fe(III)-reducing conditions formed blebs, i.e., protrusions that were still in contact with the cytoplasmic membrane. Analysis of the 16S rRNA gene sequence of JF-5 demonstrated that it was closely related to an Australian isolate of Acidiphilium cryptum (99.6% sequence similarity), an organism not previously shown to couple the complete oxidation of sugars to the reduction of Fe(III). These collective results indicate that the in situ reduction of Fe(III) in acidic sediments can be mediated by heterotrophic Acidiphilium species that are capable of coupling the reduction of Fe(III) to the complete oxidation of a large variety of substrates including glucose and H(2).  (+info)

Identification of Ruminococcus flavefaciens as the predominant cellulolytic bacterial species of the equine cecum. (7/307)

Detection and quantification of cellulolytic bacteria with oligonucleotide probes showed that Ruminococcus flavefaciens was the predominant species in the pony and donkey cecum. Fibrobacter succinogenes and Ruminococcus albus were present at low levels. Four isolates, morphologically resembling R. flavefaciens, differed from ruminal strains by their carbohydrate utilization and their end products of cellobiose fermentation.  (+info)

The bvr locus of Listeria monocytogenes mediates virulence gene repression by beta-glucosides. (8/307)

The beta-glucoside cellobiose has been reported to specifically repress the PrfA-dependent virulence genes hly and plcA in Listeria monocytogenes NCTC 7973. This led to the hypothesis that beta-glucosides, sugars of plant origin, may act as signal molecules, preventing the expression of virulence genes if L. monocytogenes is living in its natural habitat (soil). In three other laboratory strains (EGD, L028, and 10403S), however, the effect of cellobiose was not unique, and all fermentable carbohydrates repressed hly. This suggested that the downregulation of virulence genes by beta-glucosides is not a specific phenomenon but, rather, an aspect of a global regulatory mechanism of catabolite repression (CR). We assessed the effect of carbohydrates on virulence gene expression in a panel of wild-type isolates of L. monocytogenes by using the PrfA-dependent phospholipase C gene plcB as a reporter. Utilization of any fermentable sugar caused plcB repression in wild-type L. monocytogenes. However, an EGD variant was identified in which, as in NCTC 7973, plcB was only repressed by beta-glucosides. Thus, the regulation of L. monocytogenes virulence genes by sugars appears to be mediated by two separate mechanisms, one presumably involving a CR pathway and another specifically responding to beta-glucosides. We have identified in L. monocytogenes a 4-kb operon, bvrABC, encoding an antiterminator of the BglG family (bvrA), a beta-glucoside-specific enzyme II permease component of the phosphoenolpyruvate-sugar phosphotransferase system (bvrB), and a putative ADP-ribosylglycohydrolase (bvrC). Low-stringency Southern blots showed that this locus is absent from other Listeria spp. Transcription of bvrB was induced by cellobiose and salicin but not by arbutin. Disruption of the bvr operon by replacing part of bvrAB with an interposon abolished the repression by cellobiose and salicin but not that by arbutin. Our data indicate that the bvr locus encodes a beta-glucoside-specific sensor that mediates virulence gene repression upon detection of cellobiose and salicin. Bvr is the first sensory system found in L. monocytogenes that is involved in environmental regulation of virulence genes.  (+info)

*Cellobiose

... is a disaccharide with the formula C12H22O11. Cellobiose, a reducing sugar, consists of two β-glucose molecules ... Cellobiose has eight free alcohol (OH) groups, one acetal linkage and one hemiacetal linkage, which give rise to strong inter- ... Treatment of cellulose with acetic anhydride and sulfuric acid, gives cellobiose octoacetate, which is no longer a hydrogen ... Cancerweb.ncl.ac.uk Braun, G. (1943). "α-Cellobiose Octaacetate" (PDF). Organic Syntheses. Collected Volume 2: 124. and Braun, ...

*Cellobiose phosphorylase

In enzymology, a cellobiose phosphorylase (EC 2.4.1.20) is an enzyme that catalyzes the chemical reaction cellobiose + ... The systematic name of this enzyme class is cellobiose:phosphate alpha-D-glucosyltransferase. This enzyme participates in ... AYERS WA (1959). "Phosphorolysis and synthesis of cellobiose by cell extracts from Ruminococcus flavefaciens". J. Biol. Chem. ... Alexander JK (1968). "Purification and specificity of cellobiose phosphorylase from Clostridium thermocellum". J. Biol. Chem. ...

*Cellobiose epimerase

In enzymology a cellobiose epimerase (EC 5.1.3.11) is an enzyme that catalyzes the chemical reaction cellobiose ⇌ {\ ... The systematic name of this enzyme class is cellobiose 2-epimerase. Enzymes like these can produce a more rapid syndrome that ... displaystyle \rightleftharpoons } D-glucosyl-D-mannose Hence, this enzyme has one substrate, cellobiose, and one product, D- ...

*Cellobiose dehydrogenase (acceptor)

... cellobiose oxidoreductase, Phanerochaete chrysosporium cellobiose oxidoreductase, CBOR, cellobiose oxidase, cellobiose:oxygen 1 ... The systematic name of this enzyme class is cellobiose:acceptor 1-oxidoreductase. Other names in common use include cellobiose ... In enzymology, a cellobiose dehydrogenase (acceptor) (EC 1.1.99.18) is an enzyme that catalyzes the chemical reaction ... "Cellobiose:Quinone Oxidoreductase, a New Wood-degrading Enzyme from White-rot Fungi". Acta Chemica Scandinavica. 28b: 209-214. ...

*Beta-glucoside kinase

Phosphorylation of cellobiose with adenosine 5'-triphosphate by a -glucoside kinase". J. Biol. Chem. 247 (11): 3415-9. PMID ... The systematic name of this enzyme class is ATP:cellobiose 6-phosphotransferase. This enzyme is also called beta-D-glucoside ... In enzymology, a beta-glucoside kinase (EC 2.7.1.85) is an enzyme that catalyzes the chemical reaction ATP + cellobiose ⇌ {\ ... the two substrates of this enzyme are ATP and cellobiose, whereas its two products are ADP and 6-phospho-beta-D-glucosyl-(1,4)- ...

*6-phospho-beta-glucosidase

Palmer RE, Anderson RL (1972). "Cellobiose metabolism in Aerobacter aerogenes. 3. Cleavage of cellobiose monophosphate by a ...

*Glucose-methanol-choline oxidoreductase family

Henriksson G, Johansson G, Pettersson G (March 2000). "A critical review of cellobiose dehydrogenases". J. Biotechnol. 78 (2): ... EC 1.1.3.13 and cellobiose dehydrogenase EC 1.1.99.18 which share a number of regions of sequence similarities. They contain ...

*Cellulosilyticum lentocellum

... produces Cellobiose 2-Epimerase. Parte, A.C. "Cellulosilyticum". www.bacterio.net. " ...

*Pycnoporus

"Cloning and analysis of Pycnoporus cinnabarinus cellobiose dehydrogenase". Gene. 234 (1): 23-33. doi:10.1016/S0378-1119(99) ...

*Devendra Prasad Gupta

doi:10.1016/S0007-1536(72)80067-6. Heale, J. B.; Gupta, D. P. (1970). "The Utilization of Cellobiose by Verticillium albo-atrum ... Heale, JB; Gupta, DP (1970). "The utilization of cellobiose by Verticillium albo-atrum". Journal of General Microbiology. UK: ...

*Starch

In this cell-free biosystem, beta-1,4-glycosidic bond-linked cellulose is partially hydrolyzed to cellobiose. Cellobiose ...

*Arthrobotrys oligospora

When predating on nematodes, the fungus uses cellobiose, L-asparagine, L-arginine, DL glutamic acid for its carbon and nitrogen ... Saprophytic growth uses D-xylose, D-mannose, and cellobiose. The fungus uses nitrite, nitrate, and ammonium for its nitrogen ...

*Ustilagic acid

Cellobiose lipids are known as biosurfactants and natural detergents. They can be used in pharmaceutical, cosmetic, and food ... The acid is a cellobiose lipid produced by the corn smut fungus Ustilago maydis under conditions of nitrogen starvation. The ... Similar compounds are the extracellular cellobiose lipids of the yeasts Cryptococcus humicola and Trichosporon porosum : 2,3,4- ...

*Clostridium clariflavum

nov., moderately thermophilic, cellulose-/cellobiose-digesting bacteria isolated from methanogenic sludge". International ...

*Géza Zemplén

Ért.) "Verhalten der Cellobiose u. ihres Osons gegen einige Enzyme" (with Emil Fischer; Berlin, 1909-10; Liebig's Annalen, and ... "Einige Derivate der Cellobiose" (with Emil Fischer; Budapest, 1911; Berichte der deutschen Chemischen Gesellschaft) "Studien ...

*Cellulase

Oxidative cellulases depolymerize cellulose by radical reactions, as for instance cellobiose dehydrogenase (acceptor). ... such as cellobiose. Exocellulases are further classified into type I, that work processively from the reducing end of the ...

*Enterobacter taylorae

They ferment D-glucose and also ferment D-mannitol, L-rhamnose and cellobiose. They are negative for indole production, urea ...

*PTS Lactose-N,N'-Diacetylchitobiose Family

The former can transport aromatic β-glucosides and cellobiose, as well as Chb. However, only Chb induces expression of the chb ...

*Glycosidic bond

investigated use of Cellobiose Phosphorylase (CP) toward synthesis of alpha-glycosides in ionic liquids. The best condition for ... ISBN 978-0-470-74859-6. Chemoenzymatic Synthesis of b-d-Glucosides using Cellobiose Phosphorylase from Clostridium thermocellum ...

*Candida tropicalis

negative for F7 Melibiose, F8 Lactose, F9 Cellobiose, F11 Raffinose, F12 Inulin, F14 D-xylose. negative delay after 7 dyas for ...

*Disaccharide

Maltose, cellobiose, and chitobiose are hydrolysis products of the polysaccharides starch, cellulose, and chitin, respectively ... cellobiose and maltose are examples of reducing disaccharides, each with one hemiacetal unit, the other occupied by the ...

*Exoglucanase

... cellobiose. Research suggests, however, that the activity of CBH1 is very strong inhibited by the product, cellobiose. ... Determination of an enzyme that is not as strongly inhibited by the product or finding a way to remove cellobiose from the ... it is strung through a tunnel-shaped active site where the cellulose is broken down into two-sugar segments called cellobiose. ...

*Staphylococcus sciuri

sciuri was originally used to categorize 35 strains shown to use cellobiose, galactose, sucrose, and glycerol. Kloos, W. E.; ...

*PEP group translocation

... fructose and cellobiose. PTS sugars can differ between bacterial groups, mirroring the most suitable carbon sources available ...

*Cigarette filter

Cellulose may be further hydrolyzed to cellobiose or glucose in an acidic medium, and eventually form valuable humus. Humans ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
We propose to develop a cell-specific isotope labeling technology to study cancer metabolism and metabolite exchange in the intact animal. Our technology addresses a major limitation of most metabolomic studies on cancer, namely that they have been mostly performed on simple cell-culture systems. The metabolic interactions of a cancer cell with its environment have been largely ignored and remain uncharacterized. This is because current metabolomic technologies cannot resolve metabolites from each of the various cell types of a mixed culture or tissue. Therefore, current approaches cannot measure metabolite exchange between tumors and their neighboring cells. Yet, these interactions have been suggested to define tumor phenotype. We exploit the fact that vertebrate cells do not take up or utilize the carbohydrate cellobiose. Cellobiose consists of two glucose molecules joined by a á-linkage. We will genetically engineer human fibroblast and HeLa cell lines that can take up and digest ...
Cellulose, Biomass, Cellobiose, Concentration, Glucose, Hydrolysis, Inhibition, Ethanol, Achievement, Bioreactor, Cellulase, Kinetics, Nature, Paper, Enzyme Stability, Enzymes, Membrane, Membranes, Set
It catalyzes an exceptionally high rate of oxidation of a wide range of aldose sugars, including D-glucose, galactose, arabinose and xylose, and also the disaccharides lactose, cellobiose and maltose ...
Arabinose, Acetic Acid, Acids, Cellobiose, Concentration, Concentrations, Furfural, Glucose, Membrane, Membranes, Molecular Weight, PH, Polyamide, Polyethylene, Rice, Separation, Sugars, Xylose
We provide here the underlying data of the scientific publication Product solubility control in cellooligosaccharide production by coupled cellobiose and cellodextrin phosphorylase. Please find the abstract below: Soluble cellodextrins (linear β‐1,4‐D‐gluco‐oligosaccharides) have interesting applications as ingredients for human and animal nutrition. Their bottom‐up synthesis from glucose is promising for bulk production, but to ensure a completely watersoluble product via degree of polymerization (DP) control (DP ≤ 6) is challenging. Here, we show biocatalytic production of cellodextrins with DP centered at 3 to 6 (~96 wt.% of total product) using coupled cellobiose and cellodextrin phosphorylase. The cascade reaction, wherein glucose was elongated sequentially from α‐glucose 1‐phosphate (αGlc1‐P), required optimization and control at two main points. First, kinetic and thermodynamic restrictions upon αGlc1‐P utilization (200 mM; 45°C, pH 7.0) were effectively overcome (53%
Ustilagic acid is an organic compound with the formula C36H64O18. The acid is a cellobiose lipid produced by the corn smut fungus Ustilago maydis under conditions of nitrogen starvation. The acid was discovered in 1950 and was proved to be an amphipathic glycolipid with surface active properties. The name comes from Latin ustus which means burnt and refers to the scorched appearance of the smut fungi. Cellobiose lipids are known as biosurfactants and natural detergents. They can be used in pharmaceutical, cosmetic, and food applications and are known for their strong fungicidal activity on many species.The yeast Pseudozyma fusiformata and Pseudozyma graminicola secrete ustilagic acids, 2-O-3-hydroxyhexanoyl-beta-D-glucopyranosyl-(1→4)-6-O-acetyl-beta-D-glucopyranosyl-(1→16)-2,15,16- trihydroxyhexadecanoic acid. Similar compounds are the extracellular cellobiose lipids of the yeasts Cryptococcus humicola and Trichosporon porosum : ...
Biodegradable plastics can be made from polylactate, which is a polymer made from lactic acid. This compound can be produced from renewable resources as substrates using microorganisms. Bacillus subtilis is a Gram-positive bacterium recognized as a GRAS microorganism (g enerally r egarded a s s afe) by the FDA. B. subtilis produces and secretes different kind of enzymes, such as proteases, cellulases, xylanases and amylases to utilize carbon sources more complex than the monosaccharides present in the environment. Thus, B. subtilis could be potentially used to hydrolyze carbohydrate polymers contained in lignocellulosic biomass to produce chemical commodities. Enzymatic hydrolysis of the cellulosic fraction of agroindustrial wastes produces cellobiose and a lower amount of glucose. Under aerobic conditions, B. subtilis grows using cellobiose as substrate. In this study, we proved that under non-aerated conditions, B. subtilis ferments cellobiose to produce L-lactate with 82% of the theoretical yield,
Two intracellular enzymes, cellobiose phosphorylase (CBP) and cellodextrin phosphorylase (CDP) are involved in the phosphorolytic pathway in cellulose degradation. Those enzymes are considered to be useful in syntheses of oligosaccharides because the reactions are reversible. CBP from Cellvibrio gilvus and Clostridium thermocellum YM4, and CDP from C. thermocellum YM4 were cloned and over-expressed in Escherichia coli. All the three enzymes showed ordered bi bi mechanism. However the orders of the substrate binding of the CBPs were different. It was found that CBP from C. gilvus strictly recognized the hydroxyl groups at positions β-1, 3, and 4 of the acceptor molecule in the reverse reaction. On the other hand, the recognition of the hydroxyl groups at positions 2 and 6 was not so strict. Three branched β-1, 4-glucosyl trisaccharides were synthesized by using the reverse reaction of C. gilvus CBP. A new substrate inhibition pattern, competitive substrate inhibition, was also found in the ...
Clostridium termitidis CT1112 is an anaerobic, Gram-positive, mesophilic, spore-forming, cellulolytic bacterium, originally isolated from the gut of a wood feeding termite Nasusitermes lujae. It has the ability to hydrolyze both cellulose and hemicellulose, and ferment the degradation products to acetate, formate, ethanol, lactate, H2, and CO2. It is therefore ges in gene and gene product expression during growth of C. termitidis on cellobiose, xylose, xylan, and α-cellulose. Correlation of transcriptome and proteome data with growth and fermentation profiles identified putative carbon-catabolism pathways in C. termitidis. The majority of the proteins associated with central metabolism were detected in high abundance. While major differences were not observed in gene and gene-product expression for enzymes associated with metabolic pathways under the different substrate conditions, xylulokinase and xylose isomerase of the pentose phosphate pathway were found to be highly up
AA3 enzymes belong to the glucose-methanol-choline (GMC) oxidoreductases family. AA3 enzymes are flavoproteins containing a flavin-adenine dinucleotide (FAD)-binding domain. Family AA3 can be divided into 4 subfamilies: AA3_1 (mostly cellobiose dehydrogenases), AA3_2 (including both aryl alcohol oxidase and glucose 1-oxidase), AA3_3 (alcohol oxidase) and AA3_4 (pyranose 2-oxidase ...
Heteropolyacids (H3PW12O40, H4SiW12O40) and salts of metal cations (Mn+) and PW12O403− (M3/nPW12O40) act as effective homogeneous catalysts for selective hydrolysis of cellobiose and cellulose to glucose and total reducing sugars (TRS), respectively, in an aqueous phase. For Brønsted acid catalysts,
Cytophaga hutchinsonii can rapidly digest crystalline cellulose without free cellulases or cellulosomes. Its cell-contact cellulose degradation mechanism is unknown. In this study, the four β-glucosidase (bgl) genes in C. hutchinsonii were singly and multiply deleted, and the functions of these β-glucosidases in cellobiose and cellulose degradation were investigated. We found that the constitutively expressed BglB played a key role in cellobiose utilization, while BglA which was induced by cellobiose could partially make up for the deletion of bglB. The double deletion mutant ΔbglA/bglB lost the ability to digest cellobiose and could not thrive in cellulose medium, indicating that β-glucosidases were important for cellulose degradation. When cultured in cellulose medium, a small amount of glucose accumulated in the medium in the initial stage of growth for the wild type, while almost no glucose accumulated for ΔbglA/bglB. When supplemented with a small amount of glucose, ΔbglA/bglB started to
WBGene00001198 not CELE_ in pgid 348 WBGene00001198 not CELE_ in pgid 350 WBGene00001198 not CELE_ in pgid 351 WBGene00001198 not CELE_ in pgid 352 WBGene00002126 not CELE_ in pgid 1424 WBGene00009821 not CELE_ in pgid 1520 WBGene00012263 not CELE_ in pgid 2914 WBGene00043408 not CELE_ in pgid 2914 WBGene00009175 not CELE_ in pgid 2914 WBGene00016878 not CELE_ in pgid 2914 WBGene00020512 not CELE_ in pgid 2914 WBGene00019252 not CELE_ in pgid 2914 WBGene00015732 not CELE_ in pgid 3033 WBGene00003454 not CELE_ in pgid 3330 WBGene00003440 not CELE_ in pgid 3330 WBGene00003441 not CELE_ in pgid 3330 WBGene00003427 not CELE_ in pgid 3330 WBGene00003461 not CELE_ in pgid 3330 WBGene00003459 not CELE_ in pgid 3330 WBGene00003428 not CELE_ in pgid 3330 WBGene00003447 not CELE_ in pgid 3330 WBGene00003455 not CELE_ in pgid 3330 WBGene00003453 not CELE_ in pgid 3330 WBGene00003436 not CELE_ in pgid 3330 WBGene00003439 not CELE_ in pgid 3330 WBGene00023572 not CELE_ in pgid 4733 WBGene00023572 not CELE_ ...
Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. Is also able to hydrolyze phospho-N,N-diacetylchitobiose.
And again, you drink a solution of lactulose and mannitol sugars. . than one child will tell you, just like adults, babies have preferences and likes and dislikes. . is usually in turn caused by nutrient deficiencies, specifically iron, folate, B12,
bsr:I33_4084 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) beta-glucosidase (A) MSSNAKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPYDESMTSLNLYHN GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLSFYDDLFDELLKHH IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL HAPFTGGGLVFEEGENKRNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY QKPLFIVENGLGAVDKVEDDGTIQDDYRINYLRDHLIEVREAIADGVELIGYTSWGPIDL VSASTAEMKKRYGFIYVDRDNEGNGTLNRIKKKSFIWYQQVIATNGESI ...
kpu:KP1_1806 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) putative family 1 glycoside hydrolase (A) MTSHIPRRSMKNRLPADFLWGNSVSSMQTEGAWNEGGKGMSVYDIRQPAEFASDWKVATD SYHRYREDFDLMQDLGMNCYRFQIAWSRVCPDGDGEFNEQGIAFYHQFIDELIARGIEPM ICLYHFDMPLSLAERYNGFTDRRVMDAFIRYGQKMIACYGDKVKYWLTFNEQNLYHSPEA FLISGYLQGEKTLRELYLIQHHVMMAHVHLTHYLHQTKPQCLMGGMLAHALVYPATCKPR DILCAQQLDEFLNQNLLRAYAGEGYSPEVMHFVAAEGFDDIYRPEDLALMATVKVDYLAF SFYASRTLNSDAIPPGTAVNNYMLFGNQDNPFLKATEWNWQIDPLGFRTIITRYYNDWRL PVFPIENGIGVIESWDGEHPIADDYRIAYHRDHINAMKAAIFEDGAQVIGYLGWGLIDIL SSQGDMRKRYGVVYVNRENHDLKDLRRVPKKSYAWLKQVFRSNGEAM ...
Complete information for CELSR3 gene (Protein Coding), Cadherin EGF LAG Seven-Pass G-Type Receptor 3, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Today Leerink is publishing its second of two notes on Celgene Corporations (NASDAQ:CELG) ozanimod that focuses on the products value; in its current forecast the firm estimates that ozanimod is worth $19/ share (13% of its PT) in the base case scen
SUMMIT, N.J.--(BUSINESS WIRE)--Oct. 24, 2013-- Celgene Corporation (NASDAQ:CELG) reported third quarter 2013 total revenue of $1,674 million compared to $1,419 million in the third quarter 2012. Net product sales were $1,644 million, an 18 perce...
SUMMIT, N.J.--(BUSINESS WIRE)-- Celgene Corporation (NASDAQ:CELG) today announced more than 65 presentations reporting on investigational studies in blood and solid tumor cancers will be pres...
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Isolation and characterization of Selenomonas ruminantium strains capable of 2-deoxyribose utilization
Effects of kraft pulp and lignin on Trametes versicolor carbon metabolism. Purification and characterization of cellobiose dehydrogenases from the white rot fungus Trametes versicolor
TY - GEN. T1 - Enhanced xylitol production through simultaneous co-consumption of cellobiose and xylose by an engineereed saccharomyces cerevisiae strain. AU - Oh, Eun Joong. AU - Ha, Suk Jin. AU - Kim, Soo Rin. AU - Galazka, Jonathan M.. AU - Cate, Jamie H.D.. AU - Su Jin, Yong. PY - 2011/1/1. Y1 - 2011/1/1. UR - http://www.scopus.com/inward/record.url?scp=85054765849&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=85054765849&partnerID=8YFLogxK. M3 - Conference contribution. AN - SCOPUS:85054765849. SN - 9781618397362. T3 - Fuels and Petrochemicals Division - Core Programming Topic at the 2011 AIChE Annual Meeting. BT - Fuels and Petrochemicals Division - Core Programming Topic at the 2011 AIChE Annual Meeting. PB - AIChE. ER - ...
1,4-β-D-Cellotriitol (borohydride reduced cellotriose) [MO-CTRRD] - CAS: 61473-64-1 Molecular Formula: C18H34O16 Molecular Weight: 506.4 Purity: | 95% High purity 1,4-β-D-Cellotriitol (borohydride reduced cellotriose) for use in research, biochemical enzyme assays and in vitro diagnostic analysis. Trisaccharides from hydrolysis of cellulose and borohydride reduced. Store at room temperature.
tr:B2VKZ2_ERWT9] bglA; BglA protein, 6-phospho-beta-glucosidase (involved in beta-glucoside utilization); K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] ...
... Glucose-based Polymeric Fibres. The cellulose is an organic compound of polymeric nature. The reaction of the condensation of D-Glucose monomers gives rise to the synthesis of a linear macromolecule (polymer). The glucose molecules are united by a glyosidic bond called beta (1-4) that connects the site 1 of a unity with the site 4 of the following unit with the OH equatorial anomeric.. The partial cell hydrolysis creates a cellobiose, made of two glucose units always with beta bond (1-4). Unlike the cellulose, the starch has alfa glyosidic bonds. The mammals have enzymes (amylases) that can hydrolyse only the alfa bond. Therefore they can metabolize the starch but not the cellulose.. The cellulose does not have a homogeneous chemical-physical structure, in fact we can distinguish phases with a different crystallization grade. The presence of many OH-groups entails the formation of many hydrogen bonds among different sites of the polymeric chain and therefore supports the ...
This record was replaced or removed. The sequence YP_006173076 is 100% identical to WP_000012618.1 over its full length. Be aware that a NCBI nonredundant RefSeq protein (WP_) can be annotated on large numbers of bacterial genomes that encode that identical protein.. Old YP_006173076.1 New WP_000012618.1 Identical proteins Re-annotation project. ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
In enzymology, a 6-phospho-beta-glucosidase (EC 3.2.1.86) is an enzyme that catalyzes the chemical reaction: 6-phospho-beta-D-glucosyl-(1,4)-D-glucose + H2O → D-glucose
1J83: Recognition of cello-oligosaccharides by a family 17 carbohydrate-binding module: an X-ray crystallographic, thermodynamic and mutagenic study.
Costurile Arbitrajului comparativ cu cele din instanța de drept comun - între mit și realitate Author: Alina Cobuz Băgnaru, Partener Fondator, Cobuz şi Asociaţii S-a subliniat în numeroase rânduri că unul din avantajele arbitrajului este și costul scăzut al acestei proceduri, în comparație cu costurile din instanța de drept comun. Această afirmație trebuie analizată…
A novel type of model substrates, i.e. immobilized p-aminophenyl-β-D-cellooligosaccharides, was developed and used in the study of exocellulases. The two major cellobiohydrolases from Trichoderma reesei, CBH I and CBH II were used as representative enzymes. p-Aminophenyl derivatives of cellobiose (PAPG₂), cellotriose (PAPG₃), and cellotetraose (PAPG₄) were synthesized from the reaction of p-nitrophenol and peracetylated glycosyl bromide of the corresponding cellooligosaccharides under the phase-transfer catalyzed conditions, followed by deacetylation and catalytic hydrogenation. p-Aminophenyl cellooligosaccharides were then tethered via their amino functional groups to N-hydroxy succinimide-activated agarose. The ability of CBH I and CBH II to associate with and catalyze the hydrolysis of reducing end tethered cellooligosaccharides was tested. CBH I catalyzed the hydrolysis of free PAPG₂ but CBH II did not. Both CBH I and CBH II reversibly bound, but did not hydrolyze, immobilized ...
Coloured scanning electron micrograph (SEM) of Cellulose degrading rumen bacterium Fibrobacter succinogenes. Fibrobacter succinogenes, also known as Bacteroides succinogenes, is one of the most important cellulolytic bacterium (cellulose degrading bacteria) in animal intestinal tracts (rumen). Herbivorous ruminant animals have a complex stomach divided into chambers. One chamber, the rumen, contains symbiotic bacteria that break down cellulose in plants, making plant matter digestible. F. succinogenes actively adheres to cellulose. F. succinogenes produces both a series of cellulose-binding proteins, some of which have endoglucanase activity and a thin glycoprotein glycocalyx that results in strong adhesion to cellulose. Fibrobacter sp. are rod shaped, obligate anaerobic, gram-negative, saccharolytic bacteria. Magnification: x3,000 when shortest axis printed at 25 millimetres. - Stock Image C032/2319
Cellulases have numerous applications in several industries, including biofuel production, food and feed industry, brewing, pulp and paper, textile, laundry, and agriculture.Cellulose-degrading bacteria are widely spread in nature, being isolated from quite different environments. Cellulose degradation is the result of a synergic process between an endoglucanase, an exoglucanase and a,β-glucosidase. Bacterial endoglucanases degrade ß-1,4-glucan linkages of cellulose amorphous zones, meanwhile exoglucanases cleave the remaining oligosaccharide chains, originating cellobiose, which is hydrolyzed by ß-glucanases. Bacterial cellulases (EC 3.2.1.4) are comprised in fourteen Glycosil Hydrolase families. Several advantages, such as higher growth rates and genetic versatility, emphasize the suitability and advantages of bacterial cellulases over other sources for this group of enzymes. This review summarizes the main known cellulolytic bacteria and the best strategies to optimize their cellulase
A series of alkaline ionic liquids (ILs) including 1-butyl-3-methylimidazolium benzoate ([BMIM]PHCOO), 1-butyl-3-methylimidazolium carbonate ([BMIM]2CO3), 1-butyl-3-methylimidazolium acetate ([BMIM]OAc), 1-butyl-3-methylimidazolium hydroxide ([BMIM]OH), ethanolamine tetrafluoroborate ([MEA]BF4), and 1,1,3,3-tetramethylguanidine (TMG)-based ILs, etc., were synthesized and utilized as catalysts for the conversion of carbohydrates into 5-HMF. 1,1,3,3-tetramethylguanidine tetrafluoroborate ([TMG]BF4) was confirmed to exhibit excellent catalytic activity, and was much cheaper than other ILs such as 1-butyl-3-methylimidazolium chloride ([BMIM]Cl) for use as a solvent in the conversion of C6 carbohydrates into 5-HMF. The 5-HMF yields from fructose, glucose, cellobiose, and microcrystalline cellulose (MCC) were 74.19%, 27.33%, 20.20%, and 17.73%, respectively. In addition, the possible pathway of carbohydrates (MCC, cellobiose, glucose, etc.) conversion into 5-HMF with [TMG]BF4 as a catalyst was speculated, and
TY - JOUR. T1 - Kinetic modeling of a bi-enzymatic system for efficient conversion of lactose to lactobionic acid. AU - Van, Wouter. AU - Bhagwat, Aditya. AU - Ludwig, Roland. AU - Dewulf, Jo. AU - Haltrich, Dietmar. AU - Van Langenhove, Herman. PY - 2009/4/1. Y1 - 2009/4/1. N2 - A model has been developed to describe the interaction between two enzymes and an intermediary redox mediator. In this bi-enzymatic process, the enzyme cellobiose dehydrogenase oxidizes lactose at the C-1 position of the reducing sugar moiety to lactobionolactone, which spontaneously hydrolyzes to lactobionic acid. 2,20 Azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt is used as electron acceptor and is continuously regenerated by laccase. Oxygen is the terminal electron acceptor and is fully reduced to water by laccase, a coppercontaining oxidase. Oxygen is added to the system by means of bubble-free oxygenation. Using the model, the productivity of the process is investigated by simultaneous solution ...
The sugar oxidising enzymes glucose oxidase, glucose dehydrogenases (GDH) and cellobiose dehydrogenases (CDH) were co-immobilised, in the presence of multiwalled carbon nanotubes, with osmium redox polymers. Under pseudo-physiological conditions of 5 mM glucose, 150 mM NaCl, 37?degrees C, glucose oxidation current densities above 800 mu A?cm-2 are obtained from films containing an [Os(4,4xxx-dimethyl-2,2xxx-bipyridine)2(poly-vinylimidazole)10Cl]+ redox polymer, redox potential 0.1 V vs. Ag/AgCl, and either glucose oxidase or FAD-dependant GDH. Current produced by, and stability of, glucose-oxidising half-cells is compared in 100 mM glucose, with films containing CDHs proving most stable. Such results show promise for development of glucose-oxidising enzymatic fuel cells ...
Meruliporia incrassata ATCC ® 11236™ Designation: Madison 563 Application: fungus resistance testing produces endoglucanase Cel 25 produces endoglucanase Cel 49 produces endoglucanase Cel 57 testing wood preservatives
Addresses: Teeri TT, Kungliga Tekniska Hogskolan, Dept Biochem & Biotechnol, S-10044 Stockholm, Sweden. VTT Biotechnol & Food Res, FIN-02044 Espoo, Finland. VTT Chem Technol, FIN-02044 Espoo, Finland. BMC, Dept Biol Mol, S-75124 Uppsala, Sweden.Available from: 2008-10-17 Created: 2008-10-17 Last updated: 2011-01-14 ...
A novel cellulase-mimetic solid catalyst, sulfonated chloromethyl polystyrene resin (CP-SO3H), containing cellulose-binding sites (-Cl) and catalytic sites (-SO3H) was synthesized for hydrolyzing cellulose. Cellobiose could be completely hydrolyzed in 2-4 hours at 100-120 °C by CP-SO3H, and microcrystalline
Beta-glucosidase is a glucosidase enzyme that acts upon β1->4 bonds linking two glucose or glucose-substituted molecules (i.e., the disaccharide cellobiose). It is one o
Here we report a method for the preparation of anomerically pure β-S-glycopyranosides (1,2-trans-glycosides) from the corresponding peracetate donors. S-glycosylation was performed in CHCl3 at reflux in the presence of a catalytic amount of InBr3. Deacylation of the intermediate peracetates were achieved under Zemplén conditions. Five pyranose examples, monosaccharides D-glucose and D-galactose and disaccharides cellobiose, maltose, and lactose, were used as donors, and five thiols including an α/ω dithiol and Fmoc-L-cysteine were used as acceptors. Melting points, high res MS, [α]D and NMR data ((1)H and (13)C, including COSY, HSQC and HMBC) are reported for compounds not previously described ...
Ha S.J., Galazka J.M., Rin Kim S., Choi J.H., Yang X., Seo J.H., Louise Glass N., Cate J.H., & Jin Y.S.Engineered Saccharomyces cerevisiae capable of simultaneous cellobiose and xylose fermentation. Proc Natl Acad Sci U S A. 108, 504-509 (2011) [http://www.pnas.org/content/108/2/504.abstract Link], [http://openwetware.org/images/8/80/Ha_PNAS.pdf PDF], [http://openwetware.org/images/d/d3/Ha_PNAS_SI.pdf Supporting Information], [http://www.pnas.org/content/108/2/435.full In This Issue-PNAS], [http://www.physorg.com/news/2010-12-scientists-major-obstacles-cellulosic-biofuel.html Related News ...
Synthesis of four glycolipids with different number of lauroyl groups on glucose or cellobiose as scaffolds is described. Their immunological evaluations either admixed with or covalently linked to J8, a peptide antigen derived from the C-terminus of the antiphagocytic M-protein of group A streptococcus, are also investigated. Administration of mixtures of J8 and glycolipids to B10BR (H-2k) mice induced low-levels of J8-specific IgG antibodies. While glycolipopeptides, in which J8 was covalently linked to the synthetic glycolipids, demonstrated high-levels of antibody titers comparable with the co-administration of these glycolipopeptides with complete Freunds adjuvant, suggesting clearly the strong potency of the synthesized glycolipids as self-adjuvanting moieties ...
Nucleic acid sequences encoding chimeric polypeptides that exhibit enhanced cellulase activities are disclosed herein. These nucleic acids may be expressed in hosts such as fungi, which in turn may be cultured to produce chimeric polypeptides. Also disclosed are chimeric polypeptides and their use in the degradation of cellulosic materials.
Dupa ce a suferit o tragedie in familie , Mack Phillips cade intr-o depresie adanca care-l face sa se indoiasca de cele mai fundamentale convingeri ale sale . El se confrunta cu o criza in credinta si primeste o scrisoare misterioasa care-l invita intr-o baraca pustie in mijlocul salbaticiei ...
... . Portofolii si joburi grafica/design pe categorii: animatie, arhitectura, concept art, design de ambalaj, design grafic, design industrial, design interactiv, web, fotografie, identitate vizuala, ilustratie, modelare 3d, multimedia, vfx, pictura, print, sculptura, video
[113 Pages Report] Check for Discount on United States Arbutin Market Report 2017 report by QYResearch Group. In this report, the United States Arbutin market is valued...
Filmul Batman (1989) Filme online subtitrate incepe cu orasul Gotham City , un oras intunecat si periculos protejat de un departament de politie in mare parte corupt , are mare nevoie de un erou . Acesta apare in persoana lui Batman (Michael Keaton) , un personaj misterios ce intotdeauna se ...
About 18 months ago I suffered from a recto cele and had a procedure to repair this condition. I had a hysterectomy 14 years previously. This was done by a gaenocologist and when I went for my .... ...
Formatul de dezbateri reprezintă ansamblul regulilor specifice de dialog. Elemente comune ale tuturor formatelor de dezbateri includ un număr egal de echipe şi un număr egal de vorbitori pentru fiecare echipă, timp egal de discurs pentru toate părţile implicate şi o alternanţă a discursurilor între cele două tabere oponente. Pentru a afla mai multe despre…
... - Parfumuri copii,cadouri Disney,cele mai complete esente de fructe acum in magazinul nostru Disney.Cadouri cu arome unice,design tridi
In cazul in care doriti sa transmiteti o sesizare , mentionam ca aceasta va fi inregistrata cu respectarea prevederilor OG nr. 27/2002 privind reglementarea activitatii de solutionare a petitiilor, aprobata prin Legea nr. 233/2002. Petitiile anonime sau cele in care nu sunt trecute datele de identificare nu se iau in considerare si se claseaza.. ...
Semantic Scholar extracted view of [Enterogenous toxic methemoglobinemia in babies with severe enteritis as a result of cows milk intolerance (authors transl)]. by Elisabeth Kohne et al.
Butyrivibrio fibrisolvens ced1 protein: shows cellodextrinase activity & rapidly hydrolyzes short-chain cellodextrins to yield either cellobiose or cellobiose & glucose as end products; releases cellobiose from p-nitrophenyl-beta-D-cellobioside & is not inhibited by methyl cellulose; amino acid sequence given in first source; from Butyrivibrio fibrisolvens H17c
TY - JOUR. T1 - Interactions of the complete cellobiohydrolase I from Trichodera reesei with microcrystalline cellulose Iβ. AU - Zhong, Linghao. AU - Matthews, James F.. AU - Crowley, Michael F.. AU - Rignall, Tauna. AU - Talón, César. AU - Cleary, Joseph M.. AU - Walker, Ross C.. AU - Chukkapalli, Giridhar. AU - McCabe, Clare. AU - Nimlos, Mark R.. AU - Brooks, Charles L.. AU - Himmel, Michael E.. AU - Brady, John W.. PY - 2008/4/1. Y1 - 2008/4/1. N2 - We describe the construction of a model complex of the cellobiohydrolase I (CBH I) cellulase from Trichoderma reesei bound to a cellulose microfibril in an aqueous environment for use in molecular dynamics (MD) simulations. Preliminary characterization from the initial phases of an MD simulation of this complex is also described. The linker sequence between the two globular domains was found to be quite flexible, and the oligosaccharides bound to this linker were found to prefer to be splayed like the spokes in a wheel due to their hydration ...
In this study, the evolution of cellulose degradation was a defining event in the history of life. Without efficient decomposition and recycling, dead plant biomass would quickly accumulate and become inaccessible to terrestrial food webs and the global carbon cycle. On land, the primary drivers of plant biomass deconstruction are fungi and bacteria in the soil or associated with herbivorous eukaryotes. While the ecological importance of plant-decomposing microbes is well established, little is known about the distribution or evolution of cellulolytic activity in any bacterial genus. Here we show that in Streptomyces, a genus of Actinobacteria abundant in soil and symbiotic niches, the ability to rapidly degrade cellulose is largely restricted to two clades of host-associated strains and is not a conserved characteristic of the Streptomyces genus or host-associated strains. Our comparative genomics identify that while plant biomass degrading genes (CAZy) are widespread in Streptomyces, key ...
Clostridium thermocellum CelJ protein: isolated from Clostridium thermocellum; amino acid sequence in first source; GenBank D83704
beta-Glucosidases represent an important group of enzymes due to their pivotal role in various biotechnological processes. One of the most prominent is biomass degradation for the production of fuel ethanol from cellulosic agricultural residues and wastes, where the use of immobilized biocatalysts may prove advantageous. Within such scope, the present work aimed to evaluate the feasibility of entrapping beta-glucosidase in either sol gel or in Lentikats supports for application in cellobiose hydrolysis, and to perform the characterization of the resulting bioconversion systems. The activity and stability of the immobilized biocatalyst over given ranges of temperature and pH values were assessed, as well as kinetic data, and compared to the free form, and the operational stability was evaluated. Immobilization increased the thermal stability of the enzyme, with a 10 degrees C shift to an optimal temperature in the case of sol gel support. Mass transfer hindrances as a result of immobilization ...
TY - CHAP. T1 - Regulation of expression of cellobiohydrolase I gene in Trichoderma. AU - Ilmen, Marja. AU - Onnela, Maija-Leena. AU - Saloheimo, Anu. AU - Penttilä, Merja. PY - 1992. Y1 - 1992. M3 - Conference abstract in proceedings. BT - 1st European Conference on Fungal Genetics. PB - University of Nottingham. CY - Nottingham. T2 - 1st European Conference on Fungal Genetics. Y2 - 20 August 1992 through 23 August 1992. ER - ...
In this work we present computational studies that shed light on the molecular mechanism of the initial stages of cellulose dissolution in saturated steam, which is an important pretreatment step in the conversion of lignocellulose to biofuel. The COMPASS, Dreiding and Universal molecular mechanics force fields and the B3LYP density functional with 6-311G, 6-311++G(d, p) and 6-311++G(2d, 2p) basis sets were used to study systems containing glucose, cellobiose and water. These molecular systems were studied since they are sufficiently small to perform the density functional theory calculations in a tractable time, while also being relevant to the dissolution of cellulose in saturated steam. Comparison of the energies and structures obtained from the three force fields with those obtained from the first principles method showed that the COMPASS force field is preferred to the other two and that this force field gives similar structures obtained from the first principles method. This supports the validity
Levansucrase acts on sucrose usually to synthesize a fructan which contains a sucrose unit at one terminus of the molecule and has branches formed by β-2, 1-fructofuranosyl linkage. The transfer of fructosyl residue to an acceptor by the enzyme is carried out from not only sucrose but also oli gosaccharides which contain a sucrose unit such as raffinose or fructosyl maltoside, fructosyl cellobioside, fructosyl lactoside, etc., which can be synthesized from sucrose in the presence of an acceptor sugar (maltose, cellobiose, lactose, etc.) by levansucrase. Soybean contains such oligosaccharides other than sucrose. We isolated levan from fermented soybean (Natto) and analyzed the molecular weight and terminus of the molecule. It was revealed that the molecular weight was about 1.1 × 10,SUP,4,/SUP, by HPLC using molecular markers of pullulans, and the levan isolated contained a stachyose unit at the terminal of the molecule. It was thought that the enzyme might have a donor binding site (with a ...
1G9J: Structures of mutants of cellulase Cel48F of Clostridium cellulolyticum in complex with long hemithiocellooligosaccharides give rise to a new view of the substrate pathway during processive action
View Celgene Corporation CELG investment & stock information. Get the latest Celgene Corporation CELG detailed stock quotes, stock data, Real-Time ECN, charts, stats and more.
Oferte si Promotii la produsele din categoria Piscine si accesorii piscine de la PCONE! Cele mai ieftine Piscine si accesorii piscine le vei gasi Online la PCOne.ro la cele mai bune preturi. Intra pe site si comanda online produsele dorite de pe PCONE.
Oferte si Promotii la produsele din categoria Diverse Ingrijire personala Remington de la VEXIO! Cele mai ieftine Diverse Ingrijire personala Remington le vei gasi Online la Vexio.ro la cele mai bune preturi. Intra pe site si comanda online produsele dorite de pe VEXIO.
Detria Oy on rovaniemeläinen, vuonna 1996 perustettu yritys, joka valmistaa ja markkinoi luontaiskosmetiikka- ja hoitotuotteita kansanparannusperinteestä tunnetuista lappilaisista yrteistä.
A new genus of cellulolytic, gram-negative, nonsporeforming, anaerobic bacteria is described. The colonies produced by these bacteria on cellulose agar were round, clear, translucent, and cream-colored and had an undulate margin. Single cells of the bacterium were straight to slightly curved rods 0.5 to 0.8 μm wide by 4 to 10 μm long and were motile by means of a single flagellum located one-third of the distance from the end of the cell. Among the various substrates tested, only cellulose, cellobiose, and salicin were able to support growth. The major fermentation products of cellobiose or cellulose degradation were acetic acid, hydrogen, and carbon dioxide. The deoxyribonucleic acid base composition of the type species was 38 mol% guanine plus cytosine. The name Acetivibrio is proposed for this new genus, which is placed in the family Bacteroidaceae. The type species, Acetivibrio cellulolyticus sp. nov., is named on the basis of its cellulolytic activity. The type strain of A. cellulolyticus is CD2
Cellobiohydrolase I (T. longibrachiatum) [ME-CBHI] - High purity Cellobiohydrolase I (T. longibrachiatum) for use in research, biochemical enzyme assays and in vitrodiagnostic analysis. EC 3.2.1.176 From Trichoderma longibrachiatum. Electrophoretically homogeneous (MW 65,000). In 3.2M ammonium sulphate. Specific activity: ~ 0.1 U/mg (40oC, pH 4.5, CM-cellulose 4M as substrate). Active on p-nitrophenyl-β-lactoside. Stable at 4oC for | 4 years.
When compared with the termite hindgut metagenome study (41), the termite hindgut microbiome contains more representatives of protein modules that are involved in degradation of the main chain of cellulose (CBM6 and GH5, 9, 44, and 74) and xylan (GH10 and 11), and GH94 (cellobiose phosphorylase) compared with the bovine microbiomes. This could be because of the diet differences (wood versus forages and legumes), or it could be that the short reads from pyrosequencing do not detect CBMs or dockerins. To address this question we performed a 454 pyrosequencing short read simulation for the detection of these protein motifs in the Clostridium thermocellum genome, a model cellulolytic microbe (Table 2 and Fig. S9). From this analysis, dockerins appear more difficult to detect in the simulated 454 short read query than are CBMs and GHs. We found 5 CBM "454 fragments" per CBM in the genome, ≈15.7 GH "454 fragments" per GH in the genome, and only ≈1.7 dockerin "454 fragments" per dockerin in the ...
Transcription and expression regulation of some individual cel genes (cel5A, cel5I, cel5D and cel44O) of Clostridium cellulolyticum were investigated. Unlike the cip-cel operon, these genes are transcribed as monocistronic units of transcription, except cel5D. The location of the transcription initiation sites was determined using RT-PCR and the mRNA 5′-end extremities were detected using primer extension experiments. Similarly to the cip-cel operon, cel5A and cel5I expressions are regulated by a carbon catabolite repression mechanism, whereas cel44O and cel5D expressions do not seem to be submitted to this regulation. The role of the putative transcriptional regulator GlyR2 in the regulation of cel5D expression was investigated. The recombinant protein GlyR2 was produced and was shown to bind in vitro to the cel5D and glyR2 promoter regions, suggesting that besides regulating its own expression, GlyR2 may regulate cel5D expression. To test this hypothesis in vivo, an insertional glyR2 mutant ...
Shewanella are facultatively anaerobic, Gram-negative bacteria, motile by polar flagella, rod-like, and generally associated with aquatic or marine environments. They are capable of using a variety of compounds as electron acceptors, including oxygen, iron, manganese, uranium, nitrate, nitrite, fumarate, to name but a few. This ability makes Shewanella important for bioremediation of contaminated metals and radioactive wastes. The genus Shewanella comprises 36 recognized and hundreds of uncharacterized cultivable species. Shewanella baltica, isolated from the Baltic Sea, is able to grow at 4 degrees C but not 37, unlike other Shewanella species. Under anaerobic conditions, oxidation of organic matter can be coupled to the reduction of nitrate, Fe(III) and sulfur compounds. OS155 is unable to produce an FeS precipitate on TSI agar medium, whereas OS195 can do so. OS155 does not produce N-acetyl-b-glucosaminidase, or chymotrypsin. It can use gentiobiose, cellobiose, sucrose, d-gluconate and ...
0075] For certain embodiments, including any one of the above embodiments of a composition, a method, a device, or a kit, the carbohydrate is selected from the group consisting of monsaccharides, oligosaccharides, polysaccharides, and combinations thereof. Suitable monosaccharides include, for example, mannose, galactose, glucose, fructose, fucose, N-acetylglucosamine, N-acetylgalactosamine, rhamnose, galactosamine, glucosamine, galacturonic acid, glucuronic acid, N-acetylneuraminic acid, methyl D-mannopyranoside, α-methylglucoside, galactoside, ribose, xylose, arabinose, saccharate, mannitol, sorbitol, inositol, glycerol, a derivative of any one of these monosaccharides, and a combination thereof. Suitable oligosaccharides include those having 2 to 12 monosaccharide units, which may be the same or different. Examples include oligomannose having 2 to 6 units, maltose, sucrose, trehalose, cellobiose, salicin, a derivative of any one of these oligosaccharides, and a combination thereof. Suitable ...
Lineage: cellular organisms; Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Aggregatibacter; Aggregatibacter ...
This domain of about 175 to 200 amino acids is found, in from one to five copies, in over 50 proteins in Fibrobacter succinogenes S85, an obligate anaerobe of the rumen. Many members of this family have an apparent lipoprotein signal sequence. Conserved cysteine residues, suggestive of disulfide bond formation, are also consistent with an extracytoplasmic location for this domain. This domain can also be found in small numbers of proteins in Chlorobium tepidum and Bacteroides thetaiotaomicron ...
General Information: Country: Japan; Isolation: Methanogenic sludge; Temp: Thermophile; Temp: 55C. Clostridium clariflavum is a thermophilic cellulose degrader closely related to C. thermocellum, with equivalent cellulolytic activity. ...
cellulase for bio polishing Manufacturers & cellulase for bio polishing Suppliers Directory - choose cellulase for bio polishing from 183 cellulase for bio polishing Super Suppliers of China.
Effect of pH on the activity of (■) free cellulase, (●) immobilized cellulase, and (▲) immobilized cellulase + ionic liquid. Morphologies of immobilized c
Adevăruri incomode despre limba română. Chestiunea principală a cărții lui Mihai Vinereanu este originea limbii române și raportul acesteia cu limba latină care nu poate fi judecat fără să se ia în calcul elementele genetice comune din trecutul îndepărtat al vorbitorilor celor două limbi. Mihai Vinereanu atrage atenția că unele cuvinte din limba română, chiar dacă prezintă asemănări frapante cu cele din latină, nu pot fi considerate neapărat de sorginte latină, ele putând fi atribuite fondului comun ancestral. El precizează că elementele comune cu latina nu depăşesc 13%, cele slave reprezintă cam 6%, cele turceşti 4,5%, greceşti 2%, maghiare 1,5% şi germane 1%, iar din cele 13% comune cu latina, doar un mic procent sînt cuvinte propriu-zis latine, cele mai multe fiind doar înrudite pe fond indo-european. ...
Biohazard level, growth media and temperature, gram stain, industrial applications and more information for Acetitomaculum ruminis.
Gentaur molecular products has all kinds of products like :search , PhytoTechnology Laboratories \ CELLULASE, ONOZUKA R-10 \ C224-1G for more molecular products just contact us
Florarie in judetul Brasov, oferim din anul 2003 cele mai bune servicii de livrare flori in Brasov. Comanda acum simplu si rapid buchete de flori, cosuri cu flori, aranjamente florale, plante si cadouri minunate de la FlorideLux.ro, florarie online.
The object of this study was to investigate the cellulolytic bacterial community in the intestine of the Chinese white pine beetle (Dendroctonus armandi) larvae. A total of 91 cellulolytic bacteria were isolated and assigned to 11 genotypes using amplified ribosomal DNA restriction analysis (ARDRA). Partial 16S rDNA sequence analysis and morphological tests were used to assign the 11 representative isolates. The results showed that the isolates belonged to α-Proteobacteria, γ-Proteobacteria and Firmicutes. Members of γ-Proteobacteria were the most frequently represented species and accounted for 73.6% of all the cellulolytic bacteria. The majority of cellulolytic bacteria in D. armandi larva gut were identified as Serratia and accounted for 49.5%, followed by Pseudomonas, which accounted for 22%. In addition, members of Bacillus, Brevundimonas, Paenibacillus, Pseudoxanthomonas, Methylobacterium and Sphingomonas were found in the D. armandi larva gut. Brevundimonas kwangchunensis, Brevundimonas
TABLE-US-00003 TABLE 3 PFAM Results for Amino Acid Sequences Amino Acid SEQ ID Range NO: ORF Domain Start, Stop Family PFAM Accession No. E-value 3 877 PTS_IIA 16, 111 PTS system, Lactose/Cellobiose specific IIA PF02255 8.20E-40 subunit 5 609 PTS_EIIA_1 30, 134 phosphoenolpyruvate-dependent sugar PF00358 6.00E-55 phosphotransferase system, EIIA 1 7 1479 PRD 76, 171; PRD domain PF00874 9.90E-52 181, 282 7 1479 CAT_RBD 6, 67 CAT RNA binding domain PF03123 1.10E-16 9 1574 Glyco_hydro_1 4, 471 Glycosyl hydrolase family 1 PF00232 2.90E-133 11 1707 PTS_EIIA_1 491, 595 phosphoenolpyruvate-dependent sugar PF00358 6.10E-53 phosphotransferase system, EIIA 1 11 1707 PTS_EIIC 105, 387 Phosphotransferase system, EIIC PF02378 3.10E-33 11 1707 PTS_EIIB 7, 41 phosphotransferase system, EIIB PF00367 8.50E-19 13 725 PTS_EIIA_1 528, 632 phosphoenolpyruvate-dependent sugar PF00358 4.10E-60 phosphotransferase system, EIIA 1 13 725 PTS_EIIC 122, 419 Phosphotransferase system, EIIC PF02378 3.80E-35 13 725 PTS_EIIB 21, ...
A 1,4-beta-D-glucan cellobiohydrolase (EC 3.2.1.91) was purified from the culture liquid of Trichoderma reesei by using biospecific sorption on amorphous cellulose and immunoaffinity chromatography. A single protein band in polyacrylamide-gel electrophoresis and one arc in immunoelectrophoresis corresponded to the enzyme activity. The Mr was 65 000. The pI was 4.2-3.6. The purified enzyme contained about 10% hexose. The enzyme differs from previously described cellobiohydrolases in being more effective in the hydrolysis of cellulose. ...
The accessibility and reactivity of cellulose are key parameters on the manufacturing of cellulose derivatives and regenerated cellulose. It is well known that, due to the crystalline structure of cellulose, the accessibility of solvents and reagents is limited. For instance, an inhomogeneous substitution of the hydroxyl groups of the cellulose chain might lead to the production of derivatives of low quality. As a consequence, part of this work has focused on improving the accessibility and reactivity on cellulose by studying the effect of different monocomponent endoglucanases. It has been demonstrated that the presence of the cellulose-binding domain plays an important role on the enhancement of cellulose reactivity; however, the structure of the catalytic domain has been showed to have the highest influence on this parameter. Furthermore, the influence of mechanical treatment prior to enzymatic treatment has been examined. The combination of pretreatments showed a positive effect enhancing to ...
SYLLABUS/CONTENT. CARBOHYDRATES. Monosaccharides: molecular structure of the main compounds, stereoisomerism, steric series, intramolecular reactions producing cyclic forms, mutarotation, reducing sugars, oxidation and reduction reactions, glycosides. Reducing disaccharides: cellobiose, maltose, lactose. Not-reducing disaccharides: sucrose. Polysaccharides: cellulose, starch, glycogen. From the energy of sunlight to the chemical energy of carbohydrates and to cell energy. Recent eco-substainable processes to produce polymers by fermentation of cellulose.. PROTEINS. Amino acids: structure, nomenclature, apolar zwitterionic cationic and anionic forms, isoionic point, electrophoresis. Proteogenic amminoacids: structure, steric series, possible features. Peptides and proteins: primary structure, main kinds of secondary structure (alpha helix or beta-pleated sheet, their rationale and their stabilization), tertiary structure (intrachain interactions, denaturation, fibrous and globular proteins), ...
Alpha Arbutin Cream, Wholesale Various High Quality Alpha Arbutin Cream Products from Global Alpha Arbutin Cream Suppliers and Alpha Arbutin Cream Factory,Importer,Exporter at Alibaba.com.
cellulase in humans for sale - 83 - cellulase in humans wholesalers & cellulase in humans manufacturers from China manufacturers.
Clostridium thermocellum is a thermophilic, cellulolytic anaerobe that is a candidate microorganism for industrial biofuels production. Strains with mutations in genes associated with production of l-
Alpha arbutin soap with the special combination of the alpha arbutin formula it can help brighten smoothen & soften your face and body naturally ...
Articolele publicate pe refresh.ro ce prezinta topul saptamanal al celor mai viralizate stiri in social media sunt realizate in colaborare cu ZeList Monito
Am testat zilele astea un telefon mic si dragut, dual sim de la Allview din Brasov si o tableta E-boda, quad core, cu ecran de 10.1 inchi. Bune ...
Daca nu aveti timp pentru o asemenea analiza dar vreti sa mizati ca un jucator profesionist puteti apela la biletul zilei , pus la dispozitia dumneavoastra de www.e-pariuri.ro . Acest bilet reprezinta un triaj al celor mai bine cotate evenimente sportive ale fiecarei zile .. Astazi mi-am propus sa va dezvalui cateva trucuri cu privire la analiza meciurilor . Ei bine , in primul rand trebuie sa ne stabilim cateva criterii , adica acele informatii cheie care pot furniza date pretioase despre o anumita echipa . Printre cele mai relevante criterii se numara :. Jucatorii accidentati sau indisponibili . Un parior profesionist v-a culege aceste informatii numai din surse oficiale .. ...
Influence of Carbon Source on the Production of Extracellular Ligninolytic Enzymes by Phanerochaete chrysosporium. Fangfang Wang,a Mingqiang Ai,a Guihua Yang,b Jiachuan Chen,b Xiulan Chen,a and Feng Huang a,*. The effect of altering the carbon source in the growing environment was investigated relative to the production of ligninolytic enzymes by Phanerochaete chrysosporium. Glucose, cellobiose, and cellulose (or mixtures thereof) were used as the carbon sources. Glucose oxidase and glyoxal oxidase activities in all carbon sources were produced during cultivation. High peak levels (0.17 to 0.24 IU/mL) of manganese peroxidase activity were observed only in mediums containing oligosaccharides. Lignin peroxidase activity was high in glucose medium (0.21 IU/mL of peak value); however, minimal amounts were formed in the cellulose medium (0.01 IU/mL of peak value). High amounts of cellobiose:quinone oxidoreductase (3.33-3.99 IU/mL of peak value) and cellobiose dehydrogenase (0.04-0.2 IU/mL of peak ...
Effects of supplementation with ruminal epithelial cells on fiber-degrading activity and cell growth of Ruminococcus albus (R. albus, strain 7) was tested using a basal substrate of rice straw and formulated concentrate. Cultures of R. albus alone and R. albus with rumen protozoa were grown at 39째C for 48 h with an 8.4% crude protein (CP) substrate, 33% of the CP supplemented with either ruminal epithelial cells or defatted soybean meal. The ruminal epithelial cells had lower amounts of rumen soluble and degradable protein fractions as compared to defatted soybean meal, as determined by an enzymatic method, and the same was found with amino acid composition of protein hydrolysates. Ruminal epithelial cells were directly utilized by the R. albus, and resulted in greater growth of cell-wall free bacteria compared to defatted soybean meal. The effect of epithelial cells on bacterial growth was enhanced by the presence of rumen protozoa. In consistency with cultures of R. albus and R. albus with ...

Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Isolation and characterization of...Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Isolation and characterization of...

Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Isolation and characterization of ... Bacterial yield was 38% greater when the organism was grown on cellobiose, and this could be due to constitutive cellobiose ... Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Article Abstract:. Ruminococcus albus when ...
more infohttp://www.readabstracts.com/Biological-sciences/Cellobiose-versus-glucose-utilization-by-the-ruminal-bacterium-Ruminococcus-albus.html

Cellobiose - DrugBankCellobiose - DrugBank

Cellobiose. Accession Number. DB02061 (EXPT00844) Type. Small Molecule. Groups. Experimental. Description. A disaccharide ... Hajime Taniguchi, Takashi Sasaki, Motomitsu Kitaoka, Method for preparing cellobiose. U.S. Patent US5077205, issued January, ...
more infohttps://www.drugbank.ca/drugs/DB02061

Cellobiose - Simple English Wikipedia, the free encyclopediaCellobiose - Simple English Wikipedia, the free encyclopedia

Cellobiose is a kind of sugar.. This word is from biochemistry and cellobiose is part of the disaccharide group of sugars. This ... Water and cellulose make cellobiose: this process is called hydrolysis.. Pure cellobiose is a white powder.[2] People cannot ... Cellobiose is made from cellulose, which comes from the cells of plants. Things that have a lot of cellulose are good for ... Retrieved from "https://simple.wikipedia.org/w/index.php?title=Cellobiose&oldid=5617842" ...
more infohttps://simple.wikipedia.org/wiki/Cellobiose

Ionization of Cellobiose … - University of Gothenburg, Sweden 
							
							
						
					
				
			Ionization of Cellobiose … - University of Gothenburg, Sweden

Ionization of Cellobiose in Aqueous Alkali and the Mechanism of Cellulose Dissolution. Journal article ... Chemical shift differences between cellobiose in NaOH and NaCl were estimated using 2D NMR and compared to DFT shift ... To elucidate the solubilization mechanism, we performed electrophoretic NMR on cellobiose, a subunit of cellulose, showing that ... cellobiose acts as an acid with two dissociation steps at pH 12 and 13.5. ...
more infohttps://gu.se/english/research/publication/?publicationId=249688

Adsorption of Glucose, Cellobiose, and Cellotetraose onto Cellulose Model SurfacesAdsorption of Glucose, Cellobiose, and Cellotetraose onto Cellulose Model Surfaces

... Adsorption of Glucose, Cellobiose, and ... In this study, we present the adsorption of glucose, cellobiose, and cellotetraose on model surfaces of crystalline cellulose I ...
more infohttps://warwick.ac.uk/fac/sci/chemistry/research/maurer/maurergroup/publications/adsorption_of_glucose/

Cellobiose - WikipediaCellobiose - Wikipedia

Cellobiose is a disaccharide with the formula C12H22O11. Cellobiose, a reducing sugar, consists of two β-glucose molecules ... Cellobiose has eight free alcohol (OH) groups, one acetal linkage and one hemiacetal linkage, which give rise to strong inter- ... Treatment of cellulose with acetic anhydride and sulfuric acid, gives cellobiose octoacetate, which is no longer a hydrogen ... Cancerweb.ncl.ac.uk Braun, G. (1943). "α-Cellobiose Octaacetate" (PDF). Organic Syntheses. Collected Volume 2: 124. and Braun, ...
more infohttps://en.wikipedia.org/wiki/Cellobiose

Activation of bacterial lytic polysaccharide monooxygenases with cellobiose dehydrogenase. | Sigma-AldrichActivation of bacterial lytic polysaccharide monooxygenases with cellobiose dehydrogenase. | Sigma-Aldrich

Activation of bacterial lytic polysaccharide monooxygenases with cellobiose dehydrogenase.. [Jennifer S M Loose, Zarah Forsberg ... cellobiose dehydrogenases, CDHs, from fungi). Here, we demonstrate that a fungal CDH from Myriococcum thermophilum (MtCDH), can ...
more infohttps://www.sigmaaldrich.com/catalog/papers/27643617

Cellobiose phosphorylase - WikipediaCellobiose phosphorylase - Wikipedia

In enzymology, a cellobiose phosphorylase (EC 2.4.1.20) is an enzyme that catalyzes the chemical reaction cellobiose + ... The systematic name of this enzyme class is cellobiose:phosphate alpha-D-glucosyltransferase. This enzyme participates in ... AYERS WA (1959). "Phosphorolysis and synthesis of cellobiose by cell extracts from Ruminococcus flavefaciens". J. Biol. Chem. ... Alexander JK (1968). "Purification and specificity of cellobiose phosphorylase from Clostridium thermocellum". J. Biol. Chem. ...
more infohttps://en.wikipedia.org/wiki/Cellobiose_phosphorylase

Interactions of a fungal lytic polysaccharide monooxygenase with β-glucan substrates and cellobiose dehydrogenase | PNASInteractions of a fungal lytic polysaccharide monooxygenase with β-glucan substrates and cellobiose dehydrogenase | PNAS

cellobiose dehydrogenase. Footnotes. *↵1To whom correspondence may be addressed. Email: finn.l.aachmann{at}ntnu.no or vincent. ... Interactions of a fungal lytic polysaccharide monooxygenase with β-glucan substrates and cellobiose dehydrogenase. Gaston ... Interactions of a fungal lytic polysaccharide monooxygenase with β-glucan substrates and cellobiose dehydrogenase ... such as cellobiose dehydrogenase (CDH). Using protein NMR and isothermal titration calorimetry we have studied the interactions ...
more infohttps://www.pnas.org/content/early/2016/05/04/1602566113.abstract

RCSB PDB - Protein Feature View 









 - PTS system, lactose/cellobiose family IIB subunit - C3T7F7 (C3T7F7 ECOLX)RCSB PDB - Protein Feature View - PTS system, lactose/cellobiose family IIB subunit - C3T7F7 (C3T7F7 ECOLX)

The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
more infohttp://www.rcsb.org/pdb/protein/A0A0J3VCG3

Cellobiose dehydrogenase and a copper-dependent polysaccharide monooxygenase potentiate cellulose degradation by Neurospora...Cellobiose dehydrogenase and a copper-dependent polysaccharide monooxygenase potentiate cellulose degradation by Neurospora...

Addition of cellobiose dehydrogenase to a mixture of purified cellulases showed no stimulatory effect. We show that cellobiose ... Cellobiose dehydrogenases and proteins related to the polysaccharide monooxygenases described here are found throughout both ... Cellobiose dehydrogenase and a copper-dependent polysaccharide monooxygenase potentiate cellulose degradation by Neurospora ... Deletion of cdh-1, the gene encoding the major cellobiose dehydrogenase of Neurospora crassa, reduced cellulase activity ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/22004347

Cellobiose | definition of cellobiose by Medical dictionaryCellobiose | definition of cellobiose by Medical dictionary

... cellobiose explanation free. What is cellobiose? Meaning of cellobiose medical term. What does cellobiose mean? ... Looking for online definition of cellobiose in the Medical Dictionary? ... Cellobiose , definition of cellobiose by Medical dictionary https://medical-dictionary.thefreedictionary.com/cellobiose ... cellobiose. Also found in: Dictionary, Encyclopedia, Wikipedia. cel·lo·bi·ose. (selō-bīōs), A disaccharide obtained from ...
more infohttps://medical-dictionary.thefreedictionary.com/cellobiose

US5747320A - Glucose and cellobiose tolerant β-glucosidase from Candida peltata 
        - Google PatentsUS5747320A - Glucose and cellobiose tolerant β-glucosidase from Candida peltata - Google Patents

... and which is effective for the hydrolysis of cellobiose to glucose, is disclosed. The enzyme is produced by Candida peltata, ... A new β-glucosidase enzyme which is tolerant to glucose and cellobiose, ... cellobiose only; (□), glucose formed from cellobiose, (Δ), cellobiose with glucose; (∇), glucose formed from cellobiose in the ... iv) Cellobiose-Sepharose 6B affinity chromatography. Cellobiose-Sepharose affinity matrix was prepared by coupling cellobiose ...
more infohttps://patents.google.com/patent/US5747320A/en

Brönsted Acidic Ionic Liquid 1-(1-Propylsulfonic)-3-methylimidazolium-Chloride Catalyzed Hydrolysisof D-Cellobiose in Aqueous...Brönsted Acidic Ionic Liquid 1-(1-Propylsulfonic)-3-methylimidazolium-Chloride Catalyzed Hydrolysisof D-Cellobiose in Aqueous...

... assuming that anomeric ratio of D-cellobiose remains constant throughout the reaction.. ... peak area of D-cellobiose 1α or 1′α hydrogen. = peak area of D-cellobiose 1β or 1′β hydrogen. = peak area of D-glucose 1α ... The anomeric composition of D-cellobiose in this mixture was calculated as using the peak area ratio of two doublets at 4.97 ... D-Cellobiose sample heated in sulfuric acid-. medium also gave a similar series of spectra. The spectrum recorded at . shows a ...
more infohttps://www.hindawi.com/journals/ijcc/2012/948652/

RCSB PDB - 8A3H: Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A...RCSB PDB - 8A3H: Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A...

Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution ... Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution. Note: Use ...
more infohttps://www.rcsb.org/3d-view/8A3H?preset=ligandInteraction&sele=IDC

Crystallization of Cellobiohydrolase in the Presence of Cellulose-Degraded Cellobiose: Analysis of Intermolecular Interactions...Crystallization of Cellobiohydrolase in the Presence of Cellulose-Degraded Cellobiose: Analysis of Intermolecular Interactions...

Gentle agitation of cellobiose-containing cellobiohydrolase solutions during sitting-drop vapor-diffusion growth resulted in ... This result was in contrast with the conventional idea that cellobiose inhibits the nucleation of cellobiohydrolase crystals. ... We aimed to clarify how cellobiose inhibits cellobiohydrolase crystallization and to crystallize cellobiohydrolase in ... concentrated cellobiose without using seeds. The contribution of attractive forces to total intermolecular interactions of ...
more infohttps://www.scirp.org/journal/PaperInformation.aspx?paperID=41600

Expression of listeriolysin and phosphatidylinositol-specific phospholipase C is repressed by the plant-derived molecule...Expression of listeriolysin and phosphatidylinositol-specific phospholipase C is repressed by the plant-derived molecule...

... of listeriolysin and phosphatidylinositol-specific phospholipase C is repressed by the plant-derived molecule cellobiose in ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/8332058?dopt=Abstract

Construction of cellobiose phosphorylase variants with broadened acceptor specificity towards anomerically substituted...Construction of cellobiose phosphorylase variants with broadened acceptor specificity towards anomerically substituted...

cellobiose phosphorylase, directed evolution, cellobiosides, glycoside synthesis, substrate specificity, DIRECTED EVOLUTION, ... Construction of cellobiose phosphorylase variants with broadened acceptor specificity towards anomerically substituted ... "Construction of Cellobiose Phosphorylase Variants with Broadened Acceptor Specificity Towards Anomerically Substituted ... Construction of cellobiose phosphorylase variants with broadened acceptor specificity towards anomerically substituted ...
more infohttps://biblio.ugent.be/publication/1089255

CiNii 論文 - 
 		
 			Characterization of Cellobiose Phosphorylase and Cellodextrin Phosphorylase (糖質関連酵素化学シンポジウム)
 		
 		
 	CiNii 論文 - Characterization of Cellobiose Phosphorylase and Cellodextrin Phosphorylase (糖質関連酵素化学シンポジウム)

Characterization of Cellobiose Phosphorylase and Cellodextrin Phosphorylase (糖質関連酵素化学シンポジウム) Characterization of Cellobiose ... Specific colorimetric quantification of cellobiose was designed by using the reaction of CBP. Cellobiose was produced from ... A cellobiose phos-phorylase from Cellvibrio gilvus recognizes only the β-D-form of 5a-carba-glucopyranose. KITAOKA M. ... Acceptor specificity of cellobiose phosphorylase from Cellvibrio gilvus : Synthesis of three branched trisaccharides PERCY A. ...
more infohttps://ci.nii.ac.jp/naid/10008253791

Effects of Brønsted and Lewis acidities on activity and selectivity of heteropolyacid-based catalysts for hydrolysis of...Effects of Brønsted and Lewis acidities on activity and selectivity of heteropolyacid-based catalysts for hydrolysis of...

... act as effective homogeneous catalysts for selective hydrolysis of cellobiose and cellulose to glucose and total reducing ... cellobiose. , cellulose and lignocellulose, H3PW12O40 and Sn0.75PW12O40 showed higher TRS. yield than H2SO4. ... cellobiose. and cellulose K. Shimizu, H. Furukawa, N. Kobayashi, Y. Itaya and A. Satsuma, Green Chem., 2009, 11, 1627 DOI: ... cellobiose. and cellulose to glucose. and total reducing sugars (. TRS. ), respectively, in an aqueous phase. For Brønsted acid ...
more infohttps://pubs.rsc.org/en/content/articlelanding/2009/GC/B913737H

Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum. |...Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum. |...

Fermentation of cellobiose was more rapid than that of cellulose. In cellobiose medium, the methanogen caused only slight ... Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum.. P ... Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum. ... The fermentation of cellulose and cellobiose by Clostridium thermocellum monocultures and C. thermocellum/Methanobacterium ...
more infohttps://aem.asm.org/content/33/2/289?ijkey=0800bd6306add01da3b9c994a9a4c1db2d87715b&keytype2=tf_ipsecsha

CiNii 論文 - 
 		
 		
 			
 		 	
 		 		
 		 			Enzymatic Characteristics of Cellobiose Phosphorylase from Ruminococcus albus NE1...CiNii 論文 - Enzymatic Characteristics of Cellobiose Phosphorylase from Ruminococcus albus NE1...

Cellobiose phosphorylase (EC 2. 4. 1. 20) of Cellulomonas : Occurrence, induction, and its role in cellobiose metabolism SCHIMZ ... Cellobiose phosphorylase (CBP) catalyzes the reversible phosphorolysis of cellobiose to produce α-,small,D,/small,- ... Enzymatic properties of cellobiose 2-epimerase from Ruminococcus albus and the synthesis of rare oligosaccharides by the enzyme ... Cellobiose versus glucose tuilizationby the ruminal bacterium Ruminococ-cus albus. THURSTON B ...
more infohttps://ci.nii.ac.jp/naid/10030752061

Enzymatic Synthesis of 1,5-Anhydro-4-<i>O</i>-β-D-glucopyranosyl-D-fructose Using Cellobiose Phosphorylase and Its Spontaneous...Enzymatic Synthesis of 1,5-Anhydro-4-<i>O</i>-β-D-glucopyranosyl-D-fructose Using Cellobiose Phosphorylase and Its Spontaneous...

Cellobiose phosphorylase from Cellvibrio gilvus was used to prepare 1,5-anhydro-4-O-β-D-glucopyranosyl-D-fructose [βGlc(1→4)AF ... Keywords: 1,5-anhydro-4-O-β-D-glucopyranosyl-D-fructose, 1,5-anhydro-D-fructose, cellobiose phosphorylase, β-elimination, ... Enzymatic Synthesis of 1,5-Anhydro-4-O-β-D-glucopyranosyl-D-fructose Using Cellobiose Phosphorylase and Its Spontaneous ...
more infohttps://www.jstage.jst.go.jp/article/jag/64/4/64_jag.JAG-2017_010/_article/-char/en

Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator |...Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator |...

Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator. Ulla ... Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator ... Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator ... Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator ...
more infohttp://www.biochemsoctrans.org/content/28/1/A20.4

Cellobiose definitionCellobiose definition

... a white, crystalline, water-soluble disaccharide, C 12 H 22 O 11 , that is obtained by the breakdown of ... Definithing > Dictionary > c > Cellobiose. Cellobiose. a white, crystalline, water-soluble disaccharide, C 12 H 22 O 11 , that ... Disclaimer: Cellobiose definition / meaning should not be considered complete, up to date, and is not intended to be used in ...
more infohttps://definithing.com/define-dictionary/cellobiose/
  • Recent studies have shown that cellobiose can be processed or metabolized by endogenous beta glycosidases in the mammalian small intestine (PMID 18752931 ). (lmdb.ca)
  • We aimed to clarify how cellobiose inhibits cellobi ohydrolase crystallization and to crystallize cellobiohydrolase in concentrated cellobiose without using seeds. (scirp.org)
  • This result was in contrast with the conventional idea that cellobiose inhibits the nucleation of cellobiohydrolase crystals. (scirp.org)
  • Cellobiose was produced from sucrose at 90% yield by a combined action of three enzymes including CBP. (nii.ac.jp)
  • Furthermore, phenotypic tests such as acid production from cellobiose and citrate utilization, previously proposed to be useful for identification of E. (thefreedictionary.com)
  • Brönsted acidic ionic liquid 1-(1-propylsulfonic)-3-methylimidazolium chloride (PSMIMCl) shows a higher catalytic activity than sulfuric acid in the hydrolysis of D-cellobiose to D-glucose in water at 90-120°C. This catalytic activity enhancement is more significant at higher temperatures, and at 120°C, PSMIMCl produced 64.5% glucose yield, whereas H 2 SO 4 produced only 42.2% after 40 min. (hindawi.com)
  • This research aimed to identify strong promoters and to engineer a strain that converts cellobiose efficiently to curdlan. (docphin.com)
  • Cellobiose, a reducing sugar, consists of two β-glucose molecules linked by a β(1→4) bond. (wikipedia.org)
  • Chemical shift differences between cellobiose in NaOH and NaCl were estimated using 2D NMR and compared to DFT shift differences upon deprotonation. (gu.se)
  • Disclaimer: Cellobiose definition / meaning should not be considered complete, up to date, and is not intended to be used in place of a visit, consultation, or advice of a legal, medical, or any other professional. (definithing.com)
  • ATCC31749 for curdlan production from cellobiose. (docphin.com)
  • Cellobiose has eight free alcohol (OH) groups, one acetal linkage and one hemiacetal linkage, which give rise to strong inter- and intramolecular hydrogen bonds. (wikipedia.org)
  • The amide N-H groups donate hydrogen bonds to oxygen atoms on the cellobiose units, while intramolecular hydrogen bonds give rise to S(7) and S(9) motifs in addition to a View the MathML sourceR33 (9) motif. (ucc.ie)
  • The engineered strains were shown with enhanced ability to utilize cellobiose, resulting in a 2. (docphin.com)