A disaccharide consisting of two glucose units in beta (1-4) glycosidic linkage. Obtained from the partial hydrolysis of cellulose.
Reversibly catalyze the oxidation of a hydroxyl group of carbohydrates to form a keto sugar, aldehyde or lactone. Any acceptor except molecular oxygen is permitted. Includes EC 1.1.1.; EC 1.1.2.; and 1.1.99.
A polysaccharide with glucose units linked as in CELLOBIOSE. It is the chief constituent of plant fibers, cotton being the purest natural form of the substance. As a raw material, it forms the basis for many derivatives used in chromatography, ion exchange materials, explosives manufacturing, and pharmaceutical preparations.
An exocellulase with specificity for a variety of beta-D-glycoside substrates. It catalyzes the hydrolysis of terminal non-reducing residues in beta-D-glucosides with release of GLUCOSE.
An endocellulase with specificity for the hydrolysis of 1,4-beta-glucosidic linkages in CELLULOSE, lichenin, and cereal beta-glucans.
Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.
A genus of fungi in the family Corticiaceae, order Stereales, that degrades lignin. The white-rot fungus Phanerochaete chrysosporium is a frequently used species in research.
An exocellulase with specificity for the hydrolysis of 1,4-beta-glucosidic linkages of 1,4-beta-D-glucans resulting in successive removal of GLUCOSE units.
An exocellulase with specificity for the hydrolysis of 1,4-beta-D-glucosidic linkages in CELLULOSE and cellotetraose. It catalyzes the hydrolysis of terminal non-reducing ends of beta-D-glucosides with release of CELLOBIOSE.
A mitosporic Ophiostomataceae fungal genus, whose species Sporothrix schenckii is a well-known animal pathogen. The conidia of this soil fungus may be inhaled causing a primary lung infection, or may infect independently via skin punctures.
A genus of gram-positive bacteria in the family Lachnospiraceae that inhabits the RUMEN; LARGE INTESTINE; and CECUM of MAMMALS.
A phylum of fungi that produce their sexual spores (basidiospores) on the outside of the basidium. It includes forms commonly known as mushrooms, boletes, puffballs, earthstars, stinkhorns, bird's-nest fungi, jelly fungi, bracket or shelf fungi, and rust and smut fungi.
A genus of motile or nonmotile gram-positive bacteria of the family Clostridiaceae. Many species have been identified with some being pathogenic. They occur in water, soil, and in the intestinal tract of humans and lower animals.
Enzymes that hydrolyze O-glucosyl-compounds. (Enzyme Nomenclature, 1992) EC 3.2.1.-.
A group of anaerobic, rod-shaped bacteria that show up as pink (negative) when treated by the Gram-staining method.
Anaerobic degradation of GLUCOSE or other organic nutrients to gain energy in the form of ATP. End products vary depending on organisms, substrates, and enzymatic pathways. Common fermentation products include ETHANOL and LACTIC ACID.
A family of bacteria found in the mouth and intestinal and respiratory tracts of man and other animals as well as in the human female urogenital tract. Its organisms are also found in soil and on cereal grains.
A family of glycosidases that hydrolyse crystalline CELLULOSE into soluble sugar molecules. Within this family there are a variety of enzyme subtypes with differing substrate specificities that must work together to bring about complete cellulose hydrolysis. They are found in structures called CELLULOSOMES.
A mitosporic fungal genus frequently found in soil and on wood. It is sometimes used for controlling pathogenic fungi. Its teleomorph is HYPOCREA.
A species of gram-positive, thermophilic, cellulolytic bacteria in the family Clostridaceae. It degrades and ferments CELLOBIOSE and CELLULOSE to ETHANOL in the CELLULOSOME.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
Enzymes that catalyze the transfer of glucose from a nucleoside diphosphate glucose to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
A large and heterogenous group of fungi whose common characteristic is the absence of a sexual state. Many of the pathogenic fungi in humans belong to this group.
Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.
A cellulose derivative which is a beta-(1,4)-D-glucopyranose polymer. It is used as a bulk laxative and as an emulsifier and thickener in cosmetics and pharmaceuticals and as a stabilizer for reagents.
Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.
A genus of obligately aerobic, thermophilic, gram-negative bacteria in the family Crenotrichaceae. They were isolated from submarine alkaline HOT SPRINGS in Iceland.
A family of bracket fungi, order POLYPORALES, living in decaying plant matter and timber.
The first stomach of ruminants. It lies on the left side of the body, occupying the whole of the left side of the abdomen and even stretching across the median plane of the body to the right side. It is capacious, divided into an upper and a lower sac, each of which has a blind sac at its posterior extremity. The rumen is lined by mucous membrane containing no digestive glands, but mucus-secreting glands are present in large numbers. Coarse, partially chewed food is stored and churned in the rumen until the animal finds circumstances convenient for rumination. When this occurs, little balls of food are regurgitated through the esophagus into the mouth, and are subjected to a second more thorough mastication, swallowed, and passed on into other parts of the compound stomach. (From Black's Veterinary Dictionary, 17th ed)
Methods and techniques used to genetically modify cells' biosynthetic product output and develop conditions for growing the cells as BIOREACTORS.
The rate dynamics in chemical or physical systems.
A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.
A gram-positive, non-spore-forming group of bacteria comprising organisms that have morphological and physiological characteristics in common.
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
A dextrodisaccharide from malt and starch. It is used as a sweetening agent and fermentable intermediate in brewing. (Grant & Hackh's Chemical Dictionary, 5th ed)
The process of cleaving a chemical compound by the addition of a molecule of water.
Polysaccharides consisting of xylose units.
Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.
The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
The first enzyme of the proline degradative pathway. It catalyzes the oxidation of proline to pyrroline-5-carboxylic acid in the presence of oxygen and water. The action is not reversible. The specific activity of proline oxidase increases with age. EC 1.5.3.-.
An enzyme that catalyzes the conversion of prephenate to p-hydroxyphenylpyruvate in the presence of NAD. In the enteric bacteria, this enzyme also possesses chorismate mutase activity, thereby catalyzing the first two steps in the biosynthesis of tyrosine. EC 1.3.1.12.
The vital life force in the body, supposedly able to be regulated by acupuncture. It corresponds roughly to the Greek pneuma, the Latin spiritus, and the ancient Indian prana. The concept of life-breath or vital energy was formulated as an indication of the awareness of man, originally directed externally toward nature or society but later turned inward to the self or life within. (From Comparison between Concepts of Life-Breath in East and West, 15th International Symposium on the Comparative History of Medicine - East and West, August 26-September 3, 1990, Shizuoka, Japan, pp. ix-x)
A genus of aerobic, gram-negative, motile, slightly curved, rod-shaped bacteria. (From Bergey's Manual of Determinative Bacteriology, 9th ed)
A genus of aerobic or facultatively anaerobic BACTERIA, in the family Cellulomonadaceae. It is found in the SOIL and capable of hydrolyzing CELLULOSE.
Any chemical species which accepts an electron-pair from a LEWIS BASE in a chemical bonding reaction.
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
Amide derivatives of phosphoric acid such as compounds that include the phosphoric triamide (P(=O)(N)(N)(N)) structure.

Characterization and cloning of celR, a transcriptional regulator of cellulase genes from Thermomonospora fusca. (1/307)

CelR, a protein that regulates transcription of cellulase genes in Thermomonospora fusca (Actinomycetaceae) was purified to homogeneity. A 6-kilobase NotI-SacI fragment of T. fusca DNA containing the celR gene was cloned into Esherichia coli and sequenced. The celR gene encodes a 340-residue polypeptide that is highly homologous to members of the GalR-LacI family of bacterial transcriptional regulators. CelR specifically binds to a 14-base pair inverted repeat, which has sequence similarity to the binding sites of other family members. This site is present in regions upstream of all six cellulase genes in T. fusca. The binding of CelR to the celE promoter is inhibited specifically by low concentrations of cellobiose (0.2-0.5 mM), the major end product of cellulases. The other sugars tested did not affect binding at equivalent or 50-fold higher concentrations. The results suggest that CelR may act as a repressor, and that the mechanism of induction involves a direct interaction of CelR with cellobiose.  (+info)

Growth of Azospirillum irakense KBC1 on the aryl beta-glucoside salicin requires either salA or salB. (2/307)

The rhizosphere nitrogen-fixing bacterium Azospirillum irakense KBC1 is able to grow on pectin and beta-glucosides such as cellobiose, arbutin, and salicin. Two adjacent genes, salA and salB, conferring beta-glucosidase activity to Escherichia coli, have been identified in a cosmid library of A. irakense DNA. The SalA and SalB enzymes preferentially hydrolyzed aryl beta-glucosides. A Delta(salA-salB) A. irakense mutant was not able to grow on salicin but could still utilize arbutin, cellobiose, and glucose for growth. This mutant could be complemented by either salA or salB, suggesting functional redundancy of these genes in salicin utilization. In contrast to this functional homology, the SalA and SalB proteins, members of family 3 of the glycosyl hydrolases, show a low degree of amino acid similarity. Unlike SalA, the SalB protein exhibits an atypical truncated C-terminal region. We propose that SalA and SalB are representatives of the AB and AB' subfamilies, respectively, in glycosyl hydrolase family 3. This is the first genetic implication of this beta-glucosidase family in the utilization of beta-glucosides for microbial growth.  (+info)

Carbon and electron flow in Clostridium cellulolyticum grown in chemostat culture on synthetic medium. (3/307)

Previous results indicated poor sugar consumption and early inhibition of metabolism and growth when Clostridium cellulolyticum was cultured on medium containing cellobiose and yeast extract. Changing from complex medium to a synthetic medium had a strong effect on (i) the specific cellobiose consumption, which was increased threefold; and (ii) the electron flow, since the NADH/NAD+ ratios ranged from 0.29 to 2.08 on synthetic medium whereas ratios as high as 42 to 57 on complex medium were observed. These data indicate a better control of the carbon flow on mineral salts medium than on complex medium. By continuous culture, it was shown that the electron flow from glycolysis was balanced by the production of hydrogen gas, ethanol, and lactate. At low levels of carbon flow, pyruvate was preferentially cleaved to acetate and ethanol, enabling the bacteria to maximize ATP formation. A high catabolic rate led to pyruvate overflow and to increased ethanol and lactate production. In vitro, glyceraldehyde-3-phosphate dehydrogenase, lactate dehydrogenase, and ethanol dehydrogenase levels were higher under conditions giving higher in vivo specific production rates. Redox balance is essentially maintained by NADH-ferredoxin reductase-hydrogenase at low levels of carbon flow and by ethanol dehydrogenase and lactate dehydrogenase at high levels of carbon flow. The same maximum growth rate (0.150 h-1) was found in both mineral salts and complex media, proving that the uptake of nutrients or the generation of biosynthetic precursors occurred faster than their utilization. On synthetic medium, cellobiose carbon was converted into cell mass and catabolized to produce ATP, while on complex medium, it served mainly as an energy supply and, if present in excess, led to an accumulation of intracellular metabolites as demonstrated for NADH. Cells grown on synthetic medium and at high levels of carbon flow were able to induce regulatory responses such as the production of ethanol and lactate dehydrogenase.  (+info)

Cellobiose transport by mixed ruminal bacteria from a Cow. (4/307)

The transport of cellobiose in mixed ruminal bacteria harvested from a holstein cow fed an Italian ryegrass hay was determined in the presence of nojirimycin-1-sulfate, which almost inhibited cellobiase activity. The kinetic parameters of cellobiose uptake were 14 microM for the Km and 10 nmol/min/mg of protein for the Vmax. Extracellular and cell-associated cellobiases were detected in the rumen, with both showing higher Vmax values and lower affinities than those determined for cellobiose transport. The proportion of cellobiose that was directly transported before it was extracellularly degraded into glucose increased as the cellobiose concentration decreased, reaching more than 20% at the actually observed levels of cellobiose in the rumen, which were less than 0.02 mM. The inhibitor experiment showed that cellobiose was incorporated into the cells mainly by the phosphoenolpyruvate phosphotransferase system and partially by an ATP-dependent and proton-motive-force-independent active transport system. This finding was also supported by determinations of phosphoenolpyruvate phosphotransferase-dependent NADH oxidation with cellobiose and the effects of artificial potentials on cellobiose transport. Cellobiose uptake was sensitive to a decrease in pH (especially below 6.0), and it was weakly but significantly inhibited in the presence of glucose.  (+info)

Characterization of the binding protein-dependent cellobiose and cellotriose transport system of the cellulose degrader Streptomyces reticuli. (5/307)

Streptomyces reticuli has an inducible ATP-dependent uptake system specific for cellobiose and cellotriose. By reversed genetics a gene cluster encoding components of a binding protein-dependent cellobiose and cellotriose ABC transporter was cloned and sequenced. The deduced gene products comprise a regulatory protein (CebR), a cellobiose binding lipoprotein (CebE), two integral membrane proteins (CebF and CebG), and the NH2-terminal part of an intracellular beta-glucosidase (BglC). The gene for the ATP binding protein MsiK is not linked to the ceb operon. We have shown earlier that MsiK is part of two different ABC transport systems, one for maltose and one for cellobiose and cellotriose, in S. reticuli and Streptomyces lividans. Transcription of polycistronic cebEFG and bglC mRNAs is induced by cellobiose, whereas the cebR gene is transcribed independently. Immunological experiments showed that CebE is synthesized during growth with cellobiose and that MsiK is produced in the presence of several sugars at high or moderate levels. The described ABC transporter is the first one of its kind and is the only specific cellobiose/cellotriose uptake system of S. reticuli, since insertional inactivation of the cebE gene prevents high-affinity uptake of cellobiose.  (+info)

Microbial reduction of Fe(III) in acidic sediments: isolation of Acidiphilium cryptum JF-5 capable of coupling the reduction of Fe(III) to the oxidation of glucose. (6/307)

To evaluate the microbial populations involved in the reduction of Fe(III) in an acidic, iron-rich sediment, the anaerobic flow of supplemental carbon and reductant was evaluated in sediment microcosms at the in situ temperature of 12 degrees C. Supplemental glucose and cellobiose stimulated the formation of Fe(II); 42 and 21% of the reducing equivalents that were theoretically obtained from glucose and cellobiose, respectively, were recovered in Fe(II). Likewise, supplemental H(2) was consumed by acidic sediments and yielded additional amounts of Fe(II) in a ratio of approximately 1:2. In contrast, supplemental lactate did not stimulate the formation of Fe(II). Supplemental acetate was not consumed and inhibited the formation of Fe(II). Most-probable-number estimates demonstrated that glucose-utilizing acidophilic Fe(III)-reducing bacteria approximated to 1% of the total direct counts of 4', 6-diamidino-2-phenylindole-stained bacteria. From the highest growth-positive dilution of the most-probable-number series at pH 2. 3 supplemented with glucose, an isolate, JF-5, that could dissimilate Fe(III) was obtained. JF-5 was an acidophilic, gram-negative, facultative anaerobe that completely oxidized the following substrates via the dissimilation of Fe(III): glucose, fructose, xylose, ethanol, glycerol, malate, glutamate, fumarate, citrate, succinate, and H(2). Growth and the reduction of Fe(III) did not occur in the presence of acetate. Cells of JF-5 grown under Fe(III)-reducing conditions formed blebs, i.e., protrusions that were still in contact with the cytoplasmic membrane. Analysis of the 16S rRNA gene sequence of JF-5 demonstrated that it was closely related to an Australian isolate of Acidiphilium cryptum (99.6% sequence similarity), an organism not previously shown to couple the complete oxidation of sugars to the reduction of Fe(III). These collective results indicate that the in situ reduction of Fe(III) in acidic sediments can be mediated by heterotrophic Acidiphilium species that are capable of coupling the reduction of Fe(III) to the complete oxidation of a large variety of substrates including glucose and H(2).  (+info)

Identification of Ruminococcus flavefaciens as the predominant cellulolytic bacterial species of the equine cecum. (7/307)

Detection and quantification of cellulolytic bacteria with oligonucleotide probes showed that Ruminococcus flavefaciens was the predominant species in the pony and donkey cecum. Fibrobacter succinogenes and Ruminococcus albus were present at low levels. Four isolates, morphologically resembling R. flavefaciens, differed from ruminal strains by their carbohydrate utilization and their end products of cellobiose fermentation.  (+info)

The bvr locus of Listeria monocytogenes mediates virulence gene repression by beta-glucosides. (8/307)

The beta-glucoside cellobiose has been reported to specifically repress the PrfA-dependent virulence genes hly and plcA in Listeria monocytogenes NCTC 7973. This led to the hypothesis that beta-glucosides, sugars of plant origin, may act as signal molecules, preventing the expression of virulence genes if L. monocytogenes is living in its natural habitat (soil). In three other laboratory strains (EGD, L028, and 10403S), however, the effect of cellobiose was not unique, and all fermentable carbohydrates repressed hly. This suggested that the downregulation of virulence genes by beta-glucosides is not a specific phenomenon but, rather, an aspect of a global regulatory mechanism of catabolite repression (CR). We assessed the effect of carbohydrates on virulence gene expression in a panel of wild-type isolates of L. monocytogenes by using the PrfA-dependent phospholipase C gene plcB as a reporter. Utilization of any fermentable sugar caused plcB repression in wild-type L. monocytogenes. However, an EGD variant was identified in which, as in NCTC 7973, plcB was only repressed by beta-glucosides. Thus, the regulation of L. monocytogenes virulence genes by sugars appears to be mediated by two separate mechanisms, one presumably involving a CR pathway and another specifically responding to beta-glucosides. We have identified in L. monocytogenes a 4-kb operon, bvrABC, encoding an antiterminator of the BglG family (bvrA), a beta-glucoside-specific enzyme II permease component of the phosphoenolpyruvate-sugar phosphotransferase system (bvrB), and a putative ADP-ribosylglycohydrolase (bvrC). Low-stringency Southern blots showed that this locus is absent from other Listeria spp. Transcription of bvrB was induced by cellobiose and salicin but not by arbutin. Disruption of the bvr operon by replacing part of bvrAB with an interposon abolished the repression by cellobiose and salicin but not that by arbutin. Our data indicate that the bvr locus encodes a beta-glucoside-specific sensor that mediates virulence gene repression upon detection of cellobiose and salicin. Bvr is the first sensory system found in L. monocytogenes that is involved in environmental regulation of virulence genes.  (+info)

The use of inedible lignocellulosic biomasses for biomanufacturing provides important environmental and economic benefits for society. Efficient co-utilization of lignocellulosic biomass-derived sugars, primarily glucose and xylose, is critical for the viability of lignocellulosic biorefineries. However, the phenomenon of glucose repression prevents co-utilization of both glucose and xylose in cellulosic hydrolysates. To circumvent glucose repression, co-utilization of cellobiose and xylose by Bacillus coagulans NL01 was investigated. During co-fermentation of cellobiose and xylose, B. coagulans NL01 simultaneously consumed the sugar mixtures and exhibited an improved lactic acid yield compared with co-fermentation of glucose and xylose. Moreover, the cellobiose metabolism of B. coagulans NL01 was investigated for the first time. Based on comparative genomic analysis, two gene clusters that encode two different operons of the cellobiose-specific phosphoenolpyruvate-dependent phosphotransferase system
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
We propose to develop a cell-specific isotope labeling technology to study cancer metabolism and metabolite exchange in the intact animal. Our technology addresses a major limitation of most metabolomic studies on cancer, namely that they have been mostly performed on simple cell-culture systems. The metabolic interactions of a cancer cell with its environment have been largely ignored and remain uncharacterized. This is because current metabolomic technologies cannot resolve metabolites from each of the various cell types of a mixed culture or tissue. Therefore, current approaches cannot measure metabolite exchange between tumors and their neighboring cells. Yet, these interactions have been suggested to define tumor phenotype. We exploit the fact that vertebrate cells do not take up or utilize the carbohydrate cellobiose. Cellobiose consists of two glucose molecules joined by a á-linkage. We will genetically engineer human fibroblast and HeLa cell lines that can take up and digest ...
Cellulose, Biomass, Cellobiose, Concentration, Glucose, Hydrolysis, Inhibition, Ethanol, Achievement, Bioreactor, Cellulase, Kinetics, Nature, Paper, Enzyme Stability, Enzymes, Membrane, Membranes, Set
It catalyzes an exceptionally high rate of oxidation of a wide range of aldose sugars, including D-glucose, galactose, arabinose and xylose, and also the disaccharides lactose, cellobiose and maltose ...
Arabinose, Acetic Acid, Acids, Cellobiose, Concentration, Concentrations, Furfural, Glucose, Membrane, Membranes, Molecular Weight, PH, Polyamide, Polyethylene, Rice, Separation, Sugars, Xylose
We provide here the underlying data of the scientific publication Product solubility control in cellooligosaccharide production by coupled cellobiose and cellodextrin phosphorylase. Please find the abstract below: Soluble cellodextrins (linear β‐1,4‐D‐gluco‐oligosaccharides) have interesting applications as ingredients for human and animal nutrition. Their bottom‐up synthesis from glucose is promising for bulk production, but to ensure a completely watersoluble product via degree of polymerization (DP) control (DP ≤ 6) is challenging. Here, we show biocatalytic production of cellodextrins with DP centered at 3 to 6 (~96 wt.% of total product) using coupled cellobiose and cellodextrin phosphorylase. The cascade reaction, wherein glucose was elongated sequentially from α‐glucose 1‐phosphate (αGlc1‐P), required optimization and control at two main points. First, kinetic and thermodynamic restrictions upon αGlc1‐P utilization (200 mM; 45°C, pH 7.0) were effectively overcome (53%
Ustilagic acid is an organic compound with the formula C36H64O18. The acid is a cellobiose lipid produced by the corn smut fungus Ustilago maydis under conditions of nitrogen starvation. The acid was discovered in 1950 and was proved to be an amphipathic glycolipid with surface active properties. The name comes from Latin ustus which means burnt and refers to the scorched appearance of the smut fungi. Cellobiose lipids are known as biosurfactants and natural detergents. They can be used in pharmaceutical, cosmetic, and food applications and are known for their strong fungicidal activity on many species.The yeast Pseudozyma fusiformata and Pseudozyma graminicola secrete ustilagic acids, 2-O-3-hydroxyhexanoyl-beta-D-glucopyranosyl-(1→4)-6-O-acetyl-beta-D-glucopyranosyl-(1→16)-2,15,16- trihydroxyhexadecanoic acid. Similar compounds are the extracellular cellobiose lipids of the yeasts Cryptococcus humicola and Trichosporon porosum : ...
Biodegradable plastics can be made from polylactate, which is a polymer made from lactic acid. This compound can be produced from renewable resources as substrates using microorganisms. Bacillus subtilis is a Gram-positive bacterium recognized as a GRAS microorganism (g enerally r egarded a s s afe) by the FDA. B. subtilis produces and secretes different kind of enzymes, such as proteases, cellulases, xylanases and amylases to utilize carbon sources more complex than the monosaccharides present in the environment. Thus, B. subtilis could be potentially used to hydrolyze carbohydrate polymers contained in lignocellulosic biomass to produce chemical commodities. Enzymatic hydrolysis of the cellulosic fraction of agroindustrial wastes produces cellobiose and a lower amount of glucose. Under aerobic conditions, B. subtilis grows using cellobiose as substrate. In this study, we proved that under non-aerated conditions, B. subtilis ferments cellobiose to produce L-lactate with 82% of the theoretical yield,
Two intracellular enzymes, cellobiose phosphorylase (CBP) and cellodextrin phosphorylase (CDP) are involved in the phosphorolytic pathway in cellulose degradation. Those enzymes are considered to be useful in syntheses of oligosaccharides because the reactions are reversible. CBP from Cellvibrio gilvus and Clostridium thermocellum YM4, and CDP from C. thermocellum YM4 were cloned and over-expressed in Escherichia coli. All the three enzymes showed ordered bi bi mechanism. However the orders of the substrate binding of the CBPs were different. It was found that CBP from C. gilvus strictly recognized the hydroxyl groups at positions β-1, 3, and 4 of the acceptor molecule in the reverse reaction. On the other hand, the recognition of the hydroxyl groups at positions 2 and 6 was not so strict. Three branched β-1, 4-glucosyl trisaccharides were synthesized by using the reverse reaction of C. gilvus CBP. A new substrate inhibition pattern, competitive substrate inhibition, was also found in the ...
Clostridium termitidis CT1112 is an anaerobic, Gram-positive, mesophilic, spore-forming, cellulolytic bacterium, originally isolated from the gut of a wood feeding termite Nasusitermes lujae. It has the ability to hydrolyze both cellulose and hemicellulose, and ferment the degradation products to acetate, formate, ethanol, lactate, H2, and CO2. It is therefore ges in gene and gene product expression during growth of C. termitidis on cellobiose, xylose, xylan, and α-cellulose. Correlation of transcriptome and proteome data with growth and fermentation profiles identified putative carbon-catabolism pathways in C. termitidis. The majority of the proteins associated with central metabolism were detected in high abundance. While major differences were not observed in gene and gene-product expression for enzymes associated with metabolic pathways under the different substrate conditions, xylulokinase and xylose isomerase of the pentose phosphate pathway were found to be highly up
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
AA3 enzymes belong to the glucose-methanol-choline (GMC) oxidoreductases family. AA3 enzymes are flavoproteins containing a flavin-adenine dinucleotide (FAD)-binding domain. Family AA3 can be divided into 4 subfamilies: AA3_1 (mostly cellobiose dehydrogenases), AA3_2 (including both aryl alcohol oxidase and glucose 1-oxidase), AA3_3 (alcohol oxidase) and AA3_4 (pyranose 2-oxidase ...
High purity Cellotriose for use in research, biochemical enzyme assays and in vitro diagnostic analysis. Purchase Cellotriose here.
Heteropolyacids (H3PW12O40, H4SiW12O40) and salts of metal cations (Mn+) and PW12O403− (M3/nPW12O40) act as effective homogeneous catalysts for selective hydrolysis of cellobiose and cellulose to glucose and total reducing sugars (TRS), respectively, in an aqueous phase. For Brønsted acid catalysts,
Cytophaga hutchinsonii can rapidly digest crystalline cellulose without free cellulases or cellulosomes. Its cell-contact cellulose degradation mechanism is unknown. In this study, the four β-glucosidase (bgl) genes in C. hutchinsonii were singly and multiply deleted, and the functions of these β-glucosidases in cellobiose and cellulose degradation were investigated. We found that the constitutively expressed BglB played a key role in cellobiose utilization, while BglA which was induced by cellobiose could partially make up for the deletion of bglB. The double deletion mutant ΔbglA/bglB lost the ability to digest cellobiose and could not thrive in cellulose medium, indicating that β-glucosidases were important for cellulose degradation. When cultured in cellulose medium, a small amount of glucose accumulated in the medium in the initial stage of growth for the wild type, while almost no glucose accumulated for ΔbglA/bglB. When supplemented with a small amount of glucose, ΔbglA/bglB started to
During studies of human periodontal disease, a number of bacterial strains were encountered that, on the basis of results of standard biochemical tests, appeared to be Prevotella buccalis, Prevotella denticola, Prevotella melaninogenica, or Prevotella loescheii. However, use of the standard biochemical tests, cellular fatty acid analyses, and the polyacrylamide gel electrophoresis patterns of soluble proteins resulted in conflicting identifications of these strains. The results of tests for cellobiose fermentation, inulin fermentation, and pigment production were responsible for most of the discordant results. Cellular fatty acid analyses in which the Microbial Identification System was used did not differentiate these strains from validly described species, even though separate library entries were created for them. DNA reassociation determinations in which the S1 nuclease procedure was used showed that cellobiose fermentation and pigment production are variable among strains of P. melaninogenica and P
One-pot catalytic hydrolysis/hydrogenation of cellobiose into hexitols over Ru/Al-MCM-48 A. Romero, J.A. Díaz, A. Nieto-Márquez, N. Essayem, E. Alonso, C. Pinel Microporous and Mesoporous Materials Volume 271, 15 November 2018, Pages 186-195 Access to full-text (free available before July 25, 2018): https://authors.elsevier.com/c/1XArD4xQ95owkV Abstract The simultaneous catalytic hydrolysis and hydrogenation of cellobiose, as a model constituent […]. Read More. ...
WBGene00001198 not CELE_ in pgid 348 WBGene00001198 not CELE_ in pgid 350 WBGene00001198 not CELE_ in pgid 351 WBGene00001198 not CELE_ in pgid 352 WBGene00002126 not CELE_ in pgid 1424 WBGene00009821 not CELE_ in pgid 1520 WBGene00012263 not CELE_ in pgid 2914 WBGene00043408 not CELE_ in pgid 2914 WBGene00009175 not CELE_ in pgid 2914 WBGene00016878 not CELE_ in pgid 2914 WBGene00020512 not CELE_ in pgid 2914 WBGene00019252 not CELE_ in pgid 2914 WBGene00015732 not CELE_ in pgid 3033 WBGene00003454 not CELE_ in pgid 3330 WBGene00003440 not CELE_ in pgid 3330 WBGene00003441 not CELE_ in pgid 3330 WBGene00003427 not CELE_ in pgid 3330 WBGene00003461 not CELE_ in pgid 3330 WBGene00003459 not CELE_ in pgid 3330 WBGene00003428 not CELE_ in pgid 3330 WBGene00003447 not CELE_ in pgid 3330 WBGene00003455 not CELE_ in pgid 3330 WBGene00003453 not CELE_ in pgid 3330 WBGene00003436 not CELE_ in pgid 3330 WBGene00003439 not CELE_ in pgid 3330 WBGene00023572 not CELE_ in pgid 4733 WBGene00023572 not CELE_ ...
WBGene00001198 not CELE_ in pgid 348 WBGene00001198 not CELE_ in pgid 350 WBGene00001198 not CELE_ in pgid 351 WBGene00001198 not CELE_ in pgid 352 WBGene00002126 not CELE_ in pgid 1424 WBGene00009821 not CELE_ in pgid 1520 WBGene00012263 not CELE_ in pgid 2914 WBGene00043408 not CELE_ in pgid 2914 WBGene00009175 not CELE_ in pgid 2914 WBGene00016878 not CELE_ in pgid 2914 WBGene00020512 not CELE_ in pgid 2914 WBGene00019252 not CELE_ in pgid 2914 WBGene00015732 not CELE_ in pgid 3033 WBGene00003454 not CELE_ in pgid 3330 WBGene00003440 not CELE_ in pgid 3330 WBGene00003441 not CELE_ in pgid 3330 WBGene00003427 not CELE_ in pgid 3330 WBGene00003461 not CELE_ in pgid 3330 WBGene00003459 not CELE_ in pgid 3330 WBGene00003428 not CELE_ in pgid 3330 WBGene00003447 not CELE_ in pgid 3330 WBGene00003455 not CELE_ in pgid 3330 WBGene00003453 not CELE_ in pgid 3330 WBGene00003436 not CELE_ in pgid 3330 WBGene00003439 not CELE_ in pgid 3330 WBGene00023572 not CELE_ in pgid 4733 WBGene00023572 not CELE_ ...
Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. Is also able to hydrolyze phospho-N,N-diacetylchitobiose.
And again, you drink a solution of lactulose and mannitol sugars. . than one child will tell you, just like adults, babies have preferences and likes and dislikes. . is usually in turn caused by nutrient deficiencies, specifically iron, folate, B12,
bsr:I33_4084 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) beta-glucosidase (A) MSSNAKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPYDESMTSLNLYHN GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLSFYDDLFDELLKHH IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL HAPFTGGGLVFEEGENKRNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY QKPLFIVENGLGAVDKVEDDGTIQDDYRINYLRDHLIEVREAIADGVELIGYTSWGPIDL VSASTAEMKKRYGFIYVDRDNEGNGTLNRIKKKSFIWYQQVIATNGESI ...
kpu:KP1_1806 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) putative family 1 glycoside hydrolase (A) MTSHIPRRSMKNRLPADFLWGNSVSSMQTEGAWNEGGKGMSVYDIRQPAEFASDWKVATD SYHRYREDFDLMQDLGMNCYRFQIAWSRVCPDGDGEFNEQGIAFYHQFIDELIARGIEPM ICLYHFDMPLSLAERYNGFTDRRVMDAFIRYGQKMIACYGDKVKYWLTFNEQNLYHSPEA FLISGYLQGEKTLRELYLIQHHVMMAHVHLTHYLHQTKPQCLMGGMLAHALVYPATCKPR DILCAQQLDEFLNQNLLRAYAGEGYSPEVMHFVAAEGFDDIYRPEDLALMATVKVDYLAF SFYASRTLNSDAIPPGTAVNNYMLFGNQDNPFLKATEWNWQIDPLGFRTIITRYYNDWRL PVFPIENGIGVIESWDGEHPIADDYRIAYHRDHINAMKAAIFEDGAQVIGYLGWGLIDIL SSQGDMRKRYGVVYVNRENHDLKDLRRVPKKSYAWLKQVFRSNGEAM ...
Complete information for CELSR3 gene (Protein Coding), Cadherin EGF LAG Seven-Pass G-Type Receptor 3, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Today Leerink is publishing its second of two notes on Celgene Corporations (NASDAQ:CELG) ozanimod that focuses on the products value; in its current forecast the firm estimates that ozanimod is worth $19/ share (13% of its PT) in the base case scen
SUMMIT, N.J.--(BUSINESS WIRE)--Oct. 24, 2013-- Celgene Corporation (NASDAQ:CELG) reported third quarter 2013 total revenue of $1,674 million compared to $1,419 million in the third quarter 2012. Net product sales were $1,644 million, an 18 perce...
SUMMIT, N.J.--(BUSINESS WIRE)-- Celgene Corporation (NASDAQ:CELG) today announced more than 65 presentations reporting on investigational studies in blood and solid tumor cancers will be pres...
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Research from Citrix and Cebr has found that more flexible working could save the UK economy billions as well as including more people into the workforce
Date privind reconcilierea calculelor trimestriale a produsului intern brut cu cele anuale; Ajustarea sezoniera a produsului intern brut, principalelor activitati economice ...
Am citit, am inteles si sunt de acord cu cele specificate in sectiunea referitoare la prelucrarea datelor cu caracter personal ...
Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. Isolation and characterization of Selenomonas ruminantium strains capable of 2-deoxyribose utilization
Effects of kraft pulp and lignin on Trametes versicolor carbon metabolism. Purification and characterization of cellobiose dehydrogenases from the white rot fungus Trametes versicolor
TY - GEN. T1 - Enhanced xylitol production through simultaneous co-consumption of cellobiose and xylose by an engineereed saccharomyces cerevisiae strain. AU - Oh, Eun Joong. AU - Ha, Suk Jin. AU - Kim, Soo Rin. AU - Galazka, Jonathan M.. AU - Cate, Jamie H.D.. AU - Su Jin, Yong. PY - 2011/1/1. Y1 - 2011/1/1. UR - http://www.scopus.com/inward/record.url?scp=85054765849&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=85054765849&partnerID=8YFLogxK. M3 - Conference contribution. AN - SCOPUS:85054765849. SN - 9781618397362. T3 - Fuels and Petrochemicals Division - Core Programming Topic at the 2011 AIChE Annual Meeting. BT - Fuels and Petrochemicals Division - Core Programming Topic at the 2011 AIChE Annual Meeting. PB - AIChE. ER - ...
PURPOSE: Recent evidence suggests that taurine and myoinositol may serve as organic osmolytes in a number of cells, including lens and retinal pigment epithelia, but the mechanism for their increased accumulation in response to hypertonic stress is not known. To assess whether NaK ATPase contributed to the elevated levels of taurine and myoinositol in cells exposed to hypertonic media, we measured the activity of NaK ATPase, which is known to be implicated in the transport of these substances, in human lens and retinal pigment epithelia cultured in isotonic and hypertonic media. METHODS: Primary cultures of human lens epithelial (HLE) and human retinal pigment epithelial (HRPE) cells were maintained in isotonic and hypertonic media for varying periods of time, and the activity of NaK ATPase and the levels of taurine and myoinositol were measured in cells cultured under two different conditions. The possible involvement of the transport enzyme in the accumulation of the two osmolytes was also ...
Ferulic acid acylation of oligosaccharides catalyzed by feruloyl esterases (FAE) is a promising route to produce feruloylated oligosaccharides. However, modulation of FAE synthetic properties is a key step to improve the acylation. The efficiency of H. insolens FAE to catalyze the feruloylation in six different surfactantless microemulsions reaction systems was evaluated. The highest yield (57%) w ...
Marques De Gelida Reserva, Macabeo Xarel-Lo Parellada Chardonnay 2004: Charismatic! This bubbly is a blend of 35% Macabeo, 30% ... Natalie's Rating >
1,4-β-D-Cellotriitol (borohydride reduced cellotriose) [MO-CTRRD] - CAS: 61473-64-1 Molecular Formula: C18H34O16 Molecular Weight: 506.4 Purity: | 95% High purity 1,4-β-D-Cellotriitol (borohydride reduced cellotriose) for use in research, biochemical enzyme assays and in vitro diagnostic analysis. Trisaccharides from hydrolysis of cellulose and borohydride reduced. Store at room temperature.
tr:B2VKZ2_ERWT9] bglA; BglA protein, 6-phospho-beta-glucosidase (involved in beta-glucoside utilization); K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] ...
Cellulose. Glucose-based Polymeric Fibres. The cellulose is an organic compound of polymeric nature. The reaction of the condensation of D-Glucose monomers gives rise to the synthesis of a linear macromolecule (polymer). The glucose molecules are united by a glyosidic bond called beta (1-4) that connects the site 1 of a unity with the site 4 of the following unit with the OH equatorial anomeric.. The partial cell hydrolysis creates a cellobiose, made of two glucose units always with beta bond (1-4). Unlike the cellulose, the starch has alfa glyosidic bonds. The mammals have enzymes (amylases) that can hydrolyse only the alfa bond. Therefore they can metabolize the starch but not the cellulose.. The cellulose does not have a homogeneous chemical-physical structure, in fact we can distinguish phases with a different crystallization grade. The presence of many OH-groups entails the formation of many hydrogen bonds among different sites of the polymeric chain and therefore supports the ...
This record was replaced or removed. The sequence YP_006173076 is 100% identical to WP_000012618.1 over its full length. Be aware that a NCBI nonredundant RefSeq protein (WP_) can be annotated on large numbers of bacterial genomes that encode that identical protein.. Old YP_006173076.1 New WP_000012618.1 Identical proteins Re-annotation project. ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
In enzymology, a 6-phospho-beta-glucosidase (EC 3.2.1.86) is an enzyme that catalyzes the chemical reaction: 6-phospho-beta-D-glucosyl-(1,4)-D-glucose + H2O → D-glucose
Assume the role of bioengineer as you extract, assess, and optimize cellobiase function for biofuel production and connect enzyme activity with mushroom ecology.
Make Your Selection Below for Quantity and Type of Hole if you wish to have the cels punched. Your choices are; Acme PUNCHED, Round PUNCHED or UnPUNCHED. Select Carefully Before You Place Your Order. ...
1J83: Recognition of cello-oligosaccharides by a family 17 carbohydrate-binding module: an X-ray crystallographic, thermodynamic and mutagenic study.
Costurile Arbitrajului comparativ cu cele din instanța de drept comun - între mit și realitate Author: Alina Cobuz Băgnaru, Partener Fondator, Cobuz şi Asociaţii S-a subliniat în numeroase rânduri că unul din avantajele arbitrajului este și costul scăzut al acestei proceduri, în comparație cu costurile din instanța de drept comun. Această afirmație trebuie analizată…
Explicatii la cateva din cele mai des intalnite constante biologice sau analize medicale: Acid uric, Aglutinine, Alanin-amino-transferaza, Aloimunizare, Anatoxina, Antiser, Antistreptokinaza, Antistre
Produse Cosmetice - Bvlgari. Cumpara online de pe Esteto.ro produse din categoria Produse Cosmetice marca Bvlgari la cele mai bune preturi. Livrare rapida prin curier.
Produse Cosmetice - B-Touch. Cumpara online de pe Esteto.ro produse din categoria Produse Cosmetice marca B-Touch la cele mai bune preturi. Livrare rapida prin curier.
Pensiuni Neptun-Olimp, cele mai bune preturi la pensiuni Neptun-Olimp 2022, vezi lista cu pensiuni din statiunea Neptun-Olimp - Litoralul Romanesc
Maltose, cellobiose, and chitobiose are hydrolysis products of the polysaccharides starch, cellulose, and chitin, respectively ... maltose and cellobiose are examples of reducing disaccharides, each with one hemiacetal unit, the other occupied by the ...
Phosphorylation of cellobiose with adenosine 5'-triphosphate by a -glucoside kinase". J. Biol. Chem. 247 (11): 3415-9. PMID ... The systematic name of this enzyme class is ATP:cellobiose 6-phosphotransferase. This enzyme is also called beta-D-glucoside ... In enzymology, a beta-glucoside kinase (EC 2.7.1.85) is an enzyme that catalyzes the chemical reaction ATP + cellobiose ⇌ {\ ... the two substrates of this enzyme are ATP and cellobiose, whereas its two products are ADP and 6-phospho-beta-D-glucosyl-(1,4)- ...
Palmer RE, Anderson RL (1972). "Cellobiose metabolism in Aerobacter aerogenes. 3. Cleavage of cellobiose monophosphate by a ...
Henriksson G, Johansson G, Pettersson G (March 2000). "A critical review of cellobiose dehydrogenases". J. Biotechnol. 78 (2): ... EC 1.1.3.13 and cellobiose dehydrogenase EC 1.1.99.18 which share a number of regions of sequence similarities. They contain ...
"Induction of Cellulases in chaetomium cellulolyticumby cellobiose". Biotechnology and Bioengineering. 27 (9): 1389-91. doi: ...
"Cloning and analysis of Pycnoporus cinnabarinus cellobiose dehydrogenase". Gene. 234 (1): 23-33. doi:10.1016/S0378-1119(99) ...
doi:10.1016/S0007-1536(72)80067-6. Heale, J. B.; Gupta, D. P. (1970). "The Utilization of Cellobiose by Verticillium albo-atrum ... Heale, JB; Gupta, DP (1970). "The utilization of cellobiose by Verticillium albo-atrum". Journal of General Microbiology. UK: ...
In this cell-free biosystem, beta-1,4-glycosidic bond-linked cellulose is partially hydrolyzed to cellobiose. Cellobiose ...
When predating on nematodes, the fungus uses cellobiose, L-asparagine, L-arginine, DL glutamic acid for its carbon and nitrogen ... Saprophytic growth uses D-xylose, D-mannose, and cellobiose. The fungus uses nitrite, nitrate, and ammonium for its nitrogen ...
Cellobiose lipids are known as biosurfactants and natural detergents. They can be used in pharmaceutical, cosmetic, and food ... The acid is a cellobiose lipid produced by the corn smut fungus Ustilago maydis under conditions of nitrogen starvation. The ... Similar compounds are the extracellular cellobiose lipids of the yeasts Cryptococcus humicola and Trichosporon porosum : 2,3,4- ...
nov., moderately thermophilic, cellulose-/cellobiose-digesting bacteria isolated from methanogenic sludge". International ...
investigated use of cellobiose phosphorylase (CP) toward synthesis of alpha-glycosides in ionic liquids. The best condition for ... "Chemoenzymatic Synthesis of β-D Glucosides using Cellobiose Phosphorylase from Clostridium thermocellum". Advanced Synthesis & ...
Ért.) "Verhalten der Cellobiose u. ihres Osons gegen einige Enzyme" (with Emil Fischer; Berlin, 1909-10; Liebig's Annalen, and ... "Einige Derivate der Cellobiose" (with Emil Fischer; Budapest, 1911; Berichte der deutschen Chemischen Gesellschaft) "Studien ...
It ferments glucose, oxidizes sucrose, oxidizes glycerol, oxidizes mannose, and oxidizes cellobiose. H. elongata is catalase ...
Cellulose may be further hydrolyzed to cellobiose or glucose in an acidic medium. Humans cannot digest cellulose and excrete ...
They ferment D-glucose and also ferment D-mannitol, L-rhamnose and cellobiose. They are negative for indole production, urea ...
The former can transport aromatic β-glucosides and cellobiose, as well as Chb. However, only Chb induces expression of the chb ...
equuli is not capable of fermenting cellobiose, whereas the opposite is true for A. equuli subsp. haemolyticus, indicated by a ... negative and positive result for the cellobiose fermentation test, respectively. However, both subspecies are positive for ...
negative for F7 Melibiose, F8 Lactose, F9 Cellobiose, F11 Raffinose, F12 Inulin, F14 D-xylose. negative delay after 7 days for ...
BglB is the main β-glucosidase gene transcribed when cells are grown in glucose or cellobiose cultures. BglA is only ... Additionally, adding degrading cellodextrins in the periplasm could increase efficiency by reducing loss of cellobiose to ... turning cellobiose (a disaccharide) into glucose. β-glucosidases belong to GH3, another glycoside hydrolase family. C. ... cells are unable to degrade cellobiose. Unlike other β-glucosidases, BglA's hydrolytic activity does not decrease with longer ...
... cellobiose. Research suggests, however, that the activity of CBH1 is very strong inhibited by the product, cellobiose. ... Determination of an enzyme that is not as strongly inhibited by the product or finding a way to remove cellobiose from the ... releasing cellobiose from the non-reducing ends of the chains CBH1 from yeast, for example, is composed of a carbohydrate ... it is strung through a tunnel-shaped active site where the cellulose is broken down into two-sugar segments called cellobiose. ...
sciuri was originally used to categorize 35 strains shown to use cellobiose, galactose, sucrose, and glycerol. Kloos, W. E.; ...
In Escherichia coli, the chb operon is involved with the utilization of cellobiose and β-glucosides chitobiose. The chbG gene ...
P. raffinosivorans can ferment glucose, cellobiose, maltose, fructose, mannitol, mannose, ribose, sucrose, and arabinose to ...
... fructose and cellobiose. PTS sugars can differ between bacterial groups, mirroring the most suitable carbon sources available ...
In the case of the Christmas Island red crab beta glucosidase not only produces glucose, but also removes cellobiose. This is ... The purpose of the reaction is to remove the residues from disaccharide cellobiose to produce glucose during the hydrolysis of ... In the case of beta-glucosidase, two carboxylate residues of glucosides, cellobiose, cellotriose, cellotetraose are involved at ... important as cellobiose is an inhibitor for a number of enzymes including endo-β-1,4-glucanase and cellobiohydrolase. Beta- ...
... cellobiose, inulin, a-methyl mannoside, dulcitol, and inositol are not used by the species; xylose, glycogen, a-methyl ... cellobiose, glycogen, inulin, a-methyl mannoside, dulcitol, and inositol were insufficient to allow flight, indicated by a ...
Cellulose is first hydrolyzed to cellobiose by cellulase and then cellobiose is further hydrolyzed to glucose by beta- ... Ruminants such as cows are able to hydrolyze cellulose into cellobiose and then glucose because of symbiotic bacteria that ...
... cellobiose, β-glucans, starch, and protein sources (tryptone, peptone, casein, and meat extracts). This is a relatively wide ...
T. roseus was found to oxidize glucose, fructose, galactose, mannose, xylose, sucrose, maltose, arabinose, cellobiose, and many ...
Cellobiose is a disaccharide with the formula (C6H7(OH)4O)2O. It is classified as a reducing sugar. In terms of its chemical ... Cellobiose has eight free alcohol (OH) groups, one acetal linkage and one hemiacetal linkage, which give rise to strong inter- ... Cellobiose can be used as an indicator carbohydrate for Crohns disease and malabsorption syndrome. Treatment of cellulose with ... 1] Braun, G. (1943). "α-Cellobiose Octaacetate" (PDF). Organic Syntheses. Collected Volume 2: 124. and Braun, G. (1937). "α- ...
In enzymology a cellobiose epimerase (EC 5.1.3.11) is an enzyme that catalyzes the chemical reaction cellobiose ⇌ {\ ... The systematic name of this enzyme class is cellobiose 2-epimerase. Enzymes like these can produce a more rapid syndrome that ... displaystyle \rightleftharpoons } D-glucosyl-D-mannose Hence, this enzyme has one substrate, cellobiose, and one product, D- ...
Cellobiose. Accession Number. DB02061 (EXPT00844) Type. Small Molecule. Groups. Experimental. Description. A disaccharide ... Hajime Taniguchi, Takashi Sasaki, Motomitsu Kitaoka, Method for preparing cellobiose. U.S. Patent US5077205, issued January, ...
Cellobiose is a kind of sugar.. This word is from biochemistry and cellobiose is part of the disaccharide group of sugars. This ... Water and cellulose make cellobiose: this process is called hydrolysis.. Pure cellobiose is a white powder.[2] People cannot ... Cellobiose is made from cellulose, which comes from the cells of plants. Things that have a lot of cellulose are good for ... Retrieved from "https://simple.wikipedia.org/w/index.php?title=Cellobiose&oldid=5617842" ...
Ionization of Cellobiose in Aqueous Alkali and the Mechanism of Cellulose Dissolution. Journal article ... Chemical shift differences between cellobiose in NaOH and NaCl were estimated using 2D NMR and compared to DFT shift ... To elucidate the solubilization mechanism, we performed electrophoretic NMR on cellobiose, a subunit of cellulose, showing that ... cellobiose acts as an acid with two dissociation steps at pH 12 and 13.5. ...
... Adsorption of Glucose, Cellobiose, and ... In this study, we present the adsorption of glucose, cellobiose, and cellotetraose on model surfaces of crystalline cellulose I ...
cellobiose dehydrogenase. Footnotes. *↵1To whom correspondence may be addressed. Email: finn.l.aachmann{at}ntnu.no or vincent. ... Interactions of a fungal lytic polysaccharide monooxygenase with β-glucan substrates and cellobiose dehydrogenase. Gaston ... Interactions of a fungal lytic polysaccharide monooxygenase with β-glucan substrates and cellobiose dehydrogenase ... such as cellobiose dehydrogenase (CDH). Using protein NMR and isothermal titration calorimetry we have studied the interactions ...
... produce cellobiose dehydrogenase (CDH). CDH has generated recent interest because of its ability to facilitate the formation of ... Cellobiose Dehydrogenase-An Extracellular Fungal Flavocytochrome Enzyme Microb Technol. 2001 Feb 1;28(2-3):129-138. doi: ... Wood-degrading fungi, including white-rot and soft-rot fungi as well as at least one brown-rot fungus, produce cellobiose ...
Activation of bacterial lytic polysaccharide monooxygenases with cellobiose dehydrogenase.. [Jennifer S M Loose, Zarah Forsberg ... cellobiose dehydrogenases, CDHs, from fungi). Here, we demonstrate that a fungal CDH from Myriococcum thermophilum (MtCDH), can ...
Addition of cellobiose dehydrogenase to a mixture of purified cellulases showed no stimulatory effect. We show that cellobiose ... Cellobiose dehydrogenases and proteins related to the polysaccharide monooxygenases described here are found throughout both ... Cellobiose dehydrogenase and a copper-dependent polysaccharide monooxygenase potentiate cellulose degradation by Neurospora ... Deletion of cdh-1, the gene encoding the major cellobiose dehydrogenase of Neurospora crassa, reduced cellulase activity ...
Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.. Tan, T.C., Kracher, D., Gandini, ... Cellobiose dehydrogenase. A. 585. Crassicarpon hotsonii. Mutation(s): 0 Gene Names: CDH. ... Dehydrogenase domain of Myriococcum thermophilum cellobiose dehydrogenase with bound cellobionolactam, MtDH. *DOI: 10.2210/ ... A new paradigm for cellulose depolymerization by fungi focuses on an oxidative mechanism involving cellobiose dehydrogenases ( ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
The results proved that fast cellobiose utilization enhanced ethanol production by reducing cellobiose accumulation during SSF ... Overexpression of the genes encoding cellobiose transporter and β-glucosidase accelerated cellobiose utilization, and the ... Overexpression of the genes encoding cellobiose transporter and β-glucosidase accelerated cellobiose utilization, and the ... The results proved that fast cellobiose utilization enhanced ethanol production by reducing cellobiose accumulation during ...
... assuming that anomeric ratio of D-cellobiose remains constant throughout the reaction.. ... peak area of D-cellobiose 1α or 1′α hydrogen. = peak area of D-cellobiose 1β or 1′β hydrogen. = peak area of D-glucose 1α ... The anomeric composition of D-cellobiose in this mixture was calculated as using the peak area ratio of two doublets at 4.97 ... D-Cellobiose sample heated in sulfuric acid-. medium also gave a similar series of spectra. The spectrum recorded at . shows a ...
... of listeriolysin and phosphatidylinositol-specific phospholipase C is repressed by the plant-derived molecule cellobiose in ...
6-Anhydro-beta-D-cellobiose, 95% products and learn more about Alfa Aesar™ 1,6-Anhydro-beta-D-cellobiose, 95% ... 1,6-anhydro-b-d-cellobiose, 1,6-anhydro-beta-d-cellobiose, 2s,3r,4s,5s,6r-2-1r,2s,3r,4r,5r-3,4-dihydroxy-6,8-dioxabicyclo 3.2.1 ... 1,6-anhydro-b-d-cellobiose, 1,6-anhydro-beta-d-cellobiose, 2s,3r,4s,5s,6r-2-1r,2s,3r,4r,5r-3,4-dihydroxy-6,8-dioxabicyclo 3.2.1 ...
Gentle agitation of cellobiose-containing cellobiohydrolase solutions during sitting-drop vapor-diffusion growth resulted in ... This result was in contrast with the conventional idea that cellobiose inhibits the nucleation of cellobiohydrolase crystals. ... We aimed to clarify how cellobiose inhibits cellobiohydrolase crystallization and to crystallize cellobiohydrolase in ... concentrated cellobiose without using seeds. The contribution of attractive forces to total intermolecular interactions of ...
Construction of the industrial ethanol-producing strain of Saccharomyces cerevisiae able to ferment cellobiose and melibiose. ... Construction of the industrial ethanol-producing strain of Saccharomyces cerevisiae able to ferment cellobiose and melibiose. ... Construction of the industrial ethanol-producing strain of Saccharomyces cerevisiae able to ferment cellobiose and melibiose.. ... The resulting strains were able to grow on cellobiose and melibiose through simultaneous production of sufficient extracellular ...
Characterization of Cellobiose Phosphorylase and Cellodextrin Phosphorylase (糖質関連酵素化学シンポジウム) Characterization of Cellobiose ... Specific colorimetric quantification of cellobiose was designed by using the reaction of CBP. Cellobiose was produced from ... A cellobiose phos-phorylase from Cellvibrio gilvus recognizes only the β-D-form of 5a-carba-glucopyranose. KITAOKA M. ... Acceptor specificity of cellobiose phosphorylase from Cellvibrio gilvus : Synthesis of three branched trisaccharides PERCY A. ...
... and which is effective for the hydrolysis of cellobiose to glucose, is disclosed. The enzyme is produced by Candida peltata, ... A new β-glucosidase enzyme which is tolerant to glucose and cellobiose, ... cellobiose only; (□), glucose formed from cellobiose, (Δ), cellobiose with glucose; (∇), glucose formed from cellobiose in the ... iv) Cellobiose-Sepharose 6B affinity chromatography. Cellobiose-Sepharose affinity matrix was prepared by coupling cellobiose ...
... act as effective homogeneous catalysts for selective hydrolysis of cellobiose and cellulose to glucose and total reducing ... cellobiose. , cellulose and lignocellulose, H3PW12O40 and Sn0.75PW12O40 showed higher TRS. yield than H2SO4. ... cellobiose. and cellulose K. Shimizu, H. Furukawa, N. Kobayashi, Y. Itaya and A. Satsuma, Green Chem., 2009, 11, 1627 DOI: ... cellobiose. and cellulose to glucose. and total reducing sugars (. TRS. ), respectively, in an aqueous phase. For Brønsted acid ...
Cellobiose phosphorylase (EC 2. 4. 1. 20) of Cellulomonas : Occurrence, induction, and its role in cellobiose metabolism SCHIMZ ... Cellobiose phosphorylase (CBP) catalyzes the reversible phosphorolysis of cellobiose to produce α-,small,D,/small,- ... Enzymatic properties of cellobiose 2-epimerase from Ruminococcus albus and the synthesis of rare oligosaccharides by the enzyme ... Cellobiose versus glucose tuilizationby the ruminal bacterium Ruminococ-cus albus. THURSTON B ...
Cellobiose phosphorylase from Cellvibrio gilvus was used to prepare 1,5-anhydro-4-O-β-D-glucopyranosyl-D-fructose [βGlc(1→4)AF ... Keywords: 1,5-anhydro-4-O-β-D-glucopyranosyl-D-fructose, 1,5-anhydro-D-fructose, cellobiose phosphorylase, β-elimination, ... Enzymatic Synthesis of 1,5-Anhydro-4-O-β-D-glucopyranosyl-D-fructose Using Cellobiose Phosphorylase and Its Spontaneous ...
... cellobiose explanation free. What is cellobiose? Meaning of cellobiose medical term. What does cellobiose mean? ... Looking for online definition of cellobiose in the Medical Dictionary? ... Cellobiose , definition of cellobiose by Medical dictionary https://medical-dictionary.thefreedictionary.com/cellobiose ... cellobiose. Also found in: Dictionary, Encyclopedia, Wikipedia. cel·lo·bi·ose. (selō-bīōs), A disaccharide obtained from ...
Cellobiose dehydrogenase (CDH) is an extracellular flavocytochrome containing flavin and b-type heme, and plays a key role in ... Cellobiose dehydrogenase (CDH) is an extracellular flavocytochrome containing flavin and b-type heme, and plays a key role in ... When WT or F166Y was reduced with cellobiose and then mixed with cytochrome c, heme re-oxidation and cytochrome c reduction ... Electron transfer chain reaction of the extracellular flavocytochrome cellobiose dehydrogenase from the basidiomycete ...
iii It was found that a small amount of glucose was accumulated during either cellobiose fermentation or cellobiose and xylose ... In this thesis, we proposed and constructed an artificial cellobiose assimilating pathway consisting of a cellobiose ... cellobiose assimilation aldose 1-epimerase. Abstract:. Saccharomyces cerevisiae has been widely utilized as a platform ... The ethanol productivity was 0.64 g L-1 h-1, the ethanol yield was 0.42 g per g sugar, and the cellobiose consumption rate was ...
Fermentation of cellobiose was more rapid than that of cellulose. In cellobiose medium, the methanogen caused only slight ... Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum.. P ... Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum. ... The fermentation of cellulose and cellobiose by Clostridium thermocellum monocultures and C. thermocellum/Methanobacterium ...
cellobiose phosphorylase, directed evolution, cellobiosides, glycoside synthesis, substrate specificity, DIRECTED EVOLUTION, ... Construction of cellobiose phosphorylase variants with broadened acceptor specificity towards anomerically substituted ... "Construction of Cellobiose Phosphorylase Variants with Broadened Acceptor Specificity Towards Anomerically Substituted ... Construction of cellobiose phosphorylase variants with broadened acceptor specificity towards anomerically substituted ...
Utilization of cellobiose and cellotriose by this strain eliminated the requirement for external beta-glucosidase and reduced ... The best of these, strain P2(pCT603T) containing celD, was used to hydrolyze amorphous cellulose to cellobiose and produce ... Ethanol production from cellobiose, amorphous cellulose, and crystalline cellulose by recombinant Klebsiella oxytoca containing ... Ethanol production from cellobiose, amorphous cellulose, and crystalline cellulose by recombinant Klebsiella oxytoca containing ...
Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator. Ulla ... Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator ... Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator ... Electrochemical Investigation of Cellobiose Oxidation by Cellobiose Oxidase in Presence of Cytochrome c as Mediator ...
  • In enzymology a cellobiose epimerase (EC 5.1.3.11) is an enzyme that catalyzes the chemical reaction cellobiose ⇌ {\displaystyle \rightleftharpoons } D-glucosyl-D-mannose Hence, this enzyme has one substrate, cellobiose, and one product, D-glucosyl-D-mannose. (wikipedia.org)
  • Under aerobic conditions, B. subtilis grows using cellobiose as substrate. (biomedcentral.com)
  • β-1,4-glycosidically linked Reducing sugar Soluble in polar solvents D-Cellobiose is a substrate of β-glucosidase. (thomassci.com)
  • However, the information on the interactions of this protein with soil minerals is very limited, and even less is known about their consequences for the hydrolysis of the natural substrate cellobiose. (ufz.de)
  • Both the CDH isoforms are specific for the beta-1,4 glycosidic bond and oxidize cellobiose as their preferred substrate, though cellotriose and lactose are also used. (readabstracts.com)
  • This study compares growth of Ruminococcus flavefaciens FD-1 with cellulose or cellobiose as the carbohydrate substrate. (omicsdi.org)
  • Cellobiose is a disaccharide with the formula (C6H7(OH)4O)2O. (wikipedia.org)
  • This word is from biochemistry and cellobiose is part of the disaccharide group of sugars. (wikipedia.org)
  • These studies revealed that the expression of listeriolysin O and phosphatidylinositol-specific phospholipase C is repressed specifically by the plant-derived disaccharide, cellobiose. (nih.gov)
  • Cellobiose is a disaccharide consisting of two glucose units in a beta (1-4) glycosidic linkage. (lmdb.ca)
  • An efficient transformation of sucrose and glucose into cellobiose by a parallel (countercurrent) cascade of disaccharide phosphorylases requires the enzyme co-expression to cope with large differences in specific activity of cellobiose phosphorylase (14 U mg −1 ) and sucrose phosphorylase (122 U mg −1 ). (elsevier.com)
  • Cellobiose is a disaccharide which results from the hydrolysis of cellulose. (dictionary.com)
  • Cellobiose is a disaccharide composed of two glucose molecules. (thomassci.com)
  • Any enzyme that converts cellulose to the disaccharide cellobiose . (ca.gov)
  • In this study, genes encoding cellobiose transporter and β-glucosidase were introduced into an industrial Saccharomyces cerevisiae strain, and evolution engineering was carried out to improve the cellobiose utilization of the engineered yeast strain. (frontiersin.org)
  • Overexpression of the genes encoding cellobiose transporter and β-glucosidase accelerated cellobiose utilization, and the improvement depended on the strain background. (frontiersin.org)
  • The results proved that fast cellobiose utilization enhanced ethanol production by reducing cellobiose accumulation during SSF at high temperature. (frontiersin.org)
  • Since native S. cerevisiae cannot ferment cellobiose, three strategies have been developed for heterologous cellobiose utilization. (frontiersin.org)
  • Furthermore, phenotypic tests such as acid production from cellobiose and citrate utilization, previously proposed to be useful for identification of E. (thefreedictionary.com)
  • A total of six different cellobiose assimilating pathways were constructed and compared in a laboratory S. cerevisiae strain capable of xylose utilization and the one with best fermentation performance was selected. (illinois.edu)
  • Overexpression of both S. cerevisiae and N. crassa aldose 1-epimerases showed improved sugar consumption and ethanol production in cellobiose assimilating S. cerevisiae strains and aldose 1-epimerase disrupted S. cerevisiae strains derived from the s288c strain showed significant drawbacks in cellobiose utilization. (illinois.edu)
  • Utilization of cellobiose and cellotriose by this strain eliminated the requirement for external beta-glucosidase and reduced the amount of commercial cellulase needed to ferment Solka Floc SW40 (primarily crystalline cellulose). (asm.org)
  • The human pathogen Streptococcus pneumoniae harbours many genes encoding phosphotransferase systems and sugar ABC (ATP-binding cassette) transporters, including systems for the utilization of the β-glucoside sugar cellobiose. (microbiologyresearch.org)
  • We then present experimental evidence that the cel operon involved in cellobiose utilization is directly regulated by CelR and σ 54 (SigL) in Clostridium acetobutylicum. (elsevier.com)
  • To circumvent glucose repression, co-utilization of cellobiose and xylose by Bacillus coagulans NL01 was investigated. (biomedcentral.com)
  • However, through a comparison of cellobiose fermentation by NL01 and DSM1 that only possess CELO1, it was observed that CELO2 might also play an important role in the utilization of cellobiose in vivo despite the fact that no pbgl gene was found. (biomedcentral.com)
  • This study demonstrated the cellobiose-assimilating pathway of B. coagulans and provided a new co-utilization strategy of cellobiose and xylose to overcome the obstacles that result from glucose repression in a biorefinery system. (biomedcentral.com)
  • This study shows that by taking advantage of the cellobiose utilization capability and osmotic stress high resistance of B. subtilis , a robust process for L-lactate production can be developed. (biomedcentral.com)
  • The transport of the cellulose by-products cellobiose and cellotriose into the cell induces the biosynthesis of the main phytotoxin thaxtomin A. These carbohydrates bind to the cis-acting sequences of the cellulose utilization repressor CebR and thereby induce the expression of the thaxtomin activator TxtR. (omicsdi.org)
  • Production of its main phytotoxin thaxtomin A is triggered upon transport of cellulose byproducts cellotriose and cellobiose, which disable the repression of the thaxtomin biosynthesis activator gene txtR by the cellulose utilization regulator CebR. (omicsdi.org)
  • Cellobiose versus glucose utilization by the ruminal bacterium Ruminococcus albus. (readabstracts.com)
  • Two intracellular enzymes, cellobiose phosphorylase (CBP) and cellodextrin phosphorylase (CDP) are involved in the phosphorolytic pathway in cellulose degradation. (nii.ac.jp)
  • Cellobiose phosphorylase from Cellvibrio gilvus was used to prepare 1,5-anhydro-4- O -β-D-glucopyranosyl-D-fructose [βGlc(1→4)AF] from 1,5-anhydro-D-fructose and α-D-glucose 1-phosphate. (go.jp)
  • of total product) using coupled cellobiose and cellodextrin phosphorylase. (zenodo.org)
  • Bacterial yield was 38% greater when the organism was grown on cellobiose, and this could be due to constitutive cellobiose phosphorylase activity. (readabstracts.com)
  • Cellobiose accumulation and the compromised temperature for yeast fermentation are the main limiting factors of enzymatic hydrolysis process during simultaneous saccharification and fermentation (SSF). (frontiersin.org)
  • The resultant yeast strain showed significantly improved cellobiose and xylose consumption ability and ethanol productivity in both shake-flask and bioreactor fermentation. (illinois.edu)
  • In addition, the best cellobiose assimilating pathway was also transferred to an industrial yeast strain and the resultant industrial strain showed greatly improved fermentation performance. (illinois.edu)
  • iii It was found that a small amount of glucose was accumulated during either cellobiose fermentation or cellobiose and xylose co-fermentation, which inevitably decreased the ethanol yield and productivity. (illinois.edu)
  • Fermentation of cellulose and cellobiose by Clostridium thermocellum in the absence of Methanobacterium thermoautotrophicum. (asm.org)
  • The fermentation of cellulose and cellobiose by Clostridium thermocellum monocultures and C. thermocellum/Methanobacterium thermoautotrophicum cocultures was studied. (asm.org)
  • Fermentation of cellobiose was more rapid than that of cellulose. (asm.org)
  • In cellobiose medium, the methanogen caused only slight changes in the fermentation balance of the Clostridium, and free H2 was produced. (asm.org)
  • During co-fermentation of cellobiose and xylose, B. coagulans NL01 simultaneously consumed the sugar mixtures and exhibited an improved lactic acid yield compared with co-fermentation of glucose and xylose. (biomedcentral.com)
  • The aim of this study was to engineer cellodextrin transporter 2 (CDT-2) from Neurospora crassa for improved cellobiose fermentation under lower pH conditions by Saccharomyces cerevisiae. (usda.gov)
  • Through directed evolution, a mutant CDT-2 capable of facilitating cellobiose fermentation under lower pH conditions was obtained. (usda.gov)
  • The synthesis of xylanases and cellulases is repressed if easily metabolizable carbon source like glucose, cellobiose , xylose, or xylobiose is present [12]. (thefreedictionary.com)
  • It is therefore ges in gene and gene product expression during growth of C. termitidis on cellobiose, xylose, xylan, and α-cellulose. (biomedcentral.com)
  • In addition to growth on xylan, the simultaneous consumption of two important lignocellulose constituents, cellobiose and xylose was also demonstrated. (biomedcentral.com)
  • High throughput "omics technologies" such as transcriptomics and proteomics provide insights into the metabolic potential of an organism and have been used to understand the genetic and the central carbon metabolism mechanisms for the production of desired end products in various cellulolytic clostridia cultured on different substrates In this study, C. termitidis was cultured on lignocellulose derived simple and complex sugars: cellobiose, xylose, xylan and α-cellulose as sole carbon sources. (omicsdi.org)
  • Closridium termitidis was cultured on 2g/L each of α-cellulose, xylan, cellobiose and xylose. (omicsdi.org)
  • Cellobiose was produced from sucrose at 90% yield by a combined action of three enzymes including CBP. (nii.ac.jp)
  • While the disaccharides sucrose, lactose, maltose, and cellobiose have the same chemical formula, C 12 H 22 O 11 , and all have at least one glucose molecule as part of their structure, they differ substantially in their properties. (newworldencyclopedia.org)
  • N. crassa was pregrown in Sucrose and transferred to Avicel (cellulose), Cellobiose, Sucrose or media with no carbon added. (omicsdi.org)
  • The best of these constructs, strain P2, produced ethanol efficiently from cellobiose in addition to monomeric sugars. (asm.org)
  • Specifically, genes for cellulosomal enzymes and components were highly expressed on α-cellulose, while xylanases and glucosidases were up-regulated on 5 carbon sugars with respect to cellobiose. (biomedcentral.com)
  • They use disaccharides including cellobiose , maltose and lactose but not sugar alcohols. (thefreedictionary.com)
  • lactose , maltose and cellobiose are examples of reducing disaccharides, each with one hemiacetal unit, the other occupied by the glycosidic bond, which prevents it from acting as a reducing agent . (wikipedia.org)
  • The enzyme cellobiose dehydrogenase (CDH) can be used to oxidize lactose to lactobionic acid. (biomedcentral.com)
  • The Streptomyces ATP-binding component MsiK assists in cellobiose and maltose transport. (naver.com)
  • Uptake of cellobiose and maltose was tested and ascertained for S. reticuli and S. lividans, but not for an msiK S. lividans mutant. (naver.com)
  • Even maltose and cellobiose, which are made up of two covalently bonded glucose units, differ due to the nature of the linkage, with maltose easily hydrolyzed to its monosaccharides in the human body whereas cellobiose cannot be digested. (newworldencyclopedia.org)
  • ATCC31749 for curdlan production from cellobiose. (docphin.com)
  • abstract = "Adiabatic φ/ψ maps for cellobiose were prepared with B3LYP density functional theory. (umn.edu)
  • The electrons can be provided by various sources, such as chemical compounds (e.g., ascorbate) or by enzymes (e.g., cellobiose dehydrogenases, CDHs, from fungi). (sigmaaldrich.com)
  • Deletion of cdh-1, the gene encoding the major cellobiose dehydrogenase of Neurospora crassa, reduced cellulase activity substantially, and addition of purified cellobiose dehydrogenases from M. thermophila to the Δcdh-1 strain resulted in a 1.6- to 2.0-fold stimulation in cellulase activity. (nih.gov)
  • Cellobiose dehydrogenases and proteins related to the polysaccharide monooxygenases described here are found throughout both ascomycete and basidiomycete fungi, suggesting that this model for oxidative cellulose degradation may be widespread throughout the fungal kingdom. (nih.gov)
  • Two distinct cellobiose dehydrogenases (CDH) isolated from the white rot fungus Trametes versicolor have molecular weights of 97 kDa and 81 kDa and isoelectric points of 4.2 and 6.4 respectively. (readabstracts.com)
  • The engineered strains were shown with enhanced ability to utilize cellobiose, resulting in a 2. (docphin.com)
  • A new β-glucosidase enzyme which is tolerant to glucose and cellobiose, and which is effective for the hydrolysis of cellobiose to glucose, is disclosed. (google.com)
  • Zirconia modified SBA-15 becomes a very active catalyst for the selective hydrolysis of cellobiose to glucose after sulfation. (iastate.edu)
  • Therefore, the glucose-tolerant β-glucosidase with high specific activity for cellobiose might be a potent candidate for industrial applications. (biomedcentral.com)
  • Two strains of an asexual cellobiose-fermenting yeast species were isolated from rotten wood samples collected in Funiu Mountain Nature Reserve in Henan Province, central China. (microbiologyresearch.org)
  • The presence of unbleached hardwood kraft pulp (HWKP) in a culture increases the culture's production of a number of acidic metabolites and stimulates the fungal secretion of the enzymes manganese peroxidase, cellulase and cellobiose-quinine oxidoreductase. (readabstracts.com)
  • TY - CONF AU - Zelenović, Jelena AU - Ostafe, Raluca AU - Fischer, Rainer AU - Prodanović, Radivoje PY - 2017 UR - http://www.bds.org.rs/en/conferences.php UR - http://cer.ihtm.bg.ac.rs/handle/123456789/3282 AB - Cellulase (EC 3.2.1.4) are important enzymes in food, paper, textile, detergent and biofuel industries. (ac.rs)
  • The resulting strains were able to grow on cellobiose and melibiose through simultaneous production of sufficient extracellular alpha-galactosidase and beta-glucosidase activity. (sigmaaldrich.com)
  • cellobiose-agar (RGCA) medium for isola-tion and enumeration of strains of rumen bacteria, and also to prove that numbers of viable bacteria in the rumen of cattle varied significantly in relationship to animal, diet, and time after feeding. (fastkpdf.com)
  • The engineered S. cerevisiae expressing the isolated mutant CDT-2 (I96N/T487A) produced ethanol with a specific cellobiose consumption rate of 0.069g/gcell/h, which was 51% and 55% higher than those of the strains harboring wild-type CDT-1 and CDT-2 in a minimal medium with 2g/L of acetic acid. (usda.gov)
  • Single libraries for mutant strains identify which genes show similair expression on cellobiose as in the WT on cellulose. (omicsdi.org)
  • In three other laboratory strains (EGD, L028, and 10403S), however, the effect of cellobiose was not unique, and all fermentable carbohydrates repressed hly . (asm.org)
  • We show that cellobiose dehydrogenase enhances cellulose degradation by coupling the oxidation of cellobiose to the reductive activation of copper-dependent polysaccharide monooxygenases (PMOs) that catalyze the insertion of oxygen into C-H bonds adjacent to the glycosidic linkage. (nih.gov)
  • Electrons are generated from cellobiose oxidation catalysed by DH and shuttled via CYT to LPMO. (rcsb.org)
  • When WT or F166Y was reduced with cellobiose and then mixed with cytochrome c, heme re-oxidation and cytochrome c reduction occurred synchronously, suggesting that the initial electron is transferred from reduced heme to cytochrome c. (nih.gov)
  • Construction of the industrial ethanol-producing strain of Saccharomyces cerevisiae able to ferment cellobiose and melibiose. (sigmaaldrich.com)
  • Under aerobic conditions, the growth rate of the recombinant strain GC 1 co-expressing 2 genes could achieve 0.29 OD600 h(-1) and a biomass yield up to 7.8 g l(-1) dry cell weight on medium containing 10.0 g l(-1) cellobiose and 10.0 g l(-1) melibiose as sole carbohydrate source. (sigmaaldrich.com)
  • Moreover, to investigate induction of the two genes, the mycelia grown on glucose medium were transferred to medium containing glucose, cellobiose or no carbon. (oup.com)
  • Transcriptional profiling with next-generation sequencing methods demonstrated that a Neurospora crassa mutant with the three most highly expressed beta-glucosidase genes deleted had a transcriptional response to cellobiose similair to that of wild type N. crassa exposed to cellulose. (omicsdi.org)
  • The β-glucoside cellobiose has been reported to specifically repress the PrfA-dependent virulence genes hly and plcA in Listeria monocytogenes NCTC 7973. (asm.org)
  • The systematic name of this enzyme class is cellobiose 2-epimerase. (wikipedia.org)
  • INTRODUCTION: Cellulases an enzyme that specificity cleaves the internal b-1, 4-glycosydic bonds of cellulose and release glucose, cellobiose and cello-oligosaccharides depending on the characteristic of the enzyme. (thefreedictionary.com)
  • The enzyme showed strong ability to hydrolyze cellobiose with a K m and V max of 25.45 mM and 740.5 U/mg, respectively. (hud.ac.uk)
  • Plasmid Design for Tunable Two-Enzyme Co-Expression Promotes Whole-Cell Production of Cellobiose. (elsevier.com)
  • This study shows an effective integration of major design strategies from synthetic biology to a coherent development of plasmid vectors, enabling tunable two-enzyme co-expression in E. coli, for whole-cell-production of cellobiose. (elsevier.com)
  • Untersuchen Sie die Forschungsthemen von „Plasmid Design for Tunable Two-Enzyme Co-Expression Promotes Whole-Cell Production of Cellobiose. (elsevier.com)
  • Cellobiose dehydrogenase (CDH, EC 1.1.99.18) is an extracellular enzyme produced by a number of wood-degrading fungi [ 1 ]. (biomedcentral.com)
  • The used enzyme system consists of cellobiose dehydrogenase (CDH) and laccase with 2,6-dichlorophenol-indophenol (DCIP) as redox mediator. (biomedcentral.com)
  • We therefore characterised the sorptive interactions of this enzyme with the soil minerals montmorillonite, kaolinite and goethite and quantified the resulting changes in the hydrolysis rate of cellobiose. (ufz.de)
  • Efficient direct electron transfer (DET) between a cellobiose dehydrogenase mutant from Corynascus thermophilus (CtCDH C291Y) and a novel glassy carbon (GC)-modified electrode, obtained by direct electrodeposition of gold nanoparticles (AuNPs) was realized. (lu.se)
  • Expression directed by the two promoters present in the cel locus was increased in the presence of cellobiose as sole carbon source in the medium, while expression decreased in the presence of glucose in the medium. (microbiologyresearch.org)
  • cellobiose, a soluble cellodextrin, which countered the continuous cultivation of the bacterium on cellulose as sole carbon and energy source. (fastkpdf.com)
  • Growth on cellobiose as the sole carbon source was also achieved. (springeropen.com)
  • However, there are no reports of the use of E. coli strain to produce cadaverine using cellobiose as a carbon source. (springeropen.com)
  • We performed a shotgun proteomic experiment to compare the wild-type S. scabies 87-22 and its cebR null mutant in the absence or presence of cellobiose. (omicsdi.org)
  • Wood-degrading fungi, including white-rot and soft-rot fungi as well as at least one brown-rot fungus, produce cellobiose dehydrogenase (CDH). (nih.gov)
  • Cellobiose dehydrogenase (CDH) is an extracellular flavocytochrome containing flavin and b-type heme, and plays a key role in cellulose degradation by filamentous fungi. (nih.gov)
  • Cellobiose dehydrogenase (CDH) is an extracellular hemoflavoenzyme produced by cellulose-degrading fungi. (learntechlib.org)
  • Some yeasts and mycelial fungi produce glycolipids of various types such as mannosylerythritols, sophorolipids, and cellobiose lipids. (springeropen.com)
  • Cellobiose dehydrogenase and a copper-dependent polysaccharide monooxygenase potentiate cellulose degradation by Neurospora crassa. (nih.gov)
  • It does not only participate in cellulose degradation, it also plays an important role in hydrolyzing cellulose to fermentable glucose by relieving the inhibition of exoglucanase and endoglucanase from cellobiose. (biomedcentral.com)
  • BGL catalyzes the final step in cellulose degradation, as well as stimulating cellulose hydrolysis by relieving the cellobiose-mediated inhibition of EG and CBH. (springeropen.com)
  • The natural cellobiose assimilating strain Neurospora crassa also has a mutarotase gene named NCU09705. (illinois.edu)
  • Transcriptional analysis of β-glucosidase gene ( bgl ) and cellobiose dehydrogenase gene ( cdh ) in relation to cellobiose metabolism in the basidiomycete Phanerochaete chrysosporium was performed using real-time quantitative RT-PCR. (oup.com)
  • Based on comparative genomic analysis, two gene clusters that encode two different operons of the cellobiose-specific phosphoenolpyruvate-dependent phosphotransferase system (assigned as CELO1 and CELO2) were identified. (biomedcentral.com)
  • Based on gene knockout results, CELO1 was confirmed to be responsible for the transport and assimilation of cellobiose. (biomedcentral.com)
  • Furthermore, we found that the β-glucosidase gene ( YYH1311079 ) and pGEX-KG/ YYH1311079 bacterial expression vector may provide valuable insight for designing β-glucosidase with higher cellobiose-hydrolyzing efficiencies. (biomedcentral.com)
  • Earlier studies pointed to the ability of C. thermocellum to exquisitely control gene expression in response to growth rate and the presence of insoluble cellulose or soluble compounds such as cellobiose. (omicsdi.org)
  • Our data indicate that the bvr locus encodes a β-glucoside-specific sensor that mediates virulence gene repression upon detection of cellobiose and salicin. (asm.org)
  • Therefore, CelR is a regulator dedicated to the cellobiose-dependent transcriptional activation of the cel locus. (microbiologyresearch.org)
  • When CELO1 or CELO2 was expressed in Escherichia coli , the recombinant strain exhibited distinct cellobiose uptake and consumption. (biomedcentral.com)
  • The best of these, strain P2(pCT603T) containing celD, was used to hydrolyze amorphous cellulose to cellobiose and produce ethanol in a two-stage process. (asm.org)
  • The evolved strain exhibited significantly higher cellobiose consumption rate (2.8-fold) and ethanol productivity (4.9-fold) compared with its parent strain. (frontiersin.org)
  • Besides, the evolved strain showed a high cellobiose consumption rate of 3.67 g/L/h at 34°C and 3.04 g/L/h at 38°C. Moreover, little cellobiose was accumulated during SSF of Avicel using the evolved strain at 38°C, and the ethanol yield from Avicel increased by 23% from 0.34 to 0.42 g ethanol/g cellulose. (frontiersin.org)
  • This research aimed to identify strong promoters and to engineer a strain that converts cellobiose efficiently to curdlan. (docphin.com)
  • Three strong promoters were identified and were used to install an energy-efficient cellobiose phosphorolysis mechanism in a curdlan-producing strain. (docphin.com)
  • The availability of metabolically engineered strain capable of producing ß-glucan from cellobiose paves the way for its production from cellulose. (docphin.com)
  • In this study, we demonstrate the one-step production of cadaverine (1,5-diaminopentane) from cellobiose using an Escherichia coli strain displaying β-glucosidase (BGL) on its cell surface. (springeropen.com)
  • The engineered strain produced cadaverine from cellobiose more effectively than from glucose: 6.1 mM after 48 h from 28 g/L of consumed cellobiose, vs. 3.3 mM from 20 g/L of consumed glucose. (springeropen.com)
  • To elucidate the solubilization mechanism, we performed electrophoretic NMR on cellobiose, a subunit of cellulose, showing that cellobiose acts as an acid with two dissociation steps at pH 12 and 13.5. (gu.se)
  • Cellobiose, a structural subunit of cellulose, was utilized as a retention promoter of polymer additives to a cellulose matrix in an aqueous papermaking system. (elsevier.com)
  • Activation of bacterial lytic polysaccharide monooxygenases with cellobiose dehydrogenase. (sigmaaldrich.com)
  • In this study, we present the adsorption of glucose, cellobiose, and cellotetraose on model surfaces of crystalline cellulose Iα and Iβ. (warwick.ac.uk)
  • Exoglucanase is active on crystalline cellulose hydrolysis and starts at the end of the chain, releasing cellobiose from the reducing and non-reducing end of the chain. (thefreedictionary.com)
  • Cellulases from family 48, along with family 9, are up-regulated during growth of C. thermocellum on crystalline cellulose as compared with cellobiose ( 12 , 13 ). (pnas.org)
  • In this thesis, we proposed and constructed an artificial cellobiose assimilating pathway consisting of a cellobiose transporter and a β-glucosidase in S. cerevisiae. (illinois.edu)
  • When CDH from P. chrysosporium oxidized cellobiose in the presence of oxygen, hydrogen peroxide and hydroxyl radicals were generated. (learntechlib.org)
  • For the hydrolysis of cellobiose , cellulose and lignocellulose, H 3 PW 12 O 40 and Sn 0.75 PW 12 O 40 showed higher TRS yield than H 2 SO 4 . (rsc.org)
  • Inorganic polyphosphate (PolyP) synthesis was 65% of the control with 0.05 mg ml -1 cellobiose lipid during cultivation on ethanol. (springeropen.com)
  • PolyP synthesis was not observed during the cultivation on glucose at the same cellobiose lipid concentration. (springeropen.com)
  • The ethanol productivity was 0.64 g L-1 h-1, the ethanol yield was 0.42 g per g sugar, and the cellobiose consumption rate was more than 1.77 g L-1 h-1, which enables fast and efficient ethanol production from lignocelluloses. (illinois.edu)
  • Recent studies have shown that cellobiose can be processed or metabolized by endogenous beta glycosidases in the mammalian small intestine (PMID 18752931 ). (lmdb.ca)
  • Treatment of cellulose with acetic anhydride and sulfuric acid, gives cellobiose octoacetate, which is no longer a hydrogen bond donor (though it is still a hydrogen bond acceptor) and is soluble in nonpolar organic solvents. (wikipedia.org)
  • Disruption of the bvr operon by replacing part of bvrAB with an interposon abolished the repression by cellobiose and salicin but not that by arbutin. (asm.org)