Peptides that have the ability to enter cells by crossing the plasma membrane directly, or through uptake by the endocytotic pathway.
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
A mercaptoethylamine compound that is endogenously derived from the COENZYME A degradative pathway. The fact that cysteamine is readily transported into LYSOSOMES where it reacts with CYSTINE to form cysteine-cysteamine disulfide and CYSTEINE has led to its use in CYSTINE DEPLETING AGENTS for the treatment of CYSTINOSIS.
DNA analogs containing neutral amide backbone linkages composed of aminoethyl glycine units instead of the usual phosphodiester linkage of deoxyribose groups. Peptide nucleic acids have high biological stability and higher affinity for complementary DNA or RNA sequences than analogous DNA oligomers.
Venoms produced by the wasp (Vespid) family of stinging insects, including hornets; the venoms contain enzymes, biogenic amines, histamine releasing factors, kinins, toxic polypeptides, etc., and are similar to bee venoms.
A neuropeptide of 29-30 amino acids depending on the species. Galanin is widely distributed throughout the BRAIN; SPINAL CORD; and INTESTINES. There are various subtypes of GALANIN RECEPTORS implicating roles of galanin in regulating FOOD INTAKE; pain perception; memory; and other neuroendocrine functions.
Systems for the delivery of drugs to target sites of pharmacological actions. Technologies employed include those concerning drug preparation, route of administration, site targeting, metabolism, and toxicity.
A quality of cell membranes which permits the passage of solvents and solutes into and out of cells.
Forms to which substances are incorporated to improve the delivery and the effectiveness of drugs. Drug carriers are used in drug-delivery systems such as the controlled-release technology to prolong in vivo drug actions, decrease drug metabolism, and reduce drug toxicity. Carriers are also used in designs to increase the effectiveness of drug delivery to the target sites of pharmacological actions. Liposomes, albumin microspheres, soluble synthetic polymers, DNA complexes, protein-drug conjugates, and carrier erythrocytes among others have been employed as biodegradable drug carriers.
Trans-acting transcription factors produced by retroviruses such as HIV. They are nuclear proteins whose expression is required for viral replication. The tat protein stimulates LONG TERMINAL REPEAT-driven RNA synthesis for both viral regulatory and viral structural proteins. tat stands for trans-activation of transcription.
Artificial, single or multilaminar vesicles (made from lecithins or other lipids) that are used for the delivery of a variety of biological molecules or molecular complexes to cells, for example, drug delivery and gene transfer. They are also used to study membranes and membrane proteins.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
Layers of lipid molecules which are two molecules thick. Bilayer systems are frequently studied as models of biological membranes.
A collection of cloned peptides, or chemically synthesized peptides, frequently consisting of all possible combinations of amino acids making up an n-amino acid peptide.
Transport proteins that carry specific substances in the blood or across cell membranes.
The first continuously cultured human malignant CELL LINE, derived from the cervical carcinoma of Henrietta Lacks. These cells are used for VIRUS CULTIVATION and antitumor drug screening assays.
Small cationic peptides that are an important component, in most species, of early innate and induced defenses against invading microbes. In animals they are found on mucosal surfaces, within phagocytic granules, and on the surface of the body. They are also found in insects and plants. Among others, this group includes the DEFENSINS, protegrins, tachyplesins, and thionins. They displace DIVALENT CATIONS from phosphate groups of MEMBRANE LIPIDS leading to disruption of the membrane.
Peptides whose amino and carboxy ends are linked together with a peptide bond forming a circular chain. Some of them are ANTI-INFECTIVE AGENTS. Some of them are biosynthesized non-ribosomally (PEPTIDE BIOSYNTHESIS, NON-RIBOSOMAL).

Passage of cell-penetrating peptides across a human epithelial cell layer in vitro. (1/188)

Cell barriers are essential for the maintenance and regulation of the microenvironments of the human body. Cell-penetrating peptides have simplified the delivery of bioactive cargoes across the plasma membrane. Here, the passage of three cell-penetrating peptides (transportan, the transportan analogue transportan 10, and penetratin) across a Caco-2 human colon cancer cell layer in vitro was investigated. The peptides were internalized into epithelial Caco-2 cells as visualized by indirect fluorescence microscopy and quantified by fluorimetry. Studies of peptide outflow from cells showed that the peptides were in equilibrium across the plasma membrane. The ability of the peptides to cross a Caco-2 cell layer was tested in a two-chambered model system. After 120 min, 7.0%, 2.8% and 0.6% of added transportan, transportan 10 and penetratin respectively was detected in the lower chamber. Both transportan and transportan 10 reversibly decreased the trans-epithelial electrical resistance of the barrier model, with minimum values after 60 min of 46% and 60% of control respectively. Penetratin did not affect the resistance of the cell layer to the same extent. Although transportan markedly increased the passage of ions, the paracellular flux of 4.4 kDa fluorescein-labelled dextran was limited. In conclusion, the results indicate that the transportan peptides pass the epithelial cell layer mainly by a mechanism involving a transcellular pathway.  (+info)

TAT peptide and its conjugates: proteolytic stability. (2/188)

 (+info)

MALDI-TOF mass spectrometry: a powerful tool to study the internalization of cell-penetrating peptides. (3/188)

 (+info)

Lipid domain separation, bilayer thickening and pearling induced by the cell penetrating peptide penetratin. (4/188)

 (+info)

Cell-penetrating peptide exploited syndecans. (5/188)

 (+info)

Cell biology meets biophysics to unveil the different mechanisms of penetratin internalization in cells. (6/188)

 (+info)

Peptide-mediated protein delivery-which pathways are penetrable? (7/188)

 (+info)

Morpholinos and their peptide conjugates: therapeutic promise and challenge for Duchenne muscular dystrophy. (8/188)

 (+info)

"A Noncovalent Peptide-Based Strategy for Peptide and Short Interfering RNA Delivery". Handbook of Cell-Penetrating Peptides, ... Cell-penetrating peptides (CPPs) are short peptides that facilitate cellular intake and uptake of molecules ranging from ... Meade BR, Dowdy SF (March 2007). "Exogenous siRNA delivery using peptide transduction domains/cell penetrating peptides". ... "A new potent secondary amphipathic cell-penetrating peptide for siRNA delivery into mammalian cells". Molecular Therapy. 17 (1 ...
... s are cell-penetrating peptides that act as intracellular modulators of signal transference from receptors to G ... Cell-Penetrating Peptides. Methods in Molecular Biology. Vol. 683. Clifton, N.J. pp. 259-75. doi:10.1007/978-1-60761-919-2_19. ... "Activation and inhibition of G protein-coupled receptors by cell-penetrating membrane-tethered peptides". Proc. Natl. Acad. Sci ... "Suppression of Arterial Thrombosis with Affecting Hemostatic Parameters with a Cell-Penetrating PAR1 Pepducin". Circulation. ...
Cell-penetrating peptide CPP: guides the TIVA tag through cell membranes into tissues. It is linked to the TIVA tag by a ... Madani F, Lindberg S, Langel U, Futaki S, Gräslund A (2011). "Mechanisms of cellular uptake of cell-penetrating peptides". ... TIVA tags are created initially via solid-phase synthesis with the cell-penetrating peptide conjugated afterwards. The ... the cell is imaged with the confocal microscope. Using a glass pipette, the photolysed cell is isolated by aspiration. Cells ...
Two features of the protein structure have been associated with cell-penetrating properties that are uncommon for peptide ... Although the toxin was discovered to be cell-penetrating, there is no sequence similarity to classical cell-penetrating ... Guidotti, Giulia; Brambilla, Liliana; Rossi, Daniela (April 2017). "Cell-Penetrating Peptides: From Basic Research to Clinics ... "A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain". Cell. 178 (6): 1362-1374.e16. doi: ...
"Human DMBT1-Derived Cell-Penetrating Peptides for Intracellular siRNA Delivery". Molecular Therapy: Nucleic Acids. 8: 264-276. ... Cell Mol. Biol. 20 (4): 759-68. doi:10.1165/ajrcmb.20.4.3439. PMID 10101009. Holmskov U, Lawson P, Teisner B, Tornoe I, Willis ... Cell Mol. Biol. 20 (4): 759-68. doi:10.1165/ajrcmb.20.4.3439. PMID 10101009. Holmskov U, Mollenhauer J, Madsen J, Vitved L, ... The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with ...
Seo, Bong; Hong, Yean; Do, Jeong (2017-03-03). "Cellular Reprogramming Using Protein and Cell-Penetrating Peptides". ... One of the available options is the transfer of small proteins or penetrating peptides across the membrane, which is safer but ... in 2012 in relation to the effectiveness of reprogramming somatic cells to pluripotent cells using viral and non-viral ... This phenomenon is essential in dedifferentiating a somatic cell to a pluripotent cell (induction of an induced pluripotent ...
... appears to be an even more potent cell penetrating peptide. A Hadrucalcin derivative has been used as a carrier for ... Cell-Penetrating Nanobiosensors for Pointillistic Intracellular Ca 2+ - Transient Detection. 2014. (Orphaned articles from ... Hadrucalcin is a peptide toxin from the scorpion calcin family. The mature hadrucalcin peptide is composed of 35 amino acids, ... Cell penetration properties of a highly efficient mini maurocalcine Peptide. Pharmaceuticals (Basel). 2013;6(3):320-39. doi: ...
... calcins are able to penetrate cell membranes with high efficiency. Thus, they act as cell-penetrating peptides (CPPs) and can ... It acts as a cell-penetrating peptide (CPP); it binds with high affinity and specificity to skeletal ryanodine receptor 1 (RYR1 ... Cell penetration properties of maurocalcine, a natural venom peptide active on the intracellular ryanodine receptor. Biochim. ... a Family of High-Affinity Peptide Ligands of Ryanodine Receptors". Biophysical Journal. Cell. 106 (2): 106-13. Bibcode:2014BpJ ...
Coadministration of a tumor-penetrating peptide enhances the efficacy of cancer drugs. Science 2010, 328: 1031-1035 https:// ... Focus on RNA biology and the signaling pathways that regulate cell growth and cell fate; what drives cancer cell growth, to ... Cell (1997). Deveraux, Q.L., Takahashi, R, Salvesen, G.S., and Reed, J.C. X-linked IAP is a direct inhibitor of cell-death ... Blood 111:3322-3330 (2008) Frisch, S.M. and Francis, H. Disruption of epithelial cell matrix induces apoptosis. J. Cell Biol. ...
A cell-penetrating peptide is a peptide able to penetrate the cell membrane. Wikiquote has quotations related to Peptide. ... renal peptides, respiratory peptides, opiate peptides, neurotrophic peptides, and blood-brain peptides. Some ribosomal peptides ... fungal peptides, invertebrate peptides, amphibian/skin peptides, venom peptides, cancer/anticancer peptides, vaccine peptides, ... immune/inflammatory peptides, brain peptides, endocrine peptides, ingestive peptides, gastrointestinal peptides, cardiovascular ...
In the field of cell penetrating peptides (CPPs), Wennemers showed that preorganization of cationic charges along an ... "Effect of Preorganized Charge-Display on the Cell-Penetrating Properties of Cationic Peptides". Angewandte Chemie International ... Recently, she reported peptide‐stabilized platinum nanoparticles that have greater toxicity against hepatic cancer cells (HepG2 ... Chemical Biology: In chemical biology, Wennemers uses larger proline-rich peptides, such as collagen model peptides or ...
Recently, cell penetrating peptides have been used for their ability to deliver non-permeant compounds into cells. Doxorubicin ... MCa is suggested to be a cell-penetrating peptide (CPP). CPPs commonly contain many basic residues oriented toward the same ... MCa is similar to CPP sequences because MCa is a small peptide, it has a net positive charge, it enters many cell types, it ... The toxin complex efficiently penetrated into various cell types without requiring metabolic energy or implicating an ...
"Amphiphilic Cell-Penetrating Peptides Containing Natural and Unnatural Amino Acids as Drug Delivery Agents". Cells. 11 (7): ... Cyclic peptides in plants are synthesized via a two-step process; the translation of a linear peptide chain, and its subsequent ... Cyclic peptides can be classified according to the types of bonds that comprise the ring. Homodetic cyclic peptides, such as ... Other bicyclic peptides include echinomycin, triostin A, and Celogentin C. There are a number of bi and monocyclic peptides ...
"Predicting cell-penetrating peptides using machine learning algorithms and navigating in their chemical space". Scientific ... of five for the implicit assumption that passive diffusion is the only important mechanism for the entry of drugs into cells, ... also demonstrated that some natural products break the chemical rules used in Lipinski filter such as macrolides and peptides ...
Zhao XL, Chen BC, Han JC, Wei L, Pan XB (November 2015). "Delivery of cell-penetrating peptide-peptide nucleic acid conjugates ... Though an unmodified PNA cannot readily cross the cell membrane to enter the cytosol, covalent coupling of a cell penetrating ... Peptide nucleic acid (PNA) is an artificially synthesized polymer similar to DNA or RNA. Synthetic peptide nucleic acid ... Clicked peptide polymer Glycol nucleic acid Oligonucleotide synthesis Peptide synthesis Threose nucleic acid Nielsen PE, Egholm ...
Scientific Reports 3: 1607 CellPPD: In silico approaches for designing highly effective cell penetrating peptides. Journal of ... PLoS ONE 8(6): e67008 Lbtope: Improved Method for Linear B-Cell Epitope Prediction Using Antigen's Primary Sequence. PLoS ONE 8 ... In Silico Approach for Predicting Toxicity of Peptides and Proteins. [1] "Notable bioinformatician - Dr Gajendra Pal Singh ... Computational approach for designing tumor homing peptides. ...
"A cell-penetrating peptide from a novel pVII-pIX phage-displayed random peptide library". Bioorganic & Medicinal Chemistry. 10 ... Further mechanistic studies of this peptide uncovered a dimerization "switch" that modulates the cell-penetrating activity. In ... By panning this library against a B lymphoctye cell line, a unique cell-binding and internalizing peptide was discovered. ... in the Internalization Mechanism of a Cell-Penetrating Peptide". Journal of the American Chemical Society. 127 (2): 538-539. ...
Teesalu T, Sugahara KN, Kotamraju VR, Ruoslahti E (September 2009). "C-end rule peptides mediate neuropilin-1-dependent cell, ... Ruoslahti E (February 2017). "Tumor penetrating peptides for improved drug delivery". Advanced Drug Delivery Reviews. 110-111 ( ... Peptides that are based on iRGD are utilized to make such tumors temporarily more accessible to circulating anti-cancer drugs. ... CS1: long volume value, Peptides, Infectious diseases). ...
The iRGD peptide homes and penetrates tumors through a 3-step process: First, the RGD sequence motif mediates binding to αVβ3 ... Teesalu T, Sugahara KN, Kotamraju VR, Ruoslahti E (September 2009). "C-end rule peptides mediate neuropilin-1-dependent cell, ... The peptide was able to home to tumor tissues, but in contrast to standard RGD (Arginylglycylaspartic acid) peptides, also ... Ruoslahti E (February 2017). "Tumor penetrating peptides for improved drug delivery". Advanced Drug Delivery Reviews. 110-111 ( ...
Tat contains a protein transduction domain (PTD), which is also known as a cell-penetrating peptide. Originally characterised ... "Different mechanisms for cellular internalization of the HIV-1 Tat-derived cell penetrating peptide and recombinant proteins ... It can be absorbed by cells that are not infected with HIV, and can act directly as a toxin producing cell death via apoptosis ... Schwarze SR, Hruska KA, Dowdy SF (July 2000). "Protein transduction: unrestricted delivery into all cells?". Trends Cell Biol. ...
"Cell-Penetrating Peptide-Modified Gold Nanoparticles for the Delivery of Doxorubicin to Brain Metastatic Breast Cancer". ... They concluded a 15% cell viability and dose dependent cell damage. Reduction in cell viability was detected in vivo ... Studies in human leukemia cells revealed that prolonged exposure in AuNPs did not harm the cells, even at ~100 μM of Au. Rather ... A tumor consists of a multitude of cell types, and thus targeting a single type of cell is ineffective and potentially ...
"Stability of cell-penetrating peptide-morpholino oligomer conjugates in human serum and in cells". Bioconjugate Chemistry. 18 ( ... cells in adult organisms can be accomplished by using covalent conjugates of Morpholino oligos with cell-penetrating peptides, ... stability and toxicity of a cell-penetrating peptide-morpholino oligomer conjugate". Bioconjugate Chemistry. 18 (4): 1325-31. ... the minor spliceosome acts outside the nucleus and controls cell proliferation". Cell. 131 (4): 718-29. doi:10.1016/j.cell. ...
Alternately, they may penetrate into the cell to bind intracellular molecules which are crucial to cell living. Intracellular ... In the competition of bacterial cells and host cells with the antimicrobial peptides, antimicrobial peptides will ... So the cholesterol in mammalian cells will protect the cells from attack by the antimicrobial peptides. Besides, the ... zwitterionic phospholipids on the cell surface of mammalian cell membranes plays a major role in the formation of peptide-cell ...
A disulfide-linked peptide, which is adjacent to the tag, allows it to penetrate the cell membrane. Once inside, laser ... spatial single-cell imaging platform for cell atlasing, tissue phenotyping, cell-cell interactions, cellular processes, and ... single-cell RNA sequencing generates the transcriptome of the visualized cells. This method can process thousands of cells ... The cells bound by the fluorescent marker are photoactivated, dissociated and sorted via fluorescence-activated cell sorting. ...
"Charge converting nanostructured lipid carriers containing a cell-penetrating peptide for enhanced cellular uptake". J Colloid ... However, they do not reach epithelial cells as they are immobilized via ionic interactions in mucus displaying an anionic ... Cationic nanoparticles are more efficiently taken up by epithelial cells than anionic ones. ...
Morpholino antisense oligos conjugated to cell penetrating peptides have been shown to partially protect mice from WNV disease ... West Nile meningitis (WNM) usually involves fever, headache, stiff neck and pleocytosis, an increase of white blood cells in ... Disconnect of upper motor neuron influences on the anterior horn cells possibly by myelitis or glutamate excitotoxicity have ...
... sulfate proteoglycans cooperate in cellular uptake of nanoparticles functionalized by cationic cell-penetrating peptides". Sci ... The prototype tumor-penetrating peptide, iRGD, is in clinical trials in solid tumor patients tested as an enhancer of cancer ... These tumor-penetrating peptides selectively home to tumor vessels, where they activate a transport pathway that delivers the ... Teesalu, T.; Sugahara, K. N.; Kotamraju, V. R.; Ruoslahti, E. (2009). "C-end rule peptides mediate neuropilin-1-dependent cell ...
... a nontoxic protamine substitute and an effective cell-penetrating peptide". Journal of Controlled Release. 193: 63-73. doi: ... A sperm cell can contain up to 50,000 toroid-shaped structures in its nucleus with each toroid containing about 50 kilobases. ... The primary structure of protamine P1, the protamine used for packaging DNA in sperm cells, in placental mammals is usually 49 ... An analogue of this peptide has also been produced. In gene therapy, protamine sulfate's ability to condense plasmid DNA along ...
... of cell-penetrating peptides and penetration accelerating sequence for nose-to-brain delivery of glucagon-like peptide-2". ... Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... Glucagon-like peptide 2 receptor Akita, Tomomi; Kimura, Ryosuke; Akaguma, Saki; Nagai, Mio; Nakao, Yusuke; Tsugane, Mamiko; ... GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is ...
... and cell-penetrating anti-fungal peptides. Penicillium digitatum can be identified in the laboratory using a variety of methods ... "Understanding the mechanism of action of cell-penetrating antifungal peptides using the rationally designed hexapeptide PAF26 ... The hyphal cells are haploid, although individual hyphal compartments may contain many genetically identical nuclei. During the ... Revealing diverse modes of action and biological roles of antifungal peptides. 26 (4): 146-155. doi:10.1016/j.fbr.2012.10.003. ...
Podocytes, Endothelial cells, and Glomerular mesangial cell are present. Nephrology Urology Lote CJ (2012). Principles of Renal ... atrial natriuretic peptide (sodium) and brain natriuretic peptide (sodium). A countercurrent system in the renal medulla ... Cortical nephrons (the majority of nephrons) start high in the cortex and have a short loop of Henle which does not penetrate ... It contains three components: the macula densa, juxtaglomerular cells, and extraglomerular mesangial cells.: 404 Patients in ...
June 2021). "Penetrating the Blood-Brain Barrier with New Peptide-Porphyrin Conjugates Having anti-HIV Activity". Bioconjugate ... One of the best-known families of porphyrin complexes is heme, the pigment in red blood cells, a cofactor of the protein ... Several porphyrin-peptide conjugates were found to have antiviral activity against HIV in vitro. Although not commercialized, ... Kohn E, Shirly D, Fry CH, Caputo GA (14 June 2022). "Peptide‐assisted supramolecular polymerization of the anionic porphyrin ...
... a whole-cell sonicate enzyme immunoassay followed by a VlsE C6 peptide enzyme immunoassay". Clinical Infectious Diseases. 53 (6 ... "penetrates the skin". Many people from this area of Great Britain emigrated to North America between 1717 and the end of the ... The spirochetes may also induce host cells to secrete quinolinic acid, which stimulates the NMDA receptor on nerve cells, which ... Biopsy and confirmation of Borrelia cells in myocardial tissue may be used in specific cases but are usually not done because ...
The growth of microorganisms is inhibited when iodine penetrates into the cells and oxidizes proteins, genetic material, and ... includes plant extracts and peptides) National Pesticide Information Center Overview of the use of Antimicrobials in plastic ... Disruption of the cell membrane is another property of alcohols that aid in cell death. Alcohols are cheap and effective ... When the concentration of dissolved materials or solute is higher inside the cell than it is outside, the cell is said to be in ...
Elsinochromes were proven to kill cells of the host plant and even cause necrotic legions on live tissue by reactions of a ... It seems that thrips are only able to penetrate young avocado tissue. In order to control thrips, common insecticides such as ... "Phytotoxic secondary metabolites and peptides produced by plant pathogenic Dothideomycete fungi". FEMS Microbiology Reviews. 37 ... The singlet oxygen breaks down proteins, lipids, and nucleic acids in the plant cells. Toxicity has been demonstrated to ...
... that AMPK is an internal oscillator of nutrients as opposed to light in the thought that light could not penetrate all cells of ... Proteins involved in the SCN pathway (Prokineticin 2 (PK2), vasoactive intestinal peptide (VIP), pituitary adenylate cyclase- ... Upon inducing cell-specific lesions to the DMH, the FAA in rats are diminished and is further supported by measuring EEG in ... distinctly the enteroendocrine cells (EECs). The identification of EECs as a possible source of FEO is that they contain many ...
... a proprietary class of therapeutics which use peptide ligands to carry a target drug to tumor cells. Pentarins are nanoparticle ... They are believed to be capable of penetrating dense tumor-based cancers. Lippard has been elected to the National Academy of ... Rosenberg, B.; Van Camp, L.; Krigas, T. (1965). "Inhibition of Cell Division in Escherichia coli by Electrolysis Products from ... Dean, Kevin M.; Qin, Yan; Palmer, Amy E. (September 2012). "Visualizing metal ions in cells: An overview of analytical ...
Receptors on the cancer cell membrane bind TRAIL and cell surface enzymes clip the peptide thus release the drug onto the cell ... One application was as a radio replacement for long-distance communications, given sound's ability to penetrate steel and water ... A graphene 'flying carpet' was demonstrated to deliver two anti-cancer drugs sequentially to the lung tumor cells (A549 cell) ... An advantage of graphene electrodes is the ability to produce inexpensive Schottky junction solar cells. Graphene solar cells ...
These membranes are flat sheets that form a continuous barrier around all cells. The cell membranes of almost all organisms and ... Kim J, Mosior M, Chung LA, Wu H, McLaughlin S (July 1991). "Binding of peptides with basic residues to membranes containing ... Alternatively, some membrane proteins penetrate all the way through the bilayer and serve to relay individual signal events ... This procedure is now used extensively, for example by fusing B-cells with myeloma cells. The resulting "hybridoma" from this ...
Penetrates Human Cells, and Stabilizes HDM2 in Cell Culture" PLOSOne (2012), 7(10), doi:10.1371/journal.pone.0045948 Shivaiah ... Spiroligomers (also known as bis-peptides) are synthetic oligomers made by coupling pairs of bis-amino acids into a fused ring ... The molecule enters cells through passive diffusion, and this mimic was shown to stabilize HDM2 in cell culture. Binuclear ... "Solid-Phase Synthesis of Functionalized Bis-Peptides" Biopolymers, (2011), 96(5), 578-585 doi:10.1002/bip.21591 Christopher G. ...
Targeting double-stranded breaks increases the probability that cells will undergo cell death. Cancer cells are generally less ... The dose increases while the particle penetrates the tissue, up to a maximum (the Bragg peak) that occurs near the end of the ... peptide receptor radionuclide therapy). Another example is the injection of radioactive yttrium-90 or holmium-166 microspheres ... Fractionation allows normal cells time to recover, while tumor cells are generally less efficient in repair between fractions. ...
... of PG peptide chains are labeled with FDAA. Published studies utilizing FDAAs as tools include: Visualizing bacterial cell wall ... For example, coumarin-based FDAA (HADA) is small enough to penetrate the bacterial outer-membranes and thus is widely used for ... Quantifying bacterial cell wall growth activity. Assaying the anti-cell wall ability of antibiotics. Screening new anti-cell ... Studying bacterial cell wall growth. Monitoring bacterial cell wall turnover. ...
... a peptide from the egg jelly layer. J. Cell Biol. 101, 2324-2329. Miller, R.D. and Vogt, R. (1996) An N-terminal partial ... the only cells that possess the ability to penetrate the oocyte and fertilize it. This raised the possibility that, in mammals ... Cell Biol. 7, 276-285. Alvarez, L., Friedrich, B.M., Gompper, G., Kaupp. U.B. (2013). "The computational sperm cell". Trends in ... J. Cell. Physiol. 208, 487-494. Morisawa, M. (1994). Cell signaling mechanisms for sperm motility. Zool. Sci. 11, 647-662. ...
Hsu, T.; Mitragotri, S. (8 September 2011). "Delivery of siRNA and other macromolecules into skin and cells using a peptide ... skin penetrating peptides and ionic liquids. He also invented intestinal patches and ionic liquids for oral delivery of ... Mitragotri also pioneered nanoparticle-enabled cell therapies which use drug-loaded nanoparticles that hitch a ride on red ... blood cells, monocytes and other circulatory cells for tissue-specific delivery. Mitragotri's technologies are used to develop ...
A new area of interest is the role of mast cells in ICH. Hemphill JC, 3rd; Greenberg, SM; Anderson, CS; Becker, K; Bendok, BR; ... "Penetrating Head Trauma." Archived 2005-09-13 at the Wayback Machine Emedicine.com. Sheth, Kevin N. (27 October 2022). " ... Cerebral amyloid angiopathy, a disease characterized by deposition of amyloid beta peptides in the walls of the small blood ... More common in adults than in children, intraparenchymal bleeds are usually due to penetrating head trauma, but can also be due ...
Cycloparaphenylene Cell-penetrating peptide, are short polycationic sequences Central precocious puberty, a condition in which ...
Since the needle does not need to penetrate to the level of the muscle, a thinner and shorter needle can be used. Subcutaneous ... Sting rays use their spinal blade to inject a protein-based venom which causes localized cell death but is not generally life- ... Dendrocnide species, also called stinging trees, use their trichomes to inject a mix of neurotoxic peptides which causes a ... Leeches can inject an anticoagulant peptide called hirudin after attaching to prevent blood from clotting during feeding. This ...
Keratinocytes, mast cells, eosinophils and T-cells release pruritogens in the skin; leading to activation of Aδ fibers and ... Disruptions of the epidermal barrier allows allergens to penetrate the epidermis to deeper layers of the skin. This leads to ... Filaggrin mutations are also associated with a decrease in natural antimicrobial peptides found on the skin; subsequently ... Filaggrin stimulates skin cells to release moisturizing factors and lipid matrix material, which cause adhesion of adjacent ...
... targeting of hematopoietic stem cells proposed a novel technique of conjugating PNA molecules with cell penetrating peptide ( ... September 2011). "Targeted disruption of the CCR5 gene in human hematopoietic stem cells stimulated by peptide nucleic acids". ... In mammalian cells, H-DNA-sequences displayed a high frequency of recombination. For example, a study conducted on myeloma cell ... specific TFO to the Ets2 promoter sequence that down-regulated the gene expression and led to a slowing of cell growth and cell ...
... used for the generation of transgenic plants as it has been able to efficiently and effectively penetrate the cell walls. More ... Some limitations include intracellular accumulation of heterologous proteins, improper folding of the peptide, lack of post- ... for example differences in glycosylation between rodent and human cells. Even within one cell line, often stabilizing a cell ... In this method, the viral vector (virion) infects host cells that by directly transporting DNA into the nucleus of the cell. ...
Cell. 156 (5): 1072-1083. doi:10.1016/j.cell.2014.01.044. PMID 24561062. Inta, D; Lang, U E; Borgwardt, S; Meyer-Lindenberg, A ... Deep penetrating striate arteries supply blood to the striatum. These arteries include the recurrent artery of Heubner arising ... and express the peptides dynorphin and substance P and dopamine D1 and adenosine A1 but not A2A receptors ... These two ... Types of cells in the striatum include: Medium spiny neurons (MSNs), which are the principal neurons of the striatum. They are ...
A hypothetical cell membrane termed an azotosome, capable of functioning in liquid methane in Titan conditions was computer- ... a Backbone for Peptide Nucleic Acids Which May Have Been the First Genetic Molecules for Life on Earth". PLOS ONE. 7 (11): ... Spectroscopic transparency allowing solar radiation to penetrate several meters into the liquid (or solid), greatly aiding the ... "Life-like cells are made of metal". New Scientist. September 14, 2011. Retrieved 2014-05-25. Early Archaean Microorganisms ...
When absorbed through the skin from a poison ivy plant, urushiol undergoes oxidation in the skin cells to generate the actual ... Nickel allergy is caused by nickel metal ions penetrating the skin and binding to skin proteins. Antibodies have successfully ... Carter, John (1 January 1996). "Conjugation of Peptides to Carrier Proteins via Glutaraldehyde". The Protein Protocols Handbook ... Usually, the first exposure causes only sensitization, in which there is a proliferation of effector T-cells. After a ...
"Nomenclature and Symbolism for Amino Acids and Peptides". IUPAC-IUB Joint Commission on Biochemical Nomenclature. 1983. ... and so a small amount of an ingested dose of D-phenylalanine is excreted in the urine without penetrating the central nervous ... of the coding relationship that links information stored in genomic nucleic acid with protein expression in the living cell. ...
For microbes to gain access to the plant, they must be able to penetrate the layer of wax that forms a hydrophobic barrier on ... The rhizobial symbionts can then travel through this infection thread to gain entrance to root cells. Mycorrhizae and other ... but can also include larger molecules and small peptides. In practice, chemical ecology relies extensively on chromatographic ... Plant and Cell Physiology. 50 (5): 911-923. doi:10.1093/pcp/pcp030. ISSN 0032-0781. PMID 19246460. Retrieved 2017-10-11. Heil, ...
Peptides produced by aphids, Thaumatins, are thought to provide them with resistance to some fungi. It was common at one time ... Using their carotenoids, aphids may well be able to absorb solar energy and convert it to a form that their cells can use, ATP ... These stick to the aphid, germinate, and penetrate the aphid's skin. The fungus grows in the aphid's hemolymph. After about ... Essential amino acids are provided to aphids by bacterial endosymbionts, harboured in special cells, bacteriocytes. These ...
... antigen presenting cells such as dendritic cells, macrophages, B cells, and melanocytes. Importantly, melanocytes stimulated by ... When ultraviolet rays penetrate the skin and damage DNA, thymidine dinucleotide (pTpT) fragments from damaged DNA will trigger ... including the MSH and ACTH peptides that are produced from the precursor proopiomelanocortin. Vitiligo is a skin disease where ... they are derived from two different cell lineages. Dendritic cells are derived from hematopoietic stem cells in the bone marrow ...
... the field of cell penetrating peptides as vectors has exploded. The cargoes they can deliver range from other small peptides, ... or naturally occurring peptides, able to carry variety of cargoes across the cellular membranes in an intact, functional form. ... Cell penetrating peptides (CPPs), also known as protein transduction domains (PTDs), first identified ~25 years ago, are small ... Since then, the number of peptides, both cell-specific and non-specific, reported as having cell penetrating properties has ...
Targeted disruption of key disease-linked protein-protein interactions with highly selective cell-penetrating peptide ... Targeted disruption of key disease-linked protein-protein interactions with highly selective cell-penetrating peptide ...
Cell-penetrating peptides (CPPs) appear as a possibility to increase the cellular delivery of non-permeant biomolecules such as ... Cell Line, Cell-Penetrating Peptides, Drug Carriers, Endocytosis, Humans, Molecular Sequence Data, Muscular Dystrophies, ... Cell-penetrating peptides (CPPs) appear as a possibility to increase the cellular delivery of non-permeant biomolecules such as ... Delivery of therapeutic oligonucleotides with cell penetrating peptides. Boisguérin P., Deshayes S., Gait MJ., ODonovan L., ...
... are short cationic peptides that penetrate cells by interacting with the negatively charged plasma membrane; however, the ... Furthermore, RNA interference (RNAi) knockdown of SCARA subtypes (SCARA3 and SCARA5) that are expressed in this cell line led ... totally inhibit the activity of PF14-oligonucleotide nanocomplexes in the HeLa pLuc705 splice-correction cell model, while ... Cell-penetrating peptides (CPPs) are short cationic peptides that penetrate cells by interacting with the negatively charged ...
... were given a graft of breast adenocarcinoma cells (TN60) into subcutaneous tissue. Mut3DPT-PP2A/SET peptide was used to block ... At day 5 all mice were injected either with placebo or with the peptide. The treated group showed significant tumor reduction ( ... The peptide Mut3DPT-PP2A/SET has demonstrated anti-tumor activity by reduction in vivo of tumor growth becoming a promising ... 48 mice were grafted at day 0 with breast UNLP-C3H/S tumor cells, and after randomization, they were assigned to one of the two ...
Title : Transfection by cell-penetrating peptides. Abstract: Recent data on mechanisms and applications of transfection ... 2016) Recent in vivo advances in cell-penetrating peptide-assisted drug delivery. Expert Opinion on Drug Delivery, 13(3), 373- ... strategies by cell penetrating peptides (CPP) are summarized on the variety of different oligonucleotide cargoes including ... of PepFect and NickFect technologies for oligonucleotide transfection by transportan-based cellpenetrating peptides in vitro ...
An improved cell-penetrating, caspase-activatable, near-infrared fluorescent peptide for apoptosis imaging. Bioconjug Chem 2009 ... This probe consisted of a cell-penetrating Tat peptide conjugated to an effector recognition sequence (DEVD) that was flanked ... Herein, we present biochemical analysis of a second generation probe, KcapQ, with a modified cell-penetrating peptide sequence ... Cell Survival. Cells. Enzyme Activation. Enzyme Inhibitors. Fluorescence. Fluorescent Dyes. HeLa Cells. Humans. Infrared Rays. ...
... internalization and toxicity of the cell-penetrating antifungal peptide PAF26 on fungal cells. ... which coincides with cell death. Peptide containment within vacuoles preserves fungal cells from peptide toxicity. ... cell-penetrating antifungal peptides. Its short amino acid sequence facilitates the analysis of its structure-activity ... The synthetic, cell penetrating hexapeptide PAF26 (RKKWFW) is antifungal at low micromolar concentrations and has been proposed ...
Scavenger receptor-mediated uptake of cell-penetrating peptide nanocomplexes with oligonucleotides. FASEB J. 26, 1172-1180 ( ... Systemic peptide-mediated oligonucleotide therapy improves long-term survival in spinal muscular atrophy. Proc. Natl. Acad. Sci ... Motor neuron cell-nonautonomous rescue of spinal muscular atrophy phenotypes in mild and severe transgenic mouse models. Genes ... Activating gene expression in mammalian cells with promoter-targeted duplex RNAs. Nat. Chem. Biol. 3, 166-173 (2007). ...
his arginine-rich TAT peptide penetrates plasma membrane directly. Fragment of the HIV transactivator protein (TAT) ... Cell Permeable & Penetrating peptides Sub-category Research Area * HIV-1 Tat Fragments ... TAT is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates ... Custom Peptides Synthesis. From macrocyclic to fluorescent or other highly modified peptides ...
CPPs (cell-penetrating peptides) have given rise to much interest for the delivery of biomolecules such as peptides, proteins ... Pharmacokinetics, Biodistribution, Stability and Toxicity of a Cell-Penetrating Peptide-Morpholino Oligomer Conjugate. Authors ... Objective: Conjugation of arginine-rich cell-penetrating peptide (CPP) to phosphorodiamidate morpholino oligomers (PMO) has... ... Pharmacokinetics, Biodistribution, Stability and Toxicity of a Cell-Penetrating Peptide-Morpholino Oligomer Conjugate. ...
Sandrine Sagan Versatile Membrane Partners for Thiol-Containing Cell-Penetrating Peptides / Protein-Transduction Domains. ... Annemieke Madder Furan (photo)-Oxidation Based Click Reactions for Decoration and Conjugation of Peptides and Oligonucleotides ...
Enhanced target cell specificity and uptake of lipid nanoparticles using RNA aptamers and peptides ... used 2-40 µM Tat peptide as a cell-penetrating peptide to facilitate siRNA entry. In particular, the authors observed that ... C) Percentage of cells positive for Cy5 detection in HEK cell types. D) MFI of Cy5 in each cell population in HEK cell types. ... C) Percentage cells positive for Cy5 detection in HEK cell types. D) MFI of Cy5 in each cell population in HEK cell types. ...
Photoregulated macrocyclic cell-penetrating peptides Chem. Heterocycl. Compd. 2020, 56 (6), 719-721 ... Pharmacological inhibition of syntenin PDZ2 domain impairs breast cancer cell activities and exosome loading with syndecan and ... Diarylethene moiety as an enthalpy-entropy switch: photoisomerizable stapled peptides for modulating p53/MDM2 interaction ...
Keywords: RNAi; cell penetrating peptides; functionalization; lipids; non-viral cationic vectors; polymers; siRNAs. ... as well as respond to the cancer cell environment and with cancer cell receptor specific ligands to explicitly target them for ... Nat Rev Mol Cell Biol, 2007. 8(1): p. 23-36. - PubMed ...
Cell Line, Tumor; Cell-Penetrating Peptides; Drug Design*; Glioma*; Humans; Mice; Peptides/pharmacology; Xenograft Model ... We designed a novel deliverable truncated-dominant-negative (d/n) form of ATF5 fused to a cell-penetrating domain (Pen-d/n-ATF5 ... In vitro Pen-d/n-ATF5-RP entered into glioma cells and triggered massive apoptosis. In vivo, subcutaneously-administered Pen-d/ ... n-ATF5-RP passed the blood brain barrier, entered normal brain and tumor cells, and then caused rapid selective tumor cell ...
Cell-Penetrating Peptide-Conjugated BF. Laxman K; Reddy BPK; Robinson A; Srivastava R; Ravikanth M. ChemMedChem; 2020 Oct; 15( ... of unique water-soluble heptamethine cyanine dye for use as NIR photosensitizer in photodynamic therapy of cancer cells.. Yang ... cyanine dye conjugate that potentiates the cytostatic and cytotoxic effects of Crizotinib in patient-derived glioblastoma cell ...
2006) Developmental Cell 11, 471-481. PMID: 17011487 T Gattegno, A Mittal, C Valansi, KC Nguyen, DH Hall, LV Chernomordik, B ... The C. elegans developmental fusogenEFF-1 mediates homotypic fusion in heterologous cells and in vivo. ( ... Key findings and fields of interest Proteins and Pathways in Developmental Cell-Cell Fusion B. Podbilewicz, E. Leikina, A. ... Efficient entry of cell-penetrating peptide nona-arginine into adherent cells involves a transient increase in intracellular ...
Cell-penetrating Peptides for Cancer-targeting Therapy and Imaging. Journal: Current Cancer Drug Targets. Volume: 15 Issue: 4 ... "cell imaging". Image Guidance in Stem Cell Therapeutics: Unfolding the Blindfold. Journal: Current Drug Targets. Volume: 16 ... Potential Nanoprobe for Prostate Cancer Cell Imaging. Journal: Current Molecular Imaging (Discontinued). Volume: 4 Issue: 1 ... Imaging to Monitor Repair of Myocardial Infarction Using Genetically Engineered Bone Marrow-Derived Mesenchymal Stem Cells. ...
Thermodynamics of Cell Penetrating Peptides on Lipid Membranes: Sequence and Membrane Acidity Regulate Surface Binding ... JOURNAL OF PEPTIDE SCIENCE : AN OFFICIAL PUBLICATION OF THE EUROPEAN PEPTIDE SOCIETY.; Lugar: LOndres; Año: 2017 vol. 23 p. 236 ... JOURNAL OF PEPTIDE SCIENCE : AN OFFICIAL PUBLICATION OF THE EUROPEAN PEPTIDE SOCIETY.; Lugar: LOndres; Año: 2019 vol. 25 ... New small-size peptides modulators of the exosite of BACE1 obtained from a structure-based design ...
Thyclotides, tetrahydrofuran-modified peptide nucleic acids that efficiently penetrate cells and inhibit microRNA-21.. Clausse ... Inhibition of multidrug resistance by SV40 pseudovirion delivery of an antigene peptide nucleic acid (PNA) in cultured cells.. ... PPG peptide nucleic acids that promote DNA guanine quadruplexes.. Englund EA, Gupta P, Micklitsch CM, Onyshchenko MI, Remeeva E ... Cyclopentane peptide nucleic acid: Gold nanoparticle conjugates for the detection of nucleic acids in a microfluidic format.. ...
Cell-penetrating peptides. ... COPE - with 54500+ entries the most comprehensive cell-to-cell ... For a collection of factors and peptides that target specific cell types or tissues and may be internalized see: ... All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia Entry completed ... See example pages at the bottom of the Cells-Talk.com home page THE SMART ONES COPE The others just sisyphos around ...
GPCRs embedded in endosomes have been shown to participate in cell signaling and influence how cancer develops. ... Red visualizes the uptake of cell-penetrating peptides by green fluid-filled vesicles of the endosome (gray), a cell organelle ... Red visualizes the uptake of cell-penetrating peptides by green fluid-filled vesicles of the endosome (gray), a cell organelle ... But some GPCRs ride endosomes into the cells interior. Whats more, these roving GPCRs add a spatial dimension to signaling, ...
Small peptide that is easily absorbed to stimulate cell growth and collagen formation, resulting in more skin elasticity and ... Niacinamide Strengthens the skins natural moisture barrier An antioxidant, peptide and ceramide blend helps diminish the ... Small rice protein peptides penetrate to stimulate cell growth and collagen formation, resulting in more skin elasticity. As it ... Hydrolyzed Rice Protein: Small peptide that is easily absorbed to stimulate cell growth and collagen formation, resulting in ...
The cell-penetrating peptides will aid in passing the proteins through the skin and target the pigment cells to reach ... We have used synthetic biology to fuse cell-penetrating peptides to proteins that are deficient in skin of vitiligo patients. ... If the target cell is deemed potentially dangerous, the cytotoxic cell grips the target cell tightly and creates an ... Team Stockholm have explored the possibilities to fight skin disorders using novel cell-penetrating peptides. We have focused ...
Magn Reson Med 2020 Cell penetrating peptide functionalized perfluorocarbon nanoemulsions for targeted cell labeling and ... Californias Stem Cell Agency California Institute for Regenerative Medicine. * For Researchers * Funding Opportunities * ... J Immunother Cancer 2018 Fluorine-19 MRI for detection and quantification of immune cell therapy for cancer. (PubMed: 30305175) ... Magn Reson Med 2014 Clinical cell therapy imaging using a perfluorocarbon tracer and fluorine-19 MRI. (PubMed: 25241945) ...
NIBIB-funded researchers are developing an imaging method that would allow surgeons to better identify cancerous cells in ... This probe combines the FDA-approved dye ICG with a non-toxic, tumor-targeting, cell-penetrating peptide known as p28. "Our ... "Additionally, because p28 preferentially penetrates various types of human cancer cells, we anticipate that our imaging ... To do this, they created a breast cancer cell line that expresses a protein called iRFP, which fluoresces under near-infrared ...
It appears that dysbiosis of commensals in cancer tissues is sensed by TLRs expressed on cancer cells and on immune ... infiltrating cells, whose activations result in a direct proliferative stimulation of tumor, or in a chronic inflammatory ... and antibacterial peptides. Mucosal Immunol. 5, 501-512. doi: 10.1038/mi.2012.23 ... since constitutive mechanisms physically impede microorganisms from penetrating the host. The intestinal tract is lined by a ...
Cell Penetrating Peptide Cell-Penetrating Peptide Peptides, Cell-Penetrating Registry Number. 0. Previous Indexing. Drug ... Cell-Penetrating Peptides Preferred Concept UI. M0539373. Registry Number. 0. Scope Note. Peptides that have the ability to ... Cell-Penetrating Peptides Preferred Term Term UI T758264. Date09/22/2009. LexicalTag NON. ThesaurusID NLM (2011). ... Peptides, Cell-Penetrating Term UI T758265. Date09/22/2009. LexicalTag NON. ThesaurusID NLM (2011). ...
... of bcr-abl in human leukemic cells with a coiled-coil protein delivered by a leukemia-specific cell-penetrating Peptide. Mol ... Review]. Cell Biochem Biophys, 31(2), 119-27. * Baumann CT, Lim CS, Hager GL (1998). Simultaneous visualization of the yellow ... Bruno BJ, Miller GD, Lim CS (2013). Basics and recent advances in peptide and protein drug delivery. [Review]. Ther Deliv, 4(11 ... Hager GL, Lim CS, Elbi C, Baumann CT (2000). Trafficking of nuclear receptors in living cells. [Review]. J Steroid Biochem Mol ...
  • Scavenger receptor-mediated uptake of cell-penetrating peptide nanocomplexes with oligonucleotides. (ox.ac.uk)
  • Cell-penetrating peptides: a re-evaluation of the mechanism of cellular uptake. (nih.gov)
  • Cellular uptake of unconjugated TAT peptide involves clathrin-dependent endocytosis and heparan sulfate receptors. (nih.gov)
  • We report herein a CCR5-selective RNA aptamer that acts to facilitate entry through a simplified BBB model and that drives the uptake of LNPs into CCR5-expressing cells, while the gp160 aptamer did not. (beilstein-journals.org)
  • Red visualizes the uptake of cell-penetrating peptides by green fluid-filled vesicles of the endosome (gray), a cell organelle involved in molecular transport. (genengnews.com)
  • Peptides that have the ability to enter cells by crossing the plasma membrane directly, or through uptake by the endocytotic pathway. (nih.gov)
  • The team also confirmed the properties of these peptides, including better uptake and binding within cells as well as no indication of cell death. (nih.gov)
  • The cargoes they can deliver range from other small peptides, full-length proteins, nucleic acids including RNA and DNA, liposomes, nanoparticles, and viral particles as well as radioisotopes and other fluorescent probes for imaging purposes. (mdpi.com)
  • Wilmer Eye Institute, Johns Hopkins Medicine researchers say they have used artificial intelligence models and machine-learning algorithms to successfully predict which components of amino acids that make up therapeutic proteins are most likely to safely deliver therapeutic drugs to animal eye cells. (nih.gov)
  • The new research showed that artificial intelligence-designed models accurately predicted an effective sequence of amino acids, also known as peptides or small proteins, that would bind to a particular chemical in rabbit eye cells and safely dispense medications over several weeks, reducing the need for frequent, strict treatment schedules. (nih.gov)
  • But what this colorful concoction lacks in taste, it makes up for as a valuable screening tool for peptides, miniature versions of proteins that our bodies use to control many cellular processes. (nih.gov)
  • Cell penetrating peptides (CPPs), also known as protein transduction domains (PTDs), first identified ~25 years ago, are small, 6-30 amino acid long, synthetic, or naturally occurring peptides, able to carry variety of cargoes across the cellular membranes in an intact, functional form. (mdpi.com)
  • Cell-penetrating peptides (CPPs) appear as a possibility to increase the cellular delivery of non-permeant biomolecules such as nucleic acids. (ox.ac.uk)
  • Thyclotides, tetrahydrofuran-modified peptide nucleic acids that efficiently penetrate cells and inhibit microRNA-21. (nih.gov)
  • Cyclopentane peptide nucleic acid: Gold nanoparticle conjugates for the detection of nucleic acids in a microfluidic format. (nih.gov)
  • Conformational constraints of cyclopentane peptide nucleic acids facilitate tunable binding to DNA. (nih.gov)
  • PPG peptide nucleic acids that promote DNA guanine quadruplexes. (nih.gov)
  • Cyclopentane-peptide nucleic acids for qualitative, quantitative, and repetitive detection of nucleic acids. (nih.gov)
  • We are developing new types of peptide nucleic acids (PNAs) for use in detection of nucleic acids as well as for multivalent display at the nanometer scale. (nih.gov)
  • Delivery of therapeutic oligonucleotides with cell penetrating peptides. (ox.ac.uk)
  • Recent data on mechanisms and applications of transfection strategies by cell penetrating peptides (CPP) are summarized on the variety of different oligonucleotide cargoes including plasmid, antisense and siRNA oligonucleotides. (pharmaceuticsconference.com)
  • The artificial intelligence model generated 127 peptides that were predicted to have varying ability to penetrate the specialized cells that house melanin, to bind to melanin and to be nontoxic to the cells. (nih.gov)
  • This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis. (anaspec.com)
  • Introduction of PepFect and NickFect technologies for oligonucleotide transfection by transportan-based cellpenetrating peptides in vitro and in vivo is described. (pharmaceuticsconference.com)
  • 2016) Recent in vivo advances in cell-penetrating peptide-assisted drug delivery. (pharmaceuticsconference.com)
  • Previously, we developed a cell-penetrating near-infrared fluorescence (NIRF) probe based on an activatable strategy to detect apoptosis-associated caspase activity in vivo. (mcw.edu)
  • Activating Transcription Factor 5 (ATF5) is highly expressed in gliomas, and interference with its expression/function precipitates targeted glioma cell apoptosis in vitro and in vivo. (nih.gov)
  • In vivo, subcutaneously-administered Pen-d/n-ATF5-RP passed the blood brain barrier, entered normal brain and tumor cells, and then caused rapid selective tumor cell death. (nih.gov)
  • The C. elegans developmental fusogenEFF-1 mediates homotypic fusion in heterologous cells and in vivo. (nih.gov)
  • Using ligands specific for an integrin receptor, we have shown that the optimized γ-Lys-PNA multivalent scaffold improves biological activity of the ligand by two orders of magnitude in both cell-based and in vivo models of cancer metastasis. (nih.gov)
  • G protein-coupled receptors (GPCRs) initiate signaling cascades while ensconced in the cell membrane. (genengnews.com)
  • Given the closer proximity between endosomes and the nucleus, compared with the plasma membrane and nucleus, perhaps cells take advantage of the 3D spatial organization of cellular organelles and use a 'short cut' for efficient receptor signal transduction. (genengnews.com)
  • He can also see which structures remain stable in the bloodstream and aren't readily degraded by proteases, enzymes that break down unwelcome peptides, and which ones don't toxically damage the cell membrane. (nih.gov)
  • Cell-Penetrating Peptide Mediates Intracellular Membrane Passage of Human Papillomavirus L2 Protein to Trigger Retrograde Trafficking. (nih.gov)
  • In vitro Pen-d/n-ATF5-RP entered into glioma cells and triggered massive apoptosis. (nih.gov)
  • An improved cell-penetrating, caspase-activatable, near-infrared fluorescent peptide for apoptosis imaging. (mcw.edu)
  • This is a fluorescent (TAMRA)-labeled TAT peptide, Abs/Em=541/568 nm. (anaspec.com)
  • Using cell cytometry (FACS) and fluorimetry, we demonstrated in yeast the successful expression and translational regulation of a fusion of mRNA binding protein and fluorescent protein. (igem.org)
  • They're synthesized in the lab, allowing Wimley and team to tweak their chemical structures and hopefully create ones with therapeutic potential, particularly as smart-delivery systems to target cells with greater precision and deliver biological cargoes such as drugs [1]. (nih.gov)
  • The synthetic, cell penetrating hexapeptide PAF26 (RKKWFW) is antifungal at low micromolar concentrations and has been proposed as a model for cationic, cell -penetrating antifungal peptides . (bvsalud.org)
  • 1] Synthetic molecular evolution of hybrid cell penetrating peptides . (nih.gov)
  • P53 is a tumour suppressor protein that regulates the expression of a wide variety of genes involved in Apoptosis, Growth arrest, Inhibition of cell cycle progression, Differentiation and accelerated DNA repair or Senescence in response to Genotoxic or Cellular Stress. (cupidpeptides.com)
  • Mammalian cell biology is dynamic, but today's 'omic approaches require destruction of cells to access their molecular contents and cannot resolve the full richness of cellular diversity in situ . (nih.gov)
  • Efficient entry of cell-penetrating peptide nona-arginine into adherent cells involves a transient increase in intracellular calcium. (nih.gov)
  • Lim studies the development of novel cancer therapeutics (gene therapies, protein/peptide therapies). (utah.edu)
  • Computational Modeling of Stapled Peptides toward a Treatment Strategy for CML and Broader Implications in the Design of Lengthy Peptide Therapeutics. (utah.edu)
  • Selective inhibition of endosomal β2AR and Gαs signaling blunted nuclear ERK activity, MYC gene expression, and cell proliferation. (genengnews.com)
  • This probe consisted of a cell-penetrating Tat peptide conjugated to an effector recognition sequence (DEVD) that was flanked by a fluorophore-quencher pair (Alexa Fluor 647 and QSY 21). (mcw.edu)
  • Herein, we present biochemical analysis of a second generation probe, KcapQ, with a modified cell-penetrating peptide sequence (KKKRKV). (mcw.edu)
  • In this review, we will first discuss the historical development of various NVCVs and then will discuss functionalized NVCVs with linkers that provide stability, as well as respond to the cancer cell environment and with cancer cell receptor specific ligands to explicitly target them for improved siRNA efficacy. (nih.gov)
  • The first was centered on the BBB-penetrating trans-activator of transcription (Tat) peptide or the peptide T7, and the other on RNA aptamers targeted to glycoprotein gp160 from human immunodeficiency virus (HIV) or C-C chemokine receptor type 5 (CCR5), a HIV-1 coreceptor. (beilstein-journals.org)
  • Programmable multivalent display of receptor ligands using peptide nucleic acid nanoscaffolds. (nih.gov)
  • Wimley is working hard to change that, since peptides have shown promise as therapies against some microbes, dubbed "superbugs," that have developed resistance to multiple drugs and present a serious health threat, especially to people with weakened immune systems. (nih.gov)
  • This interaction causes p53 repression which, through differential target gene expression, determines cell fate is of major interest to Cancer therapy. (cupidpeptides.com)
  • Initially, we developed the technology to monitor changes in gene expression (genomics) in single cells. (nih.gov)
  • This allows us to monitor the activation of different transcription factors and the array of genes each one regulates to investigate how different signaling pathways interact in controlling gene expression in a single cell. (nih.gov)
  • Lipid nanoparticles (LNPs) constitute a facile and scalable approach for delivery of payloads to human cells. (beilstein-journals.org)
  • Paired with the ultra-potent antioxidant, this serum is packed with peptides and lactic acid that encourage and promote a faster cell-turnover and a more refined skin texture. (skinstore.com)
  • To overcome the limitations of traditional near-infrared imaging probes, researchers from the University of Illinois at Chicago have designed a new probe specifically designed to detect cancerous cells within breast tumor margins in real time during surgery. (nih.gov)
  • Our new probe, termed ICG-p28, can selectively illuminate breast cancer cells under near-infrared light and thereby facilitates the image-guided removal of cancerous tissue at the time of surgery. (nih.gov)
  • To do this, they created a breast cancer cell line that expresses a protein called iRFP, which fluoresces under near-infrared light. (nih.gov)
  • Protection of the mucus layer involves mucins and a number of regulatory peptides, such as intestinal trefoil factors (ITFs), which play critical rols in formation and stabilization of the barrier, enhancement of rapid intestinal repair ('restitution), modulation of mucosal differentiation processes, and modulation of the mucosal immune response. (nih.gov)
  • Basics and recent advances in peptide and protein drug delivery. (utah.edu)
  • Regression/eradication of gliomas in mice by a systemically-deliverable ATF5 dominant-negative peptide. (nih.gov)
  • Mitochondrially targeted p53 or DBD subdomain is superior to wild type p53 in ovarian cancer cells even with strong dominant negative mutant p53. (utah.edu)
  • 4) Neural precursor cells possess multiple p53-dependent apoptotic pathways . (cupidpeptides.com)
  • We have developed a novel nanopipette technology that can be used to monitor the molecular properties of single cells over time. (nih.gov)
  • 6). Analysis of apoptosis in HeLa cells treated with doxorubicin showed probe activation specific to apoptotic cells. (mcw.edu)
  • In a rat model of retinal neuronal excitotoxicity, intravitreal injection of N-methyl-d-aspartate (NMDA) induced apoptosis of retinal ganglion cells (RGCs). (mcw.edu)
  • Thus, KcapQ represents an improved effector caspase-activatable NIRF probe for enhanced noninvasive analysis of apoptosis in whole cells and live animals. (mcw.edu)
  • The enzyme called extracellular-signal-regulated kinase (ERK) regulates transcription of a number of genes involved in controlling cell growth. (genengnews.com)
  • Now, in addition to single-cell sequencing technology, we have integrated methods to monitor temporal changes in the phosphorylation and activation of transcription factors. (nih.gov)
  • The research community needs tools that can probe living cells in real tissues to produce high dimensional time-series data from cells of interest. (nih.gov)
  • Two functional motifs define the interaction, internalization and toxicity of the cell-penetrating antifungal peptide PAF26 on fungal cells. (bvsalud.org)
  • Significantly, cationic residues in PAF26 are important not only for the electrostatic attraction and interaction with the fungal cell but also for transport from the vacuole to the cytoplasm , which coincides with cell death . (bvsalud.org)
  • Electroporation and electrophoretic DNA transfer into cells: the effect of DNA interaction with electropores. (nih.gov)
  • However, around 20 percent of these surgeries require a second operation, generally because cancer cells are found within the tumor margins. (nih.gov)
  • Now, NIBIB-funded researchers are developing an imaging method that would allow surgeons to better identify cancerous cells in the tumor margins during surgery. (nih.gov)
  • This probe combines the FDA-approved dye ICG with a non-toxic, tumor-targeting, cell-penetrating peptide known as p28. (nih.gov)
  • Alunni A, Krecsmarik M, Bosco A, Galant S, Pan L, Moens CB, Bally-Cuif L. Notch3 signaling gates cell cycle entry and limits neural stem cell amplification in the adult pallium. (gene-tools.com)
  • We found that GPCR-mediated ERK signaling, upon activation at the endosomes, propagates into the nucleus, where it turns on important genes to control cell growth," Zhang explained. (genengnews.com)
  • When the cell is confronted with stress through DNA damage, Hypoxia, Cytokines, Metabolic changes, Viral infection or Oncogenes, however, p53 ubiquitylation is suppressed and p53 accumulates in the nucleus, where it is activated and stabilized by undergoing multiple covalent modifications including Phosphorylation and Acetylation (1-4). (cupidpeptides.com)
  • Inhibition of bcr-abl in human leukemic cells with a coiled-coil protein delivered by a leukemia-specific cell-penetrating Peptide. (utah.edu)
  • A chimeric p53 evades mutant p53 transdominant inhibition in cancer cells. (utah.edu)
  • Using the soup, Wimley can choose the rarer peptides (labeled with a unique color to make them stand out) that are able to cross membranes to gain access to the watery cytoplasm, as well as look for those that target specific compartments inside the cell, such as the nucleus. (nih.gov)
  • Mutualistic microbes, comprising over 10 trillion microbial cells, inhabit the human gastrointestinal (GI) tract and generate functional metabolites that regulate immunity and host metabolism ( O'Hara and Shanahan, 2006 ). (frontiersin.org)
  • The winners will share $400,000 in prizes awarded for the development of new tools and methods for predicting the behavior and function of a single cell in complex tissue - and how that reflects the health of the tissue. (nih.gov)
  • Phase 1 of the Follow that Cell Challenge sought novel robust methods for analysis of individual cells to detect and assess changes in cell behavior and function over time either as a result of natural state changes or when perturbed. (nih.gov)
  • Specific inhibitory ligands of SCARAs, such as fucoidin, polyinosinic acid, and dextran sulfate, totally inhibit the activity of PF14-oligonucleotide nanocomplexes in the HeLa pLuc705 splice-correction cell model, while nonspecific, chemically related molecules do not. (ox.ac.uk)
  • This powerful ingredient comes together with peptide-rich polyglutamic acid to prevent future moisture loss and a blend of plum and ice Willowherb, which rebalance the skin's natural oils while infusing it with antioxidants and other microbiome-strengthening nutrients. (travelandleisure.com)
  • Out of these 127 peptides, the model predicted that a peptide called HR97 had the highest success rate of binding. (nih.gov)
  • To address this problem the authors recently developed a neprilysin containing a brain-transport peptide that was able to reduce CNS Aβ and improve learning and memory in an APP Tg mouse model of AD. (nih.gov)
  • Small rice protein peptides penetrate to stimulate cell growth and collagen formation, resulting in more skin elasticity. (eltamd.com)
  • Our research group has previously reported that p28 preferentially enters into various human breast cancer cells and actually induces anti-proliferative effects," explained Tohru Yamada, Ph.D., an associate professor in the Department of Surgery at the University of Illinois College of Medicine and senior author of the study. (nih.gov)
  • Abu-Remaileh M, Gerson A, Farago M, Nathan G, Alkalay I, Zins Rousso S, Gur M, Fainsod A, Bergman Y. Oct-3/4 regulates stem cell identity and cell fate decisions by modulating Wnt/β-catenin signalling. (gene-tools.com)
  • Cell-surface phosphatidylserine regulates osteoclast precursor fusion. (nih.gov)
  • Live- cell imaging of GFP-labelled nuclei in A. fumigatus showed that transport of PAF26 from the vacuole to the cytoplasm was followed by nuclear breakdown and dissolution . (bvsalud.org)
  • These dsRNA-mediated processes are evolutionarily conserved and are thought to be involved in transposon silencing in various species, although evidence of a natural role in the majority of human cells is still scant. (nih.gov)
  • In an effort to target LNPs composed of an ionizable cationic lipid (DLin-MC3-DMA), cholesterol, the phospholipid 1,2-distearoyl- sn -glycero-3-phosphocholine (DSPC), and 1,2-dimyristoyl- rac -glycero-3-methoxypolyethylene glycol-2000 (DMG-PEG 2000) to particular cell types, as well as to generate LNPs that can cross the BBB, we developed and assessed two approaches. (beilstein-journals.org)
  • Wimley can then study the peptides further to see which types of cargo they can deliver to cells. (nih.gov)
  • The L1 major capsid protein of human papillomavirus type 11 recombinant virus-like particles interacts with heparin and cell-surface glycosaminoglycans on human keratinocytes. (nih.gov)
  • 9. The investigation of unique water-soluble heptamethine cyanine dye for use as NIR photosensitizer in photodynamic therapy of cancer cells. (nih.gov)
  • Scanning electron microscopy image of a breast cancer cell. (nih.gov)
  • This way, when the researchers establish their breast cancer models by injecting mice with this particular cell line, they can precisely visualize the exact shape and size of the breast tumors. (nih.gov)
  • Carol Lim, PhD, is Interim Chair and Professor in the Departments of Pharmaceutics and Pharmaceutical Chemistry at the University of Utah and a member of the Cell Response and Regulation Program at Huntsman Cancer Institute. (utah.edu)
  • To establish the utility of this multiplexed technology, we are employing it to study a critical biological question: How do cancer cells develop drug resistance? (nih.gov)
  • While the proposed studies focus on the use of our nanopipette technology to study human cancer cells in culture, the cell monitoring capabilities of the nanopipette allow it to be used for in situ analysis of single cells in tissue biopsies and slices. (nih.gov)