Peptides: Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.Caveolin 1: A tyrosine phosphoprotein that plays an essential role in CAVEOLAE formation. It binds CHOLESTEROL and is involved in LIPIDS transport, membrane traffic, and SIGNAL TRANSDUCTION.Caveolins: The main structural proteins of CAVEOLAE. Several distinct genes for caveolins have been identified.Caveolin 2: Caveolin 2 is a binding partner of CAVEOLIN 1. It undergoes tyrosine phosphorylation by C-SRC PROTEIN PP60 and plays a regulatory role in CAVEOLAE formation.Caveolae: Endocytic/exocytic CELL MEMBRANE STRUCTURES rich in glycosphingolipids, cholesterol, and lipid-anchored membrane proteins that function in ENDOCYTOSIS (potocytosis), transcytosis, and SIGNAL TRANSDUCTION. Caveolae assume various shapes from open pits to closed vesicles. Caveolar coats are composed of CAVEOLINS.Caveolin 3: A caveolin that is expressed exclusively in MUSCLE CELLS and is sufficient to form CAVEOLAE in SARCOLEMMA. Mutations in caveolin 3 are associated with multiple muscle diseases including DISTAL MYOPATHY and LIMB-GIRDLE MUSCULAR DYSTROPHY.Peptide Fragments: Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.GTP-Binding Protein alpha Subunits: The GTPase-containing subunits of heterotrimeric GTP-binding proteins. When dissociated from the heterotrimeric complex these subunits interact with a variety of second messenger systems. Hydrolysis of GTP by the inherent GTPase activity of the subunit causes it to revert to its inactive (heterotrimeric) form. The GTP-Binding protein alpha subunits are grouped into families according to the type of action they have on second messenger systems.Cell Cycle: The complex series of phenomena, occurring between the end of one CELL DIVISION and the end of the next, by which cellular material is duplicated and then divided between two daughter cells. The cell cycle includes INTERPHASE, which includes G0 PHASE; G1 PHASE; S PHASE; and G2 PHASE, and CELL DIVISION PHASE.Cell Aging: The decrease in the cell's ability to proliferate with the passing of time. Each cell is programmed for a certain number of cell divisions and at the end of that time proliferation halts. The cell enters a quiescent state after which it experiences CELL DEATH via the process of APOPTOSIS.Endocytosis: Cellular uptake of extracellular materials within membrane-limited vacuoles or microvesicles. ENDOSOMES play a central role in endocytosis.Search Engine: Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.Cell Membrane: The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.Fibroblasts: Connective tissue cells which secrete an extracellular matrix rich in collagen and other macromolecules.Electron Spin Resonance Spectroscopy: A technique applicable to the wide variety of substances which exhibit paramagnetism because of the magnetic moments of unpaired electrons. The spectra are useful for detection and identification, for determination of electron structure, for study of interactions between molecules, and for measurement of nuclear spins and moments. (From McGraw-Hill Encyclopedia of Science and Technology, 7th edition) Electron nuclear double resonance (ENDOR) spectroscopy is a variant of the technique which can give enhanced resolution. Electron spin resonance analysis can now be used in vivo, including imaging applications such as MAGNETIC RESONANCE IMAGING.Phosphoric Monoester Hydrolases: A group of hydrolases which catalyze the hydrolysis of monophosphoric esters with the production of one mole of orthophosphate. EC 3.1.3.Cell Movement: The movement of cells from one location to another. Distinguish from CYTOKINESIS which is the process of dividing the CYTOPLASM of a cell.Cell Polarity: Orientation of intracellular structures especially with respect to the apical and basolateral domains of the plasma membrane. Polarized cells must direct proteins from the Golgi apparatus to the appropriate domain since tight junctions prevent proteins from diffusing between the two domains.Vascular Endothelial Growth Factor A: The original member of the family of endothelial cell growth factors referred to as VASCULAR ENDOTHELIAL GROWTH FACTORS. Vascular endothelial growth factor-A was originally isolated from tumor cells and referred to as "tumor angiogenesis factor" and "vascular permeability factor". Although expressed at high levels in certain tumor-derived cells it is produced by a wide variety of cell types. In addition to stimulating vascular growth and vascular permeability it may play a role in stimulating VASODILATION via NITRIC OXIDE-dependent pathways. Alternative splicing of the mRNA for vascular endothelial growth factor A results in several isoforms of the protein being produced.Endothelial Cells: Highly specialized EPITHELIAL CELLS that line the HEART; BLOOD VESSELS; and lymph vessels, forming the ENDOTHELIUM. They are polygonal in shape and joined together by TIGHT JUNCTIONS. The tight junctions allow for variable permeability to specific macromolecules that are transported across the endothelial layer.Neovascularization, Physiologic: The development of new BLOOD VESSELS during the restoration of BLOOD CIRCULATION during the healing process.Apoptosis: One of the mechanisms by which CELL DEATH occurs (compare with NECROSIS and AUTOPHAGOCYTOSIS). Apoptosis is the mechanism responsible for the physiological deletion of cells and appears to be intrinsically programmed. It is characterized by distinctive morphologic changes in the nucleus and cytoplasm, chromatin cleavage at regularly spaced sites, and the endonucleolytic cleavage of genomic DNA; (DNA FRAGMENTATION); at internucleosomal sites. This mode of cell death serves as a balance to mitosis in regulating the size of animal tissues and in mediating pathologic processes associated with tumor growth.Annexin A5: A protein of the annexin family isolated from human PLACENTA and other tissues. It inhibits cytosolic PHOSPHOLIPASE A2, and displays anticoagulant activity.Cell Line, Tumor: A cell line derived from cultured tumor cells.P-Glycoprotein: A 170-kDa transmembrane glycoprotein from the superfamily of ATP-BINDING CASSETTE TRANSPORTERS. It serves as an ATP-dependent efflux pump for a variety of chemicals, including many ANTINEOPLASTIC AGENTS. Overexpression of this glycoprotein is associated with multidrug resistance (see DRUG RESISTANCE, MULTIPLE).Ovarian Neoplasms: Tumors or cancer of the OVARY. These neoplasms can be benign or malignant. They are classified according to the tissue of origin, such as the surface EPITHELIUM, the stromal endocrine cells, and the totipotent GERM CELLS.Blotting, Western: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.Focal Adhesions: An anchoring junction of the cell to a non-cellular substrate. It is composed of a specialized area of the plasma membrane where bundles of the ACTIN CYTOSKELETON terminate and attach to the transmembrane linkers, INTEGRINS, which in turn attach through their extracellular domains to EXTRACELLULAR MATRIX PROTEINS.Cell Adhesion: Adherence of cells to surfaces or to other cells.Actins: Filamentous proteins that are the main constituent of the thin filaments of muscle fibers. The filaments (known also as filamentous or F-actin) can be dissociated into their globular subunits; each subunit is composed of a single polypeptide 375 amino acids long. This is known as globular or G-actin. In conjunction with MYOSINS, actin is responsible for the contraction and relaxation of muscle.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Cell-Matrix Junctions: Specialized areas at the CELL MEMBRANE where a cell attaches to the EXTRACELLULAR MATRIX or other substratum.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Phosphorylation: The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.Retinal Neovascularization: Formation of new blood vessels originating from the retinal veins and extending along the inner (vitreal) surface of the retina.Corneal Neovascularization: New blood vessels originating from the corneal veins and extending from the limbus into the adjacent CORNEAL STROMA. Neovascularization in the superficial and/or deep corneal stroma is a sequel to numerous inflammatory diseases of the ocular anterior segment, such as TRACHOMA, viral interstitial KERATITIS, microbial KERATOCONJUNCTIVITIS, and the immune response elicited by CORNEAL TRANSPLANTATION.Choroidal Neovascularization: A pathological process consisting of the formation of new blood vessels in the CHOROID.Research Support as Topic: Financial support of research activities.Research: Critical and exhaustive investigation or experimentation, having for its aim the discovery of new facts and their correct interpretation, the revision of accepted conclusions, theories, or laws in the light of newly discovered facts, or the practical application of such new or revised conclusions, theories, or laws. (Webster, 3d ed)Neovascularization, Pathologic: A pathologic process consisting of the proliferation of blood vessels in abnormal tissues or in abnormal positions.Molluginaceae: A plant family of the order Caryophyllales, subclass Caryophyllidae, class Magnoliopsida. Some members contain triterpenoid saponins.Animal Rights: The moral and ethical bases of the protection of animals from cruelty and abuse. The rights are extended to domestic animals, laboratory animals, and wild animals.Consumer Advocacy: The promotion and support of consumers' rights and interests.Drug Industry: That segment of commercial enterprise devoted to the design, development, and manufacture of chemical products for use in the diagnosis and treatment of disease, disability, or other dysfunction, or to improve function.IndiaEndosomes: Cytoplasmic vesicles formed when COATED VESICLES shed their CLATHRIN coat. Endosomes internalize macromolecules bound by receptors on the cell surface.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Antibodies, Monoclonal: Antibodies produced by a single clone of cells.Antibody Specificity: The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.Neurosciences: The scientific disciplines concerned with the embryology, anatomy, physiology, biochemistry, pharmacology, etc., of the nervous system.Indian Ocean Islands: Numerous islands in the Indian Ocean situated east of Madagascar, north to the Arabian Sea and east to Sri Lanka. Included are COMOROS (republic), MADAGASCAR (republic), Maldives (republic), MAURITIUS (parliamentary democracy), Pemba (administered by Tanzania), REUNION (a department of France), and SEYCHELLES (republic).Gadiformes: An order of fish including the families Gadidae (cods), Macrouridae (grenadiers), and hakes. The large Gadidae family includes cod, haddock, whiting, and pollock.Tracheoesophageal Fistula: Abnormal passage between the ESOPHAGUS and the TRACHEA, acquired or congenital, often associated with ESOPHAGEAL ATRESIA.Attentional Blink: Temporary visual deficit or impaired visual processing occurring in a rapid serial visual presentation task. After a person identifies the first of two visual targets, the ability to detect the second target is impaired for the next few hundred milliseconds. This phenomenon is called attentional blink.Galliformes: An order of heavy-bodied, largely terrestrial BIRDS including pheasants, TURKEYS, grouse, QUAIL, and CHICKENS.

Tyrosine-phosphorylated caveolin-1: immunolocalization and molecular characterization. (1/121)

Caveolin-1 was discovered as a major substrate for v-Src, but the effect of its tyrosine phosphorylation has not been known. We generated a specific antibody (PY14) to caveolin-1 phosphorylated at tyrosine 14 and studied the significance of the modification. By Western blotting of lysates of v-Src-expressing cells, PY14 recognized not only a 22-kDa band (the position of nonphosphorylated caveolin-1) but bands at 23-24 and 25 kDa. Bands of slower mobility were diminished by dephosphorylation and were also observed for mutant caveolin-1 lacking tyrosine 14. By immunofluorescence microscopy, PY14 did not label normal cells but detected large dots in v-Src-expressing cells. Immunoelectron microscopy revealed that the dots corresponded to aggregated caveolae and/or vesicles of various sizes; besides, the label was observed in intramembrane particle-free areas in the plasma membrane, which appeared to have been formed by fusion of flattened caveolae. A positive reaction with PY14 was found in normal cells after vanadate or pervanadate treatment; it occurred mainly at 22 kDa by Western blotting and was not seen as large dots by immunofluorescence microscopy. Detergent solubility, oligomerization, and association with caveolin-2 were observed similarly for caveolin-1 in normal and v-Src-expressing cells. The results indicate that phosphorylation of caveolin-1 in v-Src-expressing cells occurs at multiple residues and induces flattening, aggregation, and fusion of caveolae and/or caveolae-derived vesicles.  (+info)

Sequence and detailed organization of the human caveolin-1 and -2 genes located near the D7S522 locus (7q31.1). Methylation of a CpG island in the 5' promoter region of the caveolin-1 gene in human breast cancer cell lines. (2/121)

The CA microsatellite repeat marker, D7S522, is located at the center of a approximately 1000 kb smallest common deleted region that is lost in many forms of human cancer. It has been proposed that a putative tumor suppressor gene lies in close proximity to D7S522, within this smallest common deleted region. However, the genes located in proximity to D7S522 have remained elusive. Recently, we identified five independent BAC clones (approximately 100-200 kb) containing D7S522 and the human genes encoding caveolins 1 and 2. Here, we present the detailed organization of the caveolin locus and its relationship to D7S522, as deduced using a shot-gun sequencing approach. We derived two adjacent contigs for a total coverage of approximately 250 kb. Analysis of these contigs reveals that D7S522 is located approximately 67 kb upstream of the caveolin-2 gene and that the caveolin-2 gene is located approximately 19 kb upstream of the caveolin-1 gene, providing for the first time a detailed genetic map of this region. Further sequence analysis reveals many interesting features of the caveolin genes; these include the intron-exon boundaries and several previously unrecognized CA repeats that lie within or in close proximity to the caveolin genes. The first and second exons of both caveolin genes are embedded within CpG islands. These results suggest that regulation of caveolin gene expression may be controlled, in part, by methylation of these CpG regions. In support of this notion, we show here that the CGs in the 5' promoter region of the caveolin-1 gene are functionally methylated in two human breast cancer cell lines (MCF7 and T-47D) that fail to express the caveolin-1 protein. In contrast, the same CGs in cultured normal human mammary epithelial cells (NHMECs) are non-methylated and these cells express high levels of the caveolin-1 protein. Comparison of the human locus with the same locus in the pufferfish Fugu rubripes reveals that the overall organization of the caveolin-1/-2 locus is conserved from pufferfish to man. In conclusion, our current studies provide a systematic basis for diagnostically evaluating the potential deletion, mutation, or methylation of the caveolin genes in a variety of human tumors.  (+info)

The membrane-spanning domains of caveolins-1 and -2 mediate the formation of caveolin hetero-oligomers. Implications for the assembly of caveolae membranes in vivo. (3/121)

The mammalian caveolin gene family consists of caveolins-1, -2, and -3. The expression of caveolin-3 is muscle-specific. In contrast, caveolins-1 and -2 are co-expressed, and they form a hetero-oligomeric complex in many cell types, with particularly high levels in adipocytes, endothelial cells, and fibroblasts. These caveolin hetero-oligomers are thought to represent the functional assembly units that drive caveolae formation in vivo. Here, we investigate the mechanism by which caveolins-1 and -2 form hetero-oligomers. We reconstituted this reciprocal interaction in vivo and in vitro using a variety of complementary approaches, including the generation of glutathione S-transferase fusion proteins and synthetic peptides. Taken together, our results indicate that the membrane-spanning domains of both caveolins-1 and -2 play a critical role in mediating their ability to interact with each other. This is the first demonstration that these unusual membrane-spanning regions found in the caveolin family play a specific role in protein-protein interactions.  (+info)

Vimentin-dependent utilization of LDL-cholesterol in human adrenal tumor cells is not associated with the level of expression of apoE, sterol carrier protein-2, or caveolin. (4/121)

SW-13 adrenal tumor cells that lack detectable intermediate filaments (IF-free) exhibit an impaired capacity to esterify lipoprotein-derived cholesterol compared with cells that contain vimentin filaments. IF-free cells were found to synthesize and secrete significant amounts of apoE, while apoE secretion was nearly undetectable in cell lines that spontaneously express vimentin. However, stable transfectants that express a mouse vimentin cDNA exhibited elevated levels of cholesterol esterification and apoE secretion compared with untransfected IF-free cells, indicating that apoE secretion is not directly related to the capacity of these cells to esterify cholesterol. Some of the cell lines that differed in the level of apoE synthesis and secretion had similar levels of apoE mRNA, suggesting that the differences in expression involve a post-transcriptional mechanism. Treatment of these cells with forskolin and IBMX, 8br-cAMP, or TPA had no effect on apoE secretion. The level of sterol carrier protein-2 (SCP(2)) synthesis and the distribution of SCP(2) between membrane and soluble cellular fractions was not observably different in cells that contained or lacked vimentin. SW-13 cell lines contained little or no detectable caveolin-1 or caveolin-2. These studies demonstrate that the difference in the capacity of these adrenal tumor cells that contain or lack vimentin filaments to esterify low density lipoprotein-cholesterol is not obviously associated with the level of expression or distribution of apoE, SCP(2), or caveolins.  (+info)

Caveolin-2 localizes to the golgi complex but redistributes to plasma membrane, caveolae, and rafts when co-expressed with caveolin-1. (5/121)

We have characterized comparatively the subcellular distributions of caveolins-1 and -2, their interactions and their roles in caveolar formation in polarized epithelial cells. In Fischer rat thyroid (FRT) cells, which express low levels of caveolin-2 and no caveolin-1, caveolin-2 localizes exclusively to the Golgi complex but is partially redistributed to the plasma membrane upon co-expression of caveolin-1 by transfection or by adenovirus-mediated transduction. In Madin-Darby canine kidney (MDCK) cells, which constitutively express both caveolin-1 and -2, caveolin-2 localized to both the Golgi complex and to the plasma membrane, where it co-distributed with caveolin-1 in flat patches and in caveolae. In FRT cells, endogenous or overexpressed caveolin-2 did not associate with low density Triton insoluble membranes that floated in sucrose density gradients but was recruited to these membranes when co-expressed together with caveolin-1. In MDCK cells, both caveolin-1 and caveolin-2 associated with low density Triton-insoluble membranes. In FRT cells, transfection of caveolin-1 promoted the assembly of plasma membrane caveolae that localized preferentially (over 99%) to the basolateral surface, like constitutive caveolae of MDCK cells. In contrast, as expected from its intracellular distribution, endogenous or overexpressed caveolin-2 did not promote the assembly of caveolae; rather, it appeared to promote the assembly of intracellular vesicles in the peri-Golgi area. The data reported here demonstrate that caveolin-1 and -2 have different and complementary subcellular localizations and functional properties in polarized epithelial cells and suggest that the two proteins co-operate to carry out specific as yet unknown tasks between the Golgi complex and the cell surface.  (+info)

Expression of caveolin-1 is required for the transport of caveolin-2 to the plasma membrane. Retention of caveolin-2 at the level of the golgi complex. (6/121)

Caveolins-1 and -2 are normally co-expressed, and they form a hetero-oligomeric complex in many cell types. These caveolin hetero-oligomers are thought to represent the assembly units that drive caveolae formation in vivo. However, the functional significance of the interaction between caveolins-1 and -2 remains unknown. Here, we show that caveolin-1 co-expression is required for the transport of caveolin-2 from the Golgi complex to the plasma membrane. We identified a human erythroleukemic cell line, K562, that expresses caveolin-2 but fails to express detectable levels of caveolin-1. This allowed us to stringently assess the effects of recombinant caveolin-1 expression on the behavior of endogenous caveolin-2. We show that expression of caveolin-1 in K562 cells is sufficient to reconstitute the de novo formation of caveolae in these cells. In addition, recombinant expression of caveolin-1 allows caveolin-2 to form high molecular mass oligomers that are targeted to caveolae-enriched membrane fractions. In striking contrast, in the absence of caveolin-1 expression, caveolin-2 forms low molecular mass oligomers that are retained at the level of the Golgi complex. Interestingly, we also show that expression of caveolin-1 in K562 cells dramatically up-regulates the expression of endogenous caveolin-2. Northern blot analysis reveals that caveolin-2 mRNA levels remain constant under these conditions, suggesting that the expression of caveolin-1 stabilizes the caveolin-2 protein. Conversely, transient expression of caveolin-2 in CHO cells is sufficient to up-regulate endogenous caveolin-1 expression. Thus, the formation of a hetero-oligomeric complex between caveolins-1 and -2 stabilizes the caveolin-2 protein product and allows caveolin-2 to be transported from the Golgi complex to the plasma membrane.  (+info)

Caveolin-1 inhibits epidermal growth factor-stimulated lamellipod extension and cell migration in metastatic mammary adenocarcinoma cells (MTLn3). Transformation suppressor effects of adenovirus-mediated gene delivery of caveolin-1. (7/121)

Caveolin-1 is a principal component of caveolae membranes that may function as a transformation suppressor. For example, the human caveolin-1 gene is localized to a suspected tumor suppressor locus (D7S522; 7q31.1) that is deleted in human cancers, including mammary carcinomas. However, little is known about the role of caveolins in regulating cell movement, a critical parameter in determining metastatic potential. Here, we examine the role of caveolin-1 in cell movement. For this purpose, we employed an established cellular model, MTLn3, a metastatic rat mammary adenocarcinoma cell line. In this system, epidermal growth factor (EGF) stimulation induces rapid lamellipod extension and cell migration. Interestingly, we find that MTLn3 cells fail to express detectable levels of endogenous caveolin-1. To restore caveolin-1 expression in MTLn3 cells efficiently, we employed an inducible adenoviral gene delivery system to achieve tightly controlled expression of caveolin-1. We show here that caveolin-1 expression in MTLn3 cells inhibits EGF-stimulated lamellipod extension and cell migration and blocks their anchorage-independent growth. Under these conditions, EGF-induced activation of the p42/44 mitogen-activated protein kinase cascade is also blunted. Our results suggest that caveolin-1 expression in motile MTLn3 cells induces a non-motile phenotype.  (+info)

A molecular dissection of caveolin-1 membrane attachment and oligomerization. Two separate regions of the caveolin-1 C-terminal domain mediate membrane binding and oligomer/oligomer interactions in vivo. (8/121)

Caveolins form interlocking networks on the cytoplasmic face of caveolae. The cytoplasmically directed N and C termini of caveolins are separated by a central hydrophobic segment, which is believed to form a hairpin within the membrane. Here, we report that the caveolin scaffolding domain (CSD, residues 82-101), and the C terminus (residues 135-178) of caveolin-1 are each sufficient to anchor green fluorescent protein (GFP) to membranes in vivo. We also show that the first 16 residues of the C terminus (i.e. residues 135-150) are necessary and sufficient to attach GFP to membranes. When fused to the caveolin-1 C terminus, GFP co-localizes with two trans-Golgi markers and is excluded from caveolae. In contrast, the CSD targets GFP to caveolae, albeit less efficiently than full-length caveolin-1. Thus, caveolin-1 contains at least two membrane attachment signals: the CSD, dictating caveolar localization, and the C terminus, driving trans-Golgi localization. Additionally, we find that caveolin-1 oligomer/oligomer interactions require the distal third of the caveolin-1 C terminus. Thus, the caveolin-1 C-terminal domain has two separate functions: (i) membrane attachment (proximal third) and (ii) protein/protein interactions (distal third).  (+info)

*RAS p21 protein activator 1

Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer ... Lee H, Park DS, Wang XB, Scherer PE, Schwartz PE, Lisanti MP (September 2002). "Src-induced phosphorylation of caveolin-2 on ... 19 (2): 177-87. doi:10.1038/sj.onc.1203304. PMID 10644995. Hock B, Böhme B, Karn T, Feller S, Rübsamen-Waigmann H, Strebhardt K ... 183 (1-2): 113-21. doi:10.1016/s0303-7207(01)00587-1. PMID 11604231. Jabado N, Jauliac S, Pallier A, Bernard F, Fischer A, ...

*Inflammatory breast cancer

Caveolin is paradoxically tumour promoting. NF-κB pathway activation overexpression may contribute to the inflammatory ... caveolin-1 and -2 are overexpressed and may contribute to tumour cell motility[13] ... RhoC GTPase is overexpressed, possibly related to overexpression (hypomethylation) of caveolin-1 and -2. ... "Overexpression of caveolin-1 and -2 in cell lines and in human samples of inflammatory breast cancer". Breast Cancer Research ...

*SCP2

... has been shown to interact with Caveolin 1 and peroxisomal receptor PEX5. GRCh38: Ensembl release 89: ENSG00000116171 - ... 3 (2): 341-6. doi:10.1093/hmg/3.2.341. PMID 8004106. Seedorf U, Brysch P, Engel T, et al. (1994). "Sterol carrier protein X is ... 24 (2): 370-4. doi:10.1006/geno.1994.1630. PMID 7698762. Woodford JK, Colles SM, Myers-Payne S, et al. (1995). "Sterol carrier ... 1432 (2): 265-74. doi:10.1016/S0167-4838(99)00114-4. PMID 10407148. Kimura H, Fujii H, Suzuki S, et al. (1999). "Lipid-binding ...

*Gene silencing

... from invading murine lung epithelial cells by knocking down the caveolin-2 (CAV2) gene. Thus, though bacteria cannot be ... "Pseudomonas invasion of type I pneumocytes is dependent on the expression and phosphorylation of caveolin-2". The Journal of ... 7 (1&2): 41-46. Ferreira, S. A.; Pitz, K. Y.; Manshardt, R.; Zee, F.; Fitch, M.; Gonsalves, D. (2002). "Virus Coat Protein ... 313 (2): 514-24. PMID 12954218. doi:10.1016/s0042-6822(03)00341-6. Fan Q, Wei C, Xia M, Jiang X (January 2013). "Inhibition of ...

*Triple-negative breast cancer

Many proteins such as Caveolin 1/2, Survivin are researched as possible classification or prognostic factors. TNBCs have been ...

*JPH2

Junctophilin 2, also known as JPH2, is a protein which in humans is encoded by the JPH2 gene. Alternative splicing has been ... 2 (1): 47-53. doi:10.1038/nmeth726. PMID 15782160. Olsen JV, Blagoev B, Gnad F, et al. (2006). "Global, in vivo, and site- ... 2005). "Junctophilin type 2 is associated with caveolin-3 and is down-regulated in the hypertrophic and dilated ... 2007). "Mutations in JPH2-encoded junctophilin-2 associated with hypertrophic cardiomyopathy in humans". J Mol Cell Cardiol. 42 ...

*Tyrosine phosphorylation

One of these cases is tyrosine phosphorylation of caveolin 2 (Cav-2) that negatively regulates the anti-proliferative function ... 2012). "N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta ... 15 (2): 787-800. doi:10.1091/mbc.E03-09-0689. PMC 329393 . PMID 14657239. Lin M, Lee YH, Xu W, Baker MA, Aitken RJ (2006). " ... 116 (2): 191-203. doi:10.1016/s0092-8674(03)01077-8. PMID 14744431. Alonso A, Sasin J, Bottini N, Friedberg I, Friedberg I, ...

*Rocky Mountain spotted fever

Clathrin and Caveolin 2-Dependent Manner". Cellular Microbiology. 11 (4): 629-644. doi:10.1111/j.1462-5822.2008.01279.x. Walker ... 60 (2): 455-70. doi:10.1016/j.pcl.2012.12.001. PMID 23481111. Gammons M, Salam G (August 2002). "Tick removal". Am Fam ... 6 (2): e00323-15. doi:10.1128/mBio.00323-15. PMC 4453529 . PMID 25827414. Rocky Mountain spotted fever in Mexico: past, present ...

*Prostaglandin-endoperoxide synthase 2

PTGS2 has been shown to interact with Caveolin 1. Arachidonic acid Cyclooxygenase Cyclooxygenase 1 NSAID Discovery and ... PGHS-2 is a sequence homodimer. Each monomer of the enzyme has a peroxidase and a PTGS (COX) active site. The PTGS (COX) ... Wang Q1, He Y, Shen Y, Zhang Q, Chen D, Zuo C, Qin J, Wang H, Wang J, Yu Y. (2014). "Vitamin D inhibits COX-2 expression and ... 88 (1-2): 24-30. doi:10.1016/j.lfs.2010.10.017. PMC 3046773 . PMID 21035466. Wang D, Patel VV, Ricciotti E, Zhou R, Levin MD, ...

*Prostaglandin-endoperoxide synthase 2

PTGS2 has been shown to interact with Caveolin 1.[35]. See also[edit]. *Arachidonic acid ... 23 (1-2): 63-75. PMID 15000150. doi:10.1023/A:1025863029529.. *. Jain S, Khuri FR, Shin DM (2004). "Prevention of head and neck ... PGHS-2 is a sequence homodimer. Each monomer of the enzyme has a peroxidase and a PTGS (COX) active site. The PTGS (COX) ... Prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (The HUGO official symbol is PTGS2; HGNC ...

*TGF beta receptor 2

Razani B, Zhang XL, Bitzer M, von Gersdorff G, Böttinger EP, Lisanti MP (Mar 2001). "Caveolin-1 regulates transforming growth ... TGF beta receptor 2 has been shown to interact with: AP2B1, Cyclin B2, Endoglin, Heat shock protein 90kDa alpha (cytosolic), ... 274 (2): 584-94. doi:10.1074/jbc.274.2.584. PMID 9872992. Guerrero-Esteo M, Sanchez-Elsner T, Letamendia A, Bernabeu C (Aug ... member A1 STRAP, TGF beta receptor 1, and Transforming growth factor, beta 3. TGF beta receptor 2 consists of a C-terminal ...

*Lipid droplet

Martin, S; Parton, RG (Apr 2005). "Caveolin, cholesterol, and lipid bodies". Seminars in cell & developmental biology. 16 (2): ... These include perilipin 1 (PLIN1), perilipin 2 (PLIN2/ ADRP), perilipin 3 (PLIN3/ TIP47), perilipin 4 (PLIN4/ S3-12) and ... "Perilipin 2 improves insulin sensitivity in skeletal muscle despite elevated intramuscular lipid levels". Diabetes. 61: 2679- ...

*List of MeSH codes (D12.644)

... caveolin 1 MeSH D12.644.360.024.272 --- caveolin 2 MeSH D12.644.360.024.280 --- cortactin MeSH D12.644.360.024.295 --- crk- ... map kinase kinase 2 MeSH D12.644.360.440.300 --- map kinase kinase 3 MeSH D12.644.360.440.400 --- map kinase kinase 4 MeSH ... bcl-2 homologous antagonist-killer protein MeSH D12.644.360.075.718.937 --- bcl-x protein MeSH D12.644.360.075.718.968 --- bh3 ... leucine-2-alanine MeSH D12.644.468.281.381 --- enkephalin, methionine MeSH D12.644.468.281.381.300 --- d-ala(2),mephe(4),met(0 ...

*Caveolin

The caveolin gene family has three members in vertebrates: CAV1, CAV2, and CAV3, coding for the proteins caveolin-1, caveolin-2 ... There are two isoforms of caveolin-1: caveolin-1α and caveolin-1β, the latter lacking a part of the N-terminus. ... Caveolin-1 has also been shown to play a role in the integrin signaling. The tyrosine phosphorylated form of caveolin-1 ... Genetically engineered mice that lack caveolin-1 and caveolin-2 are viable and fertile, showing that neither the caveolins nor ...

*Antagomir

It has been shown that Caveolin-1-deficient mice show insulin resistance. MicroRNA-103/107 inhibition in Caveolin-1-deficient ... Thus, micro103/107 may affect insulin sensitivity by targeting Caveolin-1. The blockmir CD5-2 has been shown to inhibit the ... 27 (12 Suppl 2): 1893-902. PMID 723640. Young, J. A.; Ting, K. K.; Li, J.; Moller, T.; Dunn, L.; Lu, Y.; Lay, A. J.; Moses, J ... Usually, antagomirs have some sort of modification, such as 2'-methoxy groups and phosphorothioates, to make them more ...

*PLD2

Czarny M, Fiucci G, Lavie Y, Banno Y, Nozawa Y, Liscovitch M (2000). "Phospholipase D2: functional interaction with caveolin in ... Zheng X, Bollinger Bollag W (December 2003). "Aquaporin 3 colocates with phospholipase d2 in caveolin-rich membrane ... functional interaction with caveolin in low-density membrane microdomains". FEBS Lett. 467 (2-3): 326-32. doi:10.1016/s0014- ... Caveolin 1, Glyceraldehyde 3-phosphate dehydrogenase, PLCG1, PRKCD, Src, and Wiskott-Aldrich syndrome protein. N-(2-(1-(3- ...

*Caveolin 1

... within caveolin-1 molecule. Molecules that interact with caveolin-1 contain caveolin-binding motifs (CBM). Caveolin GRCh38: ... "Human caveolin-1 and caveolin-2 are closely linked genes colocalized with WI-5336 in a region of 7q31 frequently deleted in ... caveolin. Caveolin binding negatively regulates the auto-activation of Src tyrosine kinases". J. Biol. Chem. 271 (46): 29182-90 ... Caveolin-1 is a protein that in humans is encoded by the CAV1 gene. The scaffolding protein encoded by this gene is the main ...

*Caveolin 3

Caveolin-3 is one of three isoforms of the protein caveolin. Caveolin-3 is concentrated in the caveolae of myocytes, and ... Knockout of caveolin-3 genes are sufficient to induce these manifestations. Similarly, dominant-negative genotypes for caveolin ... Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting ... There are many proteins that associate with caveolin-3, including ion channels and exchangers. In cardiac myocytes, caveolin-3 ...

*Caveolin 2

Fra AM, Mastroianni N, Mancini M, Pasqualetto E, Sitia R (May 1999). "Human caveolin-1 and caveolin-2 are closely linked genes ... "Genomic organization and transcriptional analysis of the human genes coding for caveolin-1 and caveolin-2". Gene. 243 (1-2): 75 ... Caveolin-2 is a protein that in humans is encoded by the CAV2 gene. The protein encoded by this gene is a major component of ... 1995). "VIP21/caveolin is a cholesterol-binding protein". Proc. Natl. Acad. Sci. U.S.A. 92 (22): 10339-43. doi:10.1073/pnas. ...

*T-cadherin

1998). "T-cadherin and signal-transducing molecules co-localize in caveolin-rich membrane domains of vascular smooth muscle ... 2 (4): 261-70. doi:10.1091/mbc.2.4.261. PMC 361775 . PMID 2059658. Tanihara H, Sano K, Heimark RL, et al. (1995). "Cloning of ... 429 (2): 207-10. doi:10.1016/S0014-5793(98)00598-5. PMID 9650591. Sato M, Mori Y, Sakurada A, et al. (1998). "The H-cadherin ( ... 463 (1-2): 29-34. doi:10.1016/S0014-5793(99)01594-X. PMID 10601632. Takeuchi T, Misaki A, Liang SB, et al. (2000). "Expression ...

*PDGFRB

... has been shown to interact with: CRK, Caveolin 1, Grb2, NCK1, NCK2, PDGFR-α, PTPN11, RAS p21 protein activator 1, SHC1 ... Yamamoto M, Toya Y, Jensen RA, Ishikawa Y (March 1999). "Caveolin is an inhibitor of platelet-derived growth factor receptor ... 152 (2): 325-34. doi:10.1083/jcb.152.2.325. PMC 2199605 . PMID 11266449. Lechleider RJ, Sugimoto S, Bennett AM, Kashishian AS, ... 103 (2): 157-8. doi:10.1172/JCI6127. PMC 407889 . PMID 9916126. Olson LE, Soriano P (2011). "PDGFRβ signaling regulates mural ...

*PDGFRA

Yamamoto, M; Toya Y; Jensen R A; Ishikawa Y (March 1999). "Caveolin is an inhibitor of platelet-derived growth factor receptor ... B enzm: 1.1/2/3/4/5/6/7/8/10/11/13/14/15-18, 2.1/2/3/4/5/6/7/8, 2.7.10, 2.7.11-12, 3.1/2/3/4/5/6/7, 3.1.3.48, 3.4.21/22/23/24, ... CD201 • CD202b • CD204 • CD205 • CD206 • CD207 • CD208 • CD209 • CDw210 (a, b) • CD212 • CD213a (1, 2) • CD217 • CD218 (a, b) ... PDGFRA formira interakcije sa PDGFRB,[2][3] PLCG1,[4] Natrijum-vodonik antiporter 3 regulator 1,[5] Cbl gene,[6] CRK,[7][8] ...

*FZD5

Yamamoto H, Komekado H, Kikuchi A (2006). "Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation ... 328 (2): 533-9. doi:10.1016/j.bbrc.2005.01.009. PMID 15694380. Hillier LW, Graves TA, Fulton RS, et al. (2005). "Generation and ... 11 (2): 213-23. doi:10.1016/j.devcel.2006.07.003. PMID 16890161. Katoh Y, Katoh M (2007). "Conserved POU-binding site linked to ... 25 (2): 81-90. doi:10.1080/13816810490514270. PMID 15370539. Holmen SL, Robertson SA, Zylstra CR, Williams BO (2005). "Wnt- ...

*WNT3

Yamamoto H, Komekado H, Kikuchi A (2006). "Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation ... 64 (2): 231. doi:10.1016/0092-8674(91)90633-A. PMID 1846319. Smolich BD, McMahon JA, McMahon AP, Papkoff J (1994). "Wnt family ... 20 (2): 373-7. doi:10.3892/ijo.20.2.373. PMID 11788904. Strausberg RL, Feingold EA, Grouse LH, et al. (2003). "Generation and ... 17 (3): 790-2. doi:10.1006/geno.1993.1412. PMID 8244403. "Entrez Gene: WNT3 wingless-type MMTV integration site family, member ...

*PFKM

Scherer PE, Lisanti MP (Aug 1997). "Association of phosphofructokinase-M with caveolin-3 in differentiated skeletal myotubes. ... 103 (2): 169-73. doi:10.1016/0009-8981(80)90210-7. PMID 6445244. Musumeci O, Bruno C, Mongini T, Rodolico C, Aguennouz M, Barca ... 104 (2): 277-82. doi:10.1016/0378-1119(91)90262-A. PMID 1833270. Sharma PM, Reddy GR, Babior BM, McLachlan A (Jun 1990). " ... Interestingly, even though PFKM functions to drive glycolysis, its overexpression has been associated with type 2 diabetes and ...

*TFG (gene)

Wary KK, Mariotti A, Zurzolo C, Giancotti FG (Sep 1998). "A requirement for caveolin-1 and associated kinase Fyn in integrin ... 348 (2): 381-7. doi:10.1042/0264-6021:3480381. PMC 1221077 . PMID 10816433. Schaak S, Cussac D, Cayla C, Devedjian JC, Guyot R ... 47 (2): 242-50. doi:10.1136/gut.47.2.242. PMC 1728001 . PMID 10896916. Imokawa G, Kobayasi T, Miyagishi M (Oct 2000). " ... Paris H, Denis C (Aug 2000). "Alpha(2) adrenoceptors regulate proliferation of human intestinal epithelial cells". Gut. ...

*Muscle spindle

2011). "Chapter 2 - Overview of the Microstructure of the Nervous System". Gray's Clinical Neuroanatomy: The Anatomic Basis for ... 2) Fusimotor set: Gamma motoneurons are activated according to the novelty or difficulty of a task. Whereas static gamma ... Secondary type II sensory fibers (medium diameter) end adjacent to the central regions of the static bag and chain fibres.[2] ... The static axons innervate the chain or static bag2 fibers. They increase the firing rate of Ia and II afferents at a given ...

*Androgen receptor

Lu ML, Schneider MC, Zheng Y, Zhang X, Richie JP (April 2001). "Caveolin-1 interacts with androgen receptor. A positive ... Caveolin 1, CDK9, COX5B, CREB-binding protein, Cyclin D1, Cyclin-dependent kinase 7, DACH1, Death associated protein 6, L-DOPA ... 277 (2): 1240-8. doi:10.1074/jbc.M108855200. PMID 11707452. Hayes SA, Zarnegar M, Sharma M, Yang F, Peehl DM, ten Dijke P, Sun ... 13 (2): 670-82. doi:10.1091/mbc.01-10-0513. PMC 65658 . PMID 11854421. Sharma M, Li X, Wang Y, Zarnegar M, Huang CY, Palvimo JJ ...
Gentaur molecular products has all kinds of products like :search , Prospecbio \ Mouse Anti Human Caveolin-1 CAV1 \ ant-027 for more molecular products just contact us
SWISS-MODEL is a fully automated protein structure homology-modelling server. The purpose of this server is to make protein modelling accessible to all life science researchers worldwide.
In the last 15 years, the incidence of Type 2 diabetes associated with cardiovascular disease has more than doubled. The underlying pathology includes both endo...
www.MOLUNA.de Caveolins in Cancer Pathogenesis, Prevention and Therapy [4196990] - Caveolins play an important role in the pathogenesis of multiple cancers. This volume focuses mainly on the importance of Caveolin-1 in breast, prostate, lung, skin, colon, pancreatic and brain cancers. It also studies the role of Caveolin-3 in breast cancer.Caveolins are important structural proteins of Caveolae, small invaginations of the
Caveolin-3 is a protein that in humans is encoded by the CAV3 gene. Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), HyperCKemia, distal myopathy or rippling muscle disease (RMD). Other mutations in Caveolin causes Long QT Syndrome or familial hypertrophic cardiomyopathy, although the role of Cav3 in Long QT syndrome has recently been disputed. Caveolin ...
This download caveolins was been, and received on the treatment by Sir Henry Irving in 1875. Harold was in 1876, The Cup in 1881( at the Lyceum), The Promise of May( at the Globe) in 1882, Becket in 1884, with The Foresters in 1892. The download is one from which I give, not right of secure single-player of the purchase and of of rendering for the analysis.
Caveolae. Caveolae were described in the fifties of the last century by P. Palade after observing animal tissues at transmission electron microscopy. They are small invaginations (45-80 nm) of the plasma membrane that can be observed in most of the eukaryotic cells. It was suggested that most of the caveolae become vesicles (but see below). Caveolae are abundant in endothelial cells, muscle cells and adipocytes. The membrane of the caveolae contains caveolin, as well as other integral proteins linked to glycosylphosphatidylinositol, many sphingolipids (sphingomyelin and glycosphingolipids), and is enriched in cholesterol. The presence of caveolin in a cell is enought to form caveolae. There are around 100 to 200 caveolin molecules in one caveola and there are different types of caveolin in one caveola. Caveolin 1 is expressed in smooth muscle cells and in most of the non muscle cells, and it is necessary for caveolae formation in these cells. Caveolin 2, which can be expressed in the same cells ...
Angiogenic growth factor-induced endothelial cell migration is a key step towards tumor angiogenesis. When cells are migrating, caveolin-1, the principle protein component of caveolae, is excluded from the leading edge and polarized to the cell rear. The migration-stimulated caveolin rear translocation appears to play an important role in endothelial cell polarization and directional movement. In
Expression of caveolins in RMS tumours. Double immunostain showing that in skeletal muscle Cav-1 and Cav-3 mark satellite cells and the plasmalemma of myofibres
Caveolin 1 Polyclonal Antibody from Invitrogen for Immunohistochemistry (Paraffin) applications. This antibody reacts with Human samples. Supplied as 50 ug purified antibody (1 mg/ml) in PBS with | 0.1% sodium azide.
Caveolae, Membrane, Endocytosis, Plasma, Plasma Membrane, Senescence, Binding Protein, Caveolin-1, Cellular Senescence, Fibroblasts, Insulin, Mutations, ATP, Mutation, and Blood
Caveolin-2兔单克隆抗体[EPR2220(3)](ab124883)可与人样本反应并经WB, Flow Cyt实验严格验证。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
Caveolins act as scaffold proteins in multiprotein complexes and have been implicated in signaling by G protein-coupled receptors. Studies using knock-out mice suggest that beta(3)-adrenoceptor (beta(3)-AR) signaling is dependent on caveolin-1; however, it is not known whether caveolin-1 is associated with the beta(3)-AR or solely with downstream signaling proteins. We have addressed this question by examining the impact of membrane rafts and caveolin-1 on the differential signaling of mouse beta(3a)- and beta(3b)-AR isoforms that diverge at the distal C terminus. Only the beta(3b)-AR promotes pertussis toxin (PTX)-sensitive cAMP accumulation. When cells expressing the beta(3a)-AR were treated with filipin III to disrupt membrane rafts or transfected with caveolin-1 siRNA, the cyclic AMP response to the beta(3)-AR agonist CL316243 became PTX-sensitive, suggesting G alpha(i/o) coupling. The beta(3a)-AR C terminus, S (P-384) under bar PLNR (P-389) under bar DG (Y-392) under bar EGARP (P-398) under ...
This work establishes an impact of cavin‐1 on pressure regulation in the pulmonary circulation. Right ventricular systolic pressure was robustly increased compared to WT littermate controls and accompanied by an increased right ventricular mass and remodeling of airway‐associated blood vessels. Because PAH is a progressive disease and we used younger animals, one may predict a more full‐blown PAH phenotype with aging. Since expression of caveolin‐1 was partly maintained, cavin‐1‐knockout mice may constitute a more adequate model of heritable PAH due to mutations in caveolin‐1 than do caveolin‐1‐knockout mice. This is because the disease‐causing mutations cause a partial reduction of caveolin‐1 (Austin et al. 2012), contrasting with the situation in caveolin‐1‐knockout mice where the protein is completely lacking.. In agreement with our current findings, thicker alveolar septa, hypercellularity, and elevated pulmonary pressure have been reported in ...
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).
Buy our Caveolin-2 peptide. Ab4929 is a blocking peptide and has been validated in BL. Abcam provides free protocols, tips and expert support for WB and a 12…
Caveolin is the principal protein of caveolae and has been implicated in the pathogenesis of cerebral ischemia. To investigate whether changed expression of caveolins has a pivotal role in focal cerebral ischemia, we induced middle cerebral artery occlusion (MCAo)-reperfusion and examined expression of caveolins, inflammatory activation markers, and mediators of autophagic cell death. We also treated MCAo rats with forced exercise to determine its effects on neurological outcome. Particularly, spontaneously hypertensive rats (SHR) and normotensive Wistar-Kyoto (WKY) rats were used to compare the effects of hypertension on focal cerebral ischemia. All MCAo groups showed neurological deficiencies, motor dysfunction, and disruption of balancing ability; however, these pathological changes were more severe in SHR than WKY rats. Expression of caveolins was decreased in MCAo brain tissue, whereas the levels of iNOS and glial fibrillary acidic protein (GFAP) increased. Additionally, LC3-II and beclin-1 levels
This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008 ...
Caveolin-1 (Cav-1) is a 21?kDa protein enriched in caveolae and continues to be implicated in oncogenic cell transformation CHC tumorigenesis and metastasis. response to chemotherapy and radiation and tumor growth. We found Cav-1 is definitely overexpressed in human being Personal computer cell lines mouse models and human being pancreatic tumors and is associated with worse tumor grade and clinical results. In Personal computer cell lines disruption/depletion of caveolae/Cav-1 reduces proliferation colony formation and invasion. Radiation and chemotherapy up-regulate Cav-1 manifestation while Cav-1 depletion induces both chemosensitization and radiosensitization through modified apoptotic and DNA restoration signaling. and and transgene ("KPC mouse") (Fig. 1B). Cav-1 manifestation was also tested on a cells microarray of 110 individuals with pancreatic malignancy and obtained semi-quantitatively for low versus high CHC manifestation. While Cav-1 is definitely virtually absent in pancreatic ...
Polyclonal antibody for CAVEOLIN 1/CAV1 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. CAVEOLIN 1/CAV1 information: Molecular Weight: 20472 MW; Subcellular Localization: Golgi apparatus membrane; Peripheral
Proteins and other substances can cross the endothelial layer that lines a blood vessel via two routes. Caveolin-1 is essential for both, Siddiqui et al. show.. Researchers already knew that caveolin-1 was necessary for transcellular protein trafficking, in which macromolecules such as albumin enter an endothelial cell from the bloodstream and exit on the tissue side. Caveolae swallow these molecular travelers and bundle them into vesicles that wend through the cell. In an alternative pathway, known as the paracellular route, molecules slip between the cells of the endothelial layer, passing through the adherens junctions that fasten adjacent cells together. Previous work showed that adherens junctions become permeable in mice lacking caveolin-1, suggesting that the protein helps seal the junctions.. Siddiqui et al. dissected the molecular chain of events that connects caveolin-1 to adherens junction integrity. Loss of caveolin-1 activated the enzyme eNOS, which spawns nitric oxide (NO) that ...
where to get vector overexpressing caveolin-1? - posted in Molecular Cloning: Trying to overexpress caveolin-1 in human cancer cells...are there readymade products out there which already has cav-1 attached to a dependable promoter? If so, where should I look? Thanks in advance!
Background: Muscle-restricted coiled-coil protein (MURC)/cavin-4 is a novel member of the cavin family that regulates caveolae function. Caveolae formation and function are also regulated by caveolin-3 in cardiomyocytes (CMs). Overexpression of caveolin-3 induces cardiac protection, and loss of caveolin-3 causes progressive cardiomyopathy. Mutations in MURC have been identified in patients with dilated cardiomyopathy. However, the role of MURC as a caveolar component protein remains unknown.. Methods and Results: To assess the role of MURC in the development of heart failure, MURC-knockout (KO) and wild-type (WT) mice were subjected to pressure overload by transverse aortic constriction (TAC). After TAC, WT mice developed overt heart failure and eccentric cardiac hypertrophy, whereas MURC-KO mice showed preserved cardiac function accompanied by attenuated cardiac hypertrophy. We then focused on β-adrenergic receptor (AR) signaling, because MURC was colocalized and associated with β1-AR. ...
Summary is not available for the mouse gene. This summary is for the human ortholog.] The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010 ...
In biology, caveolae (Latin for "little caves"; singular, caveola), which are a special type of lipid raft, are small (50-100 nanometer) invaginations of the plasma membrane in many vertebrate cell types, especially in endothelial cells, adipocytes and embryonic notochord cells. They were originally discovered by E. Yamada in 1955. These flask-shaped structures are rich in proteins as well as lipids such as cholesterol and sphingolipids and have several functions in signal transduction. They are also believed to play a role in mechanoprotection, mechanosensation, endocytosis, oncogenesis, and the uptake of pathogenic bacteria and certain viruses. Formation and maintenance of caveolae was initially thought to be primarily due to caveolin, a 21 kD protein. There are three homologous genes of caveolin expressed in mammalian cells: Cav1, Cav2 and Cav3. These proteins have a common topology: cytoplasmic N-terminus with scaffolding domain, long hairpin transmembrane domain and cytoplasmic C-terminus. ...
Learn about Nashua CC RN program. You can enter nursing with either an associates degree or BSN. As a licensed vocational nurse (LVN), you may provide patient care under the supervision of a registered nurse (RN).
Nucleoside diphosphate kinase B (NME2) is ubiquitously expressed; it is an enzyme responsible for the synthesis of nucleoside triphosphates.. NME2 acts as a transcriptional activator, plays a role in T-cell (TCR) receptor activation and TCR-mediated calcium influx. It is also involved in caveolae formation.. ...
The scaffolding protein CAV1 is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to…
Cav-1 expression is negatively related with COL I expression in chronologically-aged human and mouse skinTo compare the age-dependent change of Cav-1 and COL I,
The plasma membrane is not uniform, but can be divided into different microdomains. Whereas some microdomains, such as clathrin-coated pits, are morphologically identifiable, others can be identified only upon colocalization with domain-specific marker molecules. Caveolae are microdomains originally identified morphologically as small noncoated invaginations of the plasma membrane. The formation of caveolae depends on expression of caveolin and, since the plasma membrane contains different noncoated invaginations, caveolae can be identified only by labeling for caveolin. Some confusion exists with respect to the relationship between caveolae and lipid rafts [see raft nomenclature ( Simons and Toomre, 2000)]. This is partly due to difficulties in isolating pure caveolae and to the various methods used for this purpose. Initially, subcellular fractionation upon Triton X-100 extraction at 4°C was used. Such fractionation allows the isolation of detergent-resistant membranes [DRMs; also called DIGs ...
This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3 end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. [provided by RefSeq, Nov 2009 ...
TY - JOUR. T1 - AMP-dependent kinase inhibits oxidative stress-induced caveolin-1 phosphorylation and endocytosis by suppressing the dissociation between c-Abl and Prdx1 proteins in endothelial cells. AU - Takeuchi, Kimio. AU - Morizane, Yuki. AU - Kamami-Levy, Cynthia. AU - Suzuki, Jun. AU - Kayama, Maki. AU - Cai, Wenyi. AU - Miller, Joan W.. AU - Vavvas, Demetrios G.. PY - 2013/7/12. Y1 - 2013/7/12. N2 - Caveolin-1 is the primary structural component of endothelial caveolae that is essential for transcellular trafficking of albumin and is also a critical scaffolding protein that regulates the activity of signaling molecules in caveolae. Phosphorylation of caveolin-1 plays a fundamental role in the mechanism of oxidant-induced vascular hyper permeability. However, the regulatory mechanism of caveolin-1 phosphorylation remains unclear. Here we identify a previously unexpected role for AMPKin inhibition of caveolin-1 phosphorylation under oxidative stress. A pharmacological activator of AMPK, ...
Shibata and colleagues have shown previously that the application of peptides derived from the Gαs sequence in inside-out macropatches enhanced isoproterenol-evoked sodium current (INa), attributable to an apparent increase in the number of functional channels.5,6⇓ In this issue of Circulation Research, Shibata and colleagues (Yarbrough et al8) report that the source of these new channels could be caveolae. Using antibodies directed against caveolin-3, the muscle-specific isoform of caveolin, these investigators were able to block the direct effect of isoproterenol on the Na+ channel (ie, the PKA-independent, Gαs membrane-delimited pathway). Importantly, this effect seems specific, given that antibodies directed against other caveolin isoforms did not affect isoproterenol activation of Na+ channel activity. Moreover, Yarbrough et al8 also documented, in cardiac myocytes, the apparent preferential enrichment into caveolar microdomains of Na+ channels and Gαs. Although these data led the ...
Caveolae are specialised forms of lipid rafts in the plasma membrane of most cells. They form dynamic assemblies of sphingolipids and cholesterol containing scaffolding domains with different affinities for proteins resulting in a variety of functions [1]. The constitutive Cav-1 protein is distributed ubiquitously, while Cav-2 is usually associated with Cav-1 [3, 28]. Although Cav-3 is thought to be "muscle specific" and is expressed in striated muscles [3, 28, 29], we and others have found that Cav-3 is not expressed within human ASM [6, 30]. Recent studies have established that ASM caveolae contain a number of proteins important to [Ca2+]i regulation (e.g. agonist receptors, Ca2+ influx channels, and force regulatory proteins such as RhoA). In canine ASM, it has been established that caveolar-enriched membrane fractions express Cav-1, L-type Ca2+ channels and plasma membrane Ca2+ ATPase, but not SR proteins such as IP3R or RyR channels [31].. In ASM of different species, in addition to Ca2+ ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Objectives Reduced caveolin-1 levels in lung fibroblasts from patients with scleroderma and the lungs of bleomycin-treated mice promote collagen overexpression and lung fibrosis. This study was undertaken to determine whether caveolin-1 is deficient in leucocytes from bleomycin-treated mice and patients with scleroderma and to examine the consequences of this deficiency and its reversal.. Methods Mice or cells received the caveolin-1 scaffolding domain (CSD) peptide to reverse the pathological effects of reduced caveolin-1 expression. In bleomycin-treated mice, the levels of caveolin-1 in leucocytes and the effect of CSD peptide on leucocyte accumulation in lung tissue were examined. To validate the results in human disease and to identify caveolin-1-regulated molecular mechanisms, monocytes and neutrophils were isolated from patients with scleroderma and control subjects and caveolin-1, extracellular signal-regulated protein kinase (ERK), c-Jun N-terminal kinase (JNK), p38, CXC chemokine ...
At the European Molecular Biology Laboratory (EMBL) in Heidelberg, Professor Parton was mentored by Gareth Griffiths, where he honed his skills in electron microscopy while collaborating with other groups throughout the institute including Jean Gruenberg and Marino Zerial. He has maintained these collaborations to this day, despite the groups now being spread around the globe.. Collaboration has been central to his career. In a collaborative project with the laboratory of Kai Simons, he observed that the newly-discovered protein, VIP21 (later renamed caveolin-1), was an abundant marker protein of caveolae. Also at the EMBL Parton and Michael Way discovered a second member of the caveolin family, M-caveolin, now termed caveolin-3.. At The University of Queensland he collaborated with Professor John Hancock. Together they showed that caveolin mutants can act as dominant negative inhibitory mutants and that one of the mutants was a highly potent inhibitor of Ras signalling. Inhibition was specific ...
This task aims to unveil the morpho-functional basis of the highly organized structure and function of invadopodia in tumour cells. The role of membrane lipids, particularly cholesterol and caveolin 1, will be studied through the manipulation of membrane lipid composition. 1.2 Role of Fgd1 and podoplanin in linking ECM-cell interactions and formation of invadopodia ...
This task aims to unveil the morpho-functional basis of the highly organized structure and function of invadopodia in tumour cells. The role of membrane lipids, particularly cholesterol and caveolin 1, will be studied through the manipulation of membrane lipid composition. 1.2 Role of Fgd1 and podoplanin in linking ECM-cell interactions and formation of invadopodia ...
Received 6 November 2009. Accepted 1 December 2009. Uncorrected manuscript published online 3 December 2009. Published online 8 January 2010 ...

Caveolin-2 peptide (ab4929) | AbcamCaveolin-2 peptide (ab4929) | Abcam

Buy our Caveolin-2 peptide. Ab4929 is a blocking peptide and has been validated in BL. Abcam provides free protocols, tips and ... Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle ... for neutralization and control experiments with the polyclonal antibody that reacts with this product and endogenous caveolin-2 ...
more infohttp://www.abcam.com/caveolin-2-peptide-ab4929.html

Caveolin 2 - WikipediaCaveolin 2 - Wikipedia

Fra AM, Mastroianni N, Mancini M, Pasqualetto E, Sitia R (May 1999). "Human caveolin-1 and caveolin-2 are closely linked genes ... "Genomic organization and transcriptional analysis of the human genes coding for caveolin-1 and caveolin-2". Gene. 243 (1-2): 75 ... Caveolin-2 is a protein that in humans is encoded by the CAV2 gene. The protein encoded by this gene is a major component of ... 1995). "VIP21/caveolin is a cholesterol-binding protein". Proc. Natl. Acad. Sci. U.S.A. 92 (22): 10339-43. doi:10.1073/pnas. ...
more infohttps://en.wikipedia.org/wiki/Caveolin_2

Anti-Caveolin-2 antibody (ab2911) | AbcamAnti-Caveolin-2 antibody (ab2911) | Abcam

Rabbit polyclonal Caveolin-2 antibody. Validated in WB, IP, IHC, ICC/IF and tested in Mouse, Rat. Cited in 8 publication(s). ... Recently, I purchased rabbit caveolin-1 polyclonal (ab2910) and rabbit caveolin-2 polyclonal (ab2911). caveolin-1 worked ... caveolin-2 was completely absent, which is a little surprising since the literature suggests that caveolin-1 and 2 are co- ... Intestinal Salmonella typhimurium infection leads to miR-29a induced caveolin 2 regulation.. PLoS One 8:e67300 (2013). WB . ...
more infohttps://www.abcam.com/caveolin-2-antibody-ab2911.html

Cav2 - Caveolin-2 - Mus musculus (Mouse) - Cav2 gene & proteinCav2 - Caveolin-2 - Mus musculus (Mouse) - Cav2 gene & protein

Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer ... Belongs to the caveolin family.Curated. Phylogenomic databases. evolutionary genealogy of genes: Non-supervised Orthologous ... sp,Q9WVC3,CAV2_MOUSE Caveolin-2 OS=Mus musculus GN=Cav2 PE=1 SV=1 MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQLNSHLKLGFEDLIAEP ... forms a high molecular mass hetero-oligomer with caveolin-1.". Lee H., Park D.S., Wang X.B., Scherer P.E., Schwartz P.E., ...
more infohttp://www.uniprot.org/uniprot/Q9WVC3

Stromal Caveolin-1 and Caveolin-2 Expression in Primary Tumors and Lymph Node MetastasesStromal Caveolin-1 and Caveolin-2 Expression in Primary Tumors and Lymph Node Metastases

... Wladimir Gerstenberger,1 Michaela ... Caveolin-1 (CAV1) and caveolin-2 (CAV2) are integral membrane proteins found in the outer cell membrane called caveolae and in ... D. Kim, H. Kim, and J. S. Koo, "Expression of caveolin-1, caveolin-2 and caveolin-3 in thyroid cancer and stroma," Pathobiology ... using primary mouse monoclonal anti-caveolin-1 (clone 2297) and anti-caveolin-2 (clone 65) antibodies (BD Transduction ...
more infohttps://www.hindawi.com/journals/acp/2018/8651790/

NIOSHTIC-2  Publications Search - 20029955 - Migration-activated caveolin rear polarization is controlled by a specific domain...NIOSHTIC-2 Publications Search - 20029955 - Migration-activated caveolin rear polarization is controlled by a specific domain...

The migration-stimulated caveolin rear translocation appears to play an important role in endothelial cell polarization and ... When cells are migrating, caveolin-1, the principle protein component of caveolae, is excluded from the leading edge and ... Our results show that wild-type caveolin-1, Cav1-178-GFP, was polarized to the cell rear in migrating caveolin-1 deficient ... suggesting that aa 1-60 were essential for caveolin-1 polarization. Interestingly, deletion of aa 1-60 did not prevent caveolin ...
more infohttps://www.cdc.gov/niosh/nioshtic-2/20029955.html

Caveolin 2 ELISA & Assay KitsCaveolin 2 ELISA & Assay Kits

Compare and order Caveolin 2 ELISA Kits. View citations, images, detection ranges, sensitivity, prices and more. Recommended ... Caveolin 2 Antigen Profile Beschreibung des Gens The protein encoded by this gene is a major component of the inner surface of ... Compare ABIN418644 to our alternative Human Caveolin 2 ELISA Kits Relevance Score. uniqeid. Catalogue Id. Detection Method. ... Caveolin 2 in Regulation of G-Protein Coupled Receptor Protein Signaling * Caveolin 2 in Regulation of G-Protein Coupled ...
more infohttps://www.antikoerper-online.de/regulation-of-g-protein-coupled-receptor-protein-signaling-pathway-77/caveolin-2-elisa-kit-2870/

N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in...N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in...

Here we show that tyrosine phosphorylation of caveolin-2 (Cav-2) negatively regulates the anti-proliferative function of ... N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in ... N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in ... N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/22819829

Caveolin-2 antibody | acris-antibodies.comCaveolin-2 antibody | acris-antibodies.com

Recombinant protein of human caveolin 2 (CAV2), transcript variant 1. Human. > 80 % Preparation: Recombint protein was captured ... Background of Caveolin-2 antibody. CAV2 is a major component of the inner surface of caveolae, small invaginations of the ... Caveolin-2 (full length, N-term HIS tag, transcript variant 2). Not available. ... Caveolin 2 antibody immunoprecipitates caveolin 2 protein in IP experiments. IP samples: A549 whole cell extract. A. 30 ug A549 ...
more infohttps://www.acris-antibodies.com/target/caveolin-2-antibody.htm?product_type=Protein+%7C+Growth+Factor

Caveolin-1 and -2 in the Exocytic Pathway of MDCK Cells | JCBCaveolin-1 and -2 in the Exocytic Pathway of MDCK Cells | JCB

1 for α-caveolin-1/β-caveolin-1/caveolin-2 (summing the major 21- and minor 19-kD spots of caveolin-2) (Fig. 4, top). On the ... sequence identity to caveolin-1 was isolated from caveolin-enriched membranes and termed caveolin-2 (Scherer et al., 1996). ... Effect of anti- caveolin-1 antibodies on ER-to-Golgi (E-G), basolateral (BL), and apical (AP) transport. Anti-caveolin-1 ... α- and β-caveolin-1 are marked by arrowheads. Caveolin-2 is marked by arrows. Filter-grown MDCK cells metabolically labeled ...
more infohttp://jcb.rupress.org/content/140/4/795?ijkey=92a14214d7ffb7d4d0682a71a2fb9222c7a8d52b&keytype2=tf_ipsecsha

Tyrosine phosphorylation of caveolin-2 at residue 27: differences in the spatial and temporal behavior of phospho-Cav-2 (pY19...Tyrosine phosphorylation of caveolin-2 at residue 27: differences in the spatial and temporal behavior of phospho-Cav-2 (pY19...

Caveolin-2 is an accessory molecule and the binding partner of caveolin-1. Previously, we showed that c-Src expression leads to ... Tyrosine phosphorylation of caveolin-2 at residue 27: differences in the spatial and temporal behavior of phospho-Cav-2 (pY19 ... Phospho-Cav-2 (pY19) is concentrated at cell edges and at cell-cell contacts, whereas phospho-Cav-2 (pY27) is distributed in a ... Cav-2 is phosphorylated at tyrosine 19 in a rapid and transient fashion, whereas phosphorylation at tyrosine 27 is sustained ...
more infohttps://www.uniprot.org/citations/15504032

Caveolin-2-Deficient Mice Show Evidence of Severe Pulmonary Dysfunction without Disruption of Caveolae | Molecular and Cellular...Caveolin-2-Deficient Mice Show Evidence of Severe Pulmonary Dysfunction without Disruption of Caveolae | Molecular and Cellular...

1C) for caveolin-1 and caveolin-3. Caveolin-1 expression appeared to be reduced to various levels in certain Cav-2−/− tissues ( ... Thus, the dyslipidemia observed in caveolin-1-deficient mice is exclusively due to a loss of caveolin-1 and not caveolin-2. ... and anti-caveolin-3 MAb (clone 65). A longer exposure of the same blot is also shown. Both caveolin-1 and caveolin-3 are ... Induction of caveolin during adipogenesis and association of GLUT4 with caveolin-rich vesicles. J. Cell Biol. 127:1233-1243. ...
more infohttps://mcb.asm.org/content/22/7/2329?ijkey=b6614433a9b08c3329f2cbede7086954c0f5c2ed&keytype2=tf_ipsecsha

Anti-CAV2 / Caveolin 2 Antibody | Rabbit anti-Human Polyclonal  | LSBioAnti-CAV2 / Caveolin 2 Antibody | Rabbit anti-Human Polyclonal | LSBio

Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). Validated for ELISA, ... Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). Validated for ELISA, ... Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). Validated for ELISA, ...
more infohttps://www.lsbio.com/antibodies/cav2-antibody-caveolin-2-antibody-elisa-if-immunofluorescence-ihc-ls-c498386/511900

Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and...Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and...

Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and ... Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and ... Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and ... Caveolin-1 (CAV-1) plays important roles in many aspects of cellular biology, including vesicular transport, cholesterol ...
more infohttps://www.cun.es/pt/investigacao/publicacoes-cientificas/caveolin-1-human-adipose-tissue-upregulated-obesity-obesity-t2dm-inflammation

Anti-CAV2 / Caveolin 2 Antibody | Rabbit anti-Human Polyclonal WB | LSBioAnti-CAV2 / Caveolin 2 Antibody | Rabbit anti-Human Polyclonal WB | LSBio

Caveolin 2 antibody LS-C481421 is a biotin-conjugated rabbit polyclonal antibody to Caveolin 2 (CAV2) from human, mouse, rat ... CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. Antibody concentration 1 ug/ml. This image was taken for the ... CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. Antibody concentration 1 ug/ml. This image was taken for the ... CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. Antibody concentration 1 ug/ml. This image was taken for the ...
more infohttps://www.lsbio.com/antibodies/cav2-antibody-caveolin-2-antibody-aa36-85-biotin-wb-western-ls-c481421/494128

Role of Caveolin 1, E-Cadherin, Enolase 2 and PKCalpha on resistance to methotrexate in human HT29 colon cancer cells | BMC...Role of Caveolin 1, E-Cadherin, Enolase 2 and PKCalpha on resistance to methotrexate in human HT29 colon cancer cells | BMC...

On the other hand, microarray analysis of HT29 and HT29 MTX resistant cells unveiled overexpression of caveolin 1, enolase 2 ... We provide functional evidences indicating that caveolin 1 and E-cadherin, deregulated in MTX resistant cells, may play a ... Combined treatments targeting siRNA inhibition of caveolin 1 and overexpression of E-cadherin markedly reduced cell viability ... The union is performed between the caveolin 1 scaffolding domain peptide and PKCα caveolin 1 binding motif [59]. Further, ...
more infohttps://bmcmedgenomics.biomedcentral.com/articles/10.1186/1755-8794-1-35

JoVE Search Results: Caveolin 2JoVE Search Results: Caveolin 2

Caveolin-1, Cellular Senescence, Fibroblasts, Insulin, Mutations, ATP, Mutation, and Blood ... Detection of caveolin-3/caveolin-1/P2X7R complexes in mice atrial cardiomyocytes in vivo and in vitro. Abstract ... Caveolin-1 is required for vascular endothelial insulin uptake. < 0.05 for each). Over-expression of caveolin-1 increased ... Knockdown of caveolin-1 also inhibited insulin-induced caveolin-1 and IGF-1 receptor translocation to the plasma membrane. ...
more infohttp://labindex.jove.com/group/Caveolin-2

Anti-Caveolin-2 (phospho Y19) 抗体 (ab3417)Anti-Caveolin-2 (phospho Y19) 抗体 (ab3417)

"ウサギ・ポリクローナル抗体 ab3417 交差種: Ms,Rat,Hu 適用: WB,IP,IHC-P,ICC,ICC/IF…Caveolin-2抗体一覧…画像、プロトコール、文献など ... Synthetic peptide corresponding to Mouse Caveolin-2 aa 14-25.. Sequence: MADDAYpSHHSGC (Peptide available as ab4962). Run BLAST ... Fatty acylated caveolin-2 is a substrate of insulin receptor tyrosine kinase for insulin receptor substrate-1-directed ... Immunocytochemistry/ Immunofluorescence - Anti-Caveolin-2 (phospho Y19) antibody (ab3417)Image courtesy of Y Pak by
more infohttps://www.abcam.co.jp/caveolin-2-phospho-y19-antibody-ab3417.html

Caveolin - WikipediaCaveolin - Wikipedia

The caveolin gene family has three members in vertebrates: CAV1, CAV2, and CAV3, coding for the proteins caveolin-1, caveolin-2 ... There are two isoforms of caveolin-1: caveolin-1α and caveolin-1β, the latter lacking a part of the N-terminus. ... Caveolin-1 has also been shown to play a role in the integrin signaling. The tyrosine phosphorylated form of caveolin-1 ... Genetically engineered mice that lack caveolin-1 and caveolin-2 are viable and fertile, showing that neither the caveolins nor ...
more infohttps://en.wikipedia.org/wiki/Caveolin

Matrix metalloproteinase-2-mediated occludin degradation and caveolin-1-mediated claudin-5 redistribution contribute to blood...Matrix metalloproteinase-2-mediated occludin degradation and caveolin-1-mediated claudin-5 redistribution contribute to blood...

Caveolin-1 regulates nitric oxide-mediated matrix metalloproteinases activity and blood-brain barrier permeability in focal ... and cytosolic translocation of caveolin-1 (Cav-1). This same OGD treatment also led to rapid degradation of tight junction ... Using selective MMP-2/9 inhibitor SB-3CT (2-[[(4-phenoxyphenyl)sulfonyl]methyl]-thiirane) or their neutralizing antibodies or ... Matrix metalloproteinase-2 and -9 secreted by leukemic cells increase the permeability of blood-brain barrier by disrupting ...
more infohttps://read.qxmd.com/read/22378877/matrix-metalloproteinase-2-mediated-occludin-degradation-and-caveolin-1-mediated-claudin-5-redistribution-contribute-to-blood-brain-barrier-damage-in-early-ischemic-stroke-stage

Caveolin (IPR001612) | InterPro | EMBL-EBICaveolin (IPR001612) | InterPro | EMBL-EBI

Mammals have three caveolin proteins:caveolin-1 (Cav-1, or VIP21), caveolin-2 and caveolin-3 (or M-caveolin). Various classes ... Evaluating caveolin interactions: do proteins interact with the caveolin scaffolding domain through a widespread aromatic ... Caveolae require the caveolin protein for formation. Caveolins may act as scaffolding proteins within caveolar membranes by ...
more infohttp://www.ebi.ac.uk/interpro/entry/IPR001612?q=type:family

Caveolin-2 associates with intracellular chlamydial inclusions independently of caveolin-1 | BMC Infectious Diseases | Full TextCaveolin-2 associates with intracellular chlamydial inclusions independently of caveolin-1 | BMC Infectious Diseases | Full Text

Using caveolin-1 deficient FRT cells, we show that although caveolin-2 normally is not transported out of the Golgi in the ... We utilized a caveolin-1 negative/caveolin-2 positive FRT cell line and laser confocal immunofluorescence techniques to ... although caveolin-1 did not colocalize with these organisms. Moreover, caveolin-2 appears to be specifically, or indirectly, ... Nevertheless, this second caveolin protein can now be added to the small number of host proteins that are associated with the ...
more infohttps://bmcinfectdis.biomedcentral.com.preview-live.oscarjournals.springer.com/articles/10.1186/1471-2334-4-23

Caveolin-2 (phospho Y19)抗体[EPR2220(3)]|Anti-Caveolin-2 (phospho Y19)抗体[EPR2220(3)]Caveolin-2 (phospho Y19)抗体[EPR2220(3)]|Anti-Caveolin-2 (phospho Y19)抗体[EPR2220(3)]

Caveolin-2兔单克隆抗体[EPR2220(3)](ab124883)可与人样本反应并经WB, Flow Cyt实验严格验证。中国75% ... All lanes : Anti-Caveolin-2 (phospho Y19) antibody [EPR2220(3)] (ab124883) at 1/1000 dilution. Lane 1 : HUVEC cell lysate ... Anti-Caveolin-2 (phospho Y19)抗体[EPR2220(3)]. 参阅全部 Caveolin-2 一抗. ... Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) corresponding
more infohttp://www.abcam.cn/caveolin-2-phospho-y19-antibody-epr22203-ab124883.html

Caveolin 1 - WikipediaCaveolin 1 - Wikipedia

... within caveolin-1 molecule. Molecules that interact with caveolin-1 contain caveolin-binding motifs (CBM). Caveolin GRCh38: ... "Human caveolin-1 and caveolin-2 are closely linked genes colocalized with WI-5336 in a region of 7q31 frequently deleted in ... caveolin. Caveolin binding negatively regulates the auto-activation of Src tyrosine kinases". J. Biol. Chem. 271 (46): 29182-90 ... Caveolin-1 is a protein that in humans is encoded by the CAV1 gene. The scaffolding protein encoded by this gene is the main ...
more infohttps://en.wikipedia.org/wiki/Caveolin_1

TCDB » SEARCHTCDB » SEARCH

1] "Molecular cloning and developmental expression of the caveolin gene family in the amphibian Xenopus laevis." Razani B.et.al ... Location1 / Topology2 / Orientation3:. Golgi apparatus membrane1 / Peripheral membrane protein2 ...
more infohttp://tcdb.org/search/result.php?tc=8.A.26.1.3
  • Caveolin-1 regulates nitric oxide-mediated matrix metalloproteinases activity and blood-brain barrier permeability in focal cerebral ischemia and reperfusion injury. (qxmd.com)
  • Consequently, MMP-2 regulates a vast range of physiological processes, from angiogenesis to wound healing and tissue remodeling. (springer.com)
  • A functional activating protein 1 (AP-1) site regulates matrix metalloproteinase 2 (MMP-2) transcription by cardiac cells through interactions with JunB-Fra1 and JunB-FosB heterodimers. (springer.com)
  • Caveolin-1 regulates lung cancer stem-like cell induction and p53 inactivation in carbon nanotube-driven tumorigenesis. (cdc.gov)
  • In the TGN caveolin-1/-2 heterooligomers are sorted into basolateral vesicles, whereas larger caveolin-1 homooligomers are targeted to the apical side. (rupress.org)
  • Caveolae are invaginated structures that form in lipid raft domains when the protein caveolin-1 is expressed. (springer.com)
  • We recently found that host cell caveolin-1 is associated with the intracellular vacuoles and inclusions of some chlamydial strains and species, and that entry of those strains depends on intact lipid raft domains. (springer.com)
  • "Molecular cloning and developmental expression of the caveolin gene family in the amphibian Xenopus laevis. (tcdb.org)
  • The molecular mechanisms underlying caveolin-associated diseases are still poorly understood. (nature.com)
  • Molecular cloning had identified three distinct caveolin genes (1 , 2 , 3 , 4) caveolin-1 , caveolin-2 , and caveolin-3 . (aacrjournals.org)
  • Publication date: Available online 22 November 2019Source: Biochimica et Biophysica Acta (BBA) - Molecular Basis of DiseaseAuthor(s): Oktawia Nilsson, Rita Del Giudice, Mototsugu Nagao, Caitriona Grönberg, Lena Eliasson, Jens O. LagerstedtAbstractThe increase of plasma levels of high-density lipoproteins and Apolipoprotein A-I (ApoA-I), its main protein component, has been shown to have a positive action on glucose disposal in type 2 diabetic patients. (medworm.com)
  • 2 - 5 However, knowledge of the molecular mechanisms responsible for APN-induced cardiomyocyte protection against MI injury remains elusive. (ahajournals.org)
  • Therefore, the aims of the present study were to (1) determine the role of caveolin-3 (Cav-3) (the predominant form of caveolin expressed in cardiomyocytes) in the cardioprotective actions of APN, and (2) investigate the molecular mechanisms responsible for Cav-3 regulation of APN transmembrane signaling. (ahajournals.org)
  • 2 , 3 Although these clinical correlations have been established, the underlying molecular mechanisms are poorly understood. (ahajournals.org)
  • Several molecular changes have been described in IBC including RHOC overexpression, hypomethylation of caveolin-1 or caveolin-2 promoters, and deletion of the tumor suppressor WISP3 ( 4 - 8 ). (aacrjournals.org)
  • PTGS2 (COX-2) exists as a homodimer, each monomer with a molecular mass of about 70 kDa. (wikipedia.org)
  • WT-Cav-2, S23/36A-Cav-2, and Y19/27F-Cav-2 MLECs were plated at 3 × 10 5 cells onto 150 mm dishes, 24 h later incubated without or with TGF-β (1 ng/ml) for additional 48 h, lysed and processed for SDS-PAGE and immunoblotting with indicated antibodies as described in Section 2. (nih.gov)
  • Anti-caveolin-1 antibodies inhibit the apical delivery of influenza virus hemagglutinin without affecting basolateral transport of vesicular stomatitis virus G protein. (rupress.org)
  • Apical but not basolateral exocytosis can be inhibited with caveolin-1 antibodies, suggesting that two different caveolin complexes function in TGN to surface transport. (rupress.org)
  • Using selective MMP-2/9 inhibitor SB-3CT (2-[[(4-phenoxyphenyl)sulfonyl]methyl]-thiirane) or their neutralizing antibodies or Cav-1 siRNA, we found that MMP-2 was the major enzyme mediating OGD-induced occludin degradation, while Cav-1 was responsible for claudin-5 redistribution. (qxmd.com)
  • Oligomers can also be produced from in vitro-synthesized caveolin-1 after translocation into microsomal membranes. (rupress.org)
  • Moreover, caveolin-2 appears to be specifically, or indirectly, associated with the pathogens at the inclusion membranes. (springer.com)
  • Furthermore, forskolin- and aluminum tetrafluoride-stimulated adenylyl cyclase activity was significantly increased by caveolin knockdown in cells or in brain membranes obtained from caveolin-1 knockout mice, indicating that caveolin attenuates signaling at the level of Gα s /adenylyl cyclase and distal to GPCRs. (aspetjournals.org)
  • 11 However, the role of caveolin-3 in cardiomyocyte hypertrophy still remains unknown: it might promote hypertrophy, might inhibit hypertrophy, or might simply be a consequence of hypertrophy. (ahajournals.org)
  • We also examined the role of Caveolin-1 in the pathogenesis of PVR. (arvojournals.org)
  • IDIBAPS researchers studied the role of caveolin-1 in this process, comparing the regenerative capacity of normal mice and modified mice, which do not express the caveolin-1 gene. (psychcentral.com)
  • 9 , 10 However, the role of caveolin in APN transmembrane signaling, ie, functioning as either an inhibitor or activator, has never been previously investigated. (ahajournals.org)
  • Role of Caveolin-1 in carbon nanotube -induced stem-like cells and tumorigenesis. (cdc.gov)
  • The alpha-smooth muscle actin (αSMA) expression and migration ability were increased in RPE cells with knockout or knockdown of Caveolin-1 , whereas zonula occludens-1 (ZO-1) immunohistochemistry showed reduced morphology and expression of ZO-1. (arvojournals.org)
  • The protein caveolin-3, a structural component of cardiac caveolae, is associated with cellular signaling. (ahajournals.org)
  • Caveolin-3 is the major structural protein of caveolae in muscle. (nature.com)
  • 1 , 2 Although the robust improvement in surgical instruments has enabled a very high rate of structural attachment in RD, 3 - 5 RDs with severe complications, including giant retinal tears, multiple retinal tears, and/or vitreous hemorrhage, often develop into PVR. (arvojournals.org)
  • Expression and compartmentalization of caveolin in adipose cells: coordinate regulation with and structural segregation from GLUT4. (univalle.edu.co)
  • Exposure of bEND3 monolayer to OGD for 2 h significantly increased its permeability to FITC-labeled dextran and promoted the secretion of metalloproteinase-2 and -9 (MMP-2/9) and cytosolic translocation of caveolin-1 (Cav-1). (qxmd.com)
  • Lipid rafts/caveolae were disrupted in C6 cells by either short-term cholesterol chelation using methyl-β-cyclodextrin or by stable knockdown of caveolin-1 and -2 by RNA interference. (aspetjournals.org)
  • however, this trafficking was blocked by methyl-β-cyclodextrin or by caveolin knockdown. (aspetjournals.org)
  • Methyl-β-cyclodextrin or caveolin knockdown significantly increased isoproterenol or thyrotropin-stimulated cAMP accumulation. (aspetjournals.org)
  • and the neuropilin receptors 1 and 2 ( 8 , 9 ), as well as via interaction with heparin sulfate proteoglycans ( 10 ). (diabetesjournals.org)
  • 10 This increase is associated with agonist-stimulated contractile augmentation by inhibition of nitric oxide synthase, suggesting that caveolin-3 is involved in nitric oxide influences on contractility in failing myocardium. (ahajournals.org)
  • In cardiomyocytes, caveolin-3 might be involved in the regulation of channel functions. (ahajournals.org)
  • In subconfluent proliferating cells, ZO-1 and ZO-2 have been shown to colocalize to the nucleus and play a role in transcriptional regulation, possibly through facilitating nuclear import/export of transcriptional regulators (5-7). (cellsignal.com)
  • We now directly address the functional significance of caveolin-2 by genetically targeting the caveolin-2 locus (Cav-2) in mice. (asm.org)
  • Filoviruses belong to one of three serologically, biochemically and genetically distinct genera-Ebolavirus, Marburgvirus, and "Cuevavirus" (tentative) [ 1 , 2 ]. (mdpi.com)
  • Genetically modified mice, not expressing caveolin-1, were incapable of forming the lipidic bodies necessary in order to provide energy for the regeneration. (psychcentral.com)
  • Our analysis of several different phenotypes observed in caveolin-1-deficient mice (i.e., abnormal vascular responses and altered lipid homeostasis) reveals that Cav-2-null mice do not show any of these other phenotypes, indicating a selective role for caveolin-2 in lung function. (asm.org)
  • Using caveolin-1 deficient FRT cells, we show that although caveolin-2 normally is not transported out of the Golgi in the absence of caveolin-1, it nevertheless colocalizes with chlamydial inclusions in these cells. (springer.com)
  • The oligomers become larger, increasingly detergent insoluble, and phosphorylated on caveolin-2 during transport to the cell surface. (rupress.org)
  • Oligomers of caveolin form the coat of these domains. (wikipedia.org)
  • Ectopic expression of miR-199a-3p significantly inhibited RA-FLS proliferation and induced apoptosis, which was demonstrated by an increase in caspase-3 activity and Bax/Bcl-2 ratio. (portlandpress.com)
  • These CSCs, which were found to overexpress tumor promoter caveolin-1 (Cav-1), displayed aggressive cancer phenotypes of apoptosis resistance and enhanced cell invasion and migration compared with their non-CSC counterpart. (cdc.gov)
  • It has long been reported that sclareol, a labdane-type diterpene isolated from the Salvia sclarea plant can inhibit the proliferation and induce the apoptosis of several cancer cell lines ( 2 - 6 ). (spandidos-publications.com)
  • As a result of these pathological changes, these Cav-2-null mice are markedly exercise intolerant. (asm.org)
  • Interestingly, these Cav-2-null phenotypes are identical to the ones we and others have recently reported for Cav-1-null mice. (asm.org)
  • As caveolin-2 expression is also severely reduced in Cav-1-null mice, we conclude that caveolin-2 deficiency is the clear culprit in this lung disorder. (asm.org)
  • Similar results were obtained by avoiding caveolin-1 expression with the interference RNA technique, and the administration of glucose in mice without caveolin allowed them to have an alternative energy source and were able to regenerate liver with more normality. (psychcentral.com)
  • The transport of apical cargo from the Golgi was shown to be specifically decreased by adenovirus-mediated RNA interference directed against PI(4)P adaptor protein (FAPP) 2. (rupress.org)
  • The aim of the present study was to explore gene expression levels of CAV-1 in human adipose tissue in obesity and obesity-associated type 2 diabetes mellitus (T2DM) and to analyse its potential implication in the inflammatory state associated with obesity. (cun.es)
  • Caveolin-1 was expressed in human FVMs and upregulated in the mouse eyes with PVR. (arvojournals.org)
  • These results provide, for the first time, genetic evidence that a functioning Caveolin-1 mutation may have a role in the malignant progression of human breast cancer. (aacrjournals.org)
  • Alignment of the protein sequences encoded by the human caveolin-1 , caveolin-2 , and caveolin-3 . (aacrjournals.org)
  • Triple-negative breast cancer (TNBC) is defined as an invasive mammary carcinoma lacking clinically significant expression of the three most commonly targeted biomarkers in the treatment of breast cancer: estrogen receptor (ER), progesterone receptor (PR), and human epidermal growth factor receptor 2 (HER2). (springer.com)
  • Recommendations for human epidermal growth factor receptor 2 testing in breast cancer: American Society of Clinical Oncology/College of American Pathologists clinical practice guideline update. (springer.com)
  • Methylation of a CpG island in the 5' promoter region of the caveolin-1 gene in human breast cancer cell lines. (univalle.edu.co)
  • We further demonstrate that large caveolin-1 complexes are present in apical transport vesicles. (rupress.org)
  • extracellular senile plaques made of amyloid-β (Aβ) and intracellular neurofibrillary tangles (NFTs) composed of hyper-phosphorylated tau (2). (deepdyve.com)
  • Aβ is produced in the amyloidogenic pathway where amyloid precursor protein (APP) is cleaved by β-secretase APP-cleaving enzyme (BACE1) to liberate soluble APPβ (sAPPβ) and the intracellular β-carboxy-terminal fragment (βCTF) (2). (deepdyve.com)
  • Along with concomitantly developed biochemical purification techniques, caveolin-1 served as an important means to identify such compartments and to study their function. (asm.org)