Caveolin 2 is a binding partner of CAVEOLIN 1. It undergoes tyrosine phosphorylation by C-SRC PROTEIN PP60 and plays a regulatory role in CAVEOLAE formation.
Endocytic/exocytic CELL MEMBRANE STRUCTURES rich in glycosphingolipids, cholesterol, and lipid-anchored membrane proteins that function in ENDOCYTOSIS (potocytosis), transcytosis, and SIGNAL TRANSDUCTION. Caveolae assume various shapes from open pits to closed vesicles. Caveolar coats are composed of CAVEOLINS.
Proteins which are found in membranes including cellular and intracellular membranes. They consist of two types, peripheral and integral proteins. They include most membrane-associated enzymes, antigenic proteins, transport proteins, and drug, hormone, and lectin receptors.
The lipid- and protein-containing, selectively permeable membrane that surrounds the cytoplasm in prokaryotic and eukaryotic cells.
Detergent-insoluble CELL MEMBRANE components. They are enriched in SPHINGOLIPIDS and CHOLESTEROL and clustered with glycosyl-phosphatidylinositol (GPI)-anchored proteins.
A complex of polyene antibiotics obtained from Streptomyces filipinensis. Filipin III alters membrane function by interfering with membrane sterols, inhibits mitochondrial respiration, and is proposed as an antifungal agent. Filipins I, II, and IV are less important.
Purifying or cleansing agents, usually salts of long-chain aliphatic bases or acids, that exert cleansing (oil-dissolving) and antimicrobial effects through a surface action that depends on possessing both hydrophilic and hydrophobic properties.
A partitioning within cells due to the selectively permeable membranes which enclose each of the separate parts, e.g., mitochondria, lysosomes, etc.
The principal sterol of all higher animals, distributed in body tissues, especially the brain and spinal cord, and in animal fats and oils.
Cyclic GLUCANS consisting of seven (7) glucopyranose units linked by 1,4-glycosidic bonds.
The main structural coat protein of COATED VESICLES which play a key role in the intracellular transport between membranous organelles. Each molecule of clathrin consists of three light chains (CLATHRIN LIGHT CHAINS) and three heavy chains (CLATHRIN HEAVY CHAINS) that form a structure called a triskelion. Clathrin also interacts with cytoskeletal proteins.
Cellular uptake of extracellular materials within membrane-limited vacuoles or microvesicles. ENDOSOMES play a central role in endocytosis.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
Nonionic surfactant mixtures varying in the number of repeating ethoxy (oxy-1,2-ethanediyl) groups. They are used as detergents, emulsifiers, wetting agents, defoaming agents, etc. Octoxynol-9, the compound with 9 repeating ethoxy groups, is a spermatocide.
A homologous group of cyclic GLUCANS consisting of alpha-1,4 bound glucose units obtained by the action of cyclodextrin glucanotransferase on starch or similar substrates. The enzyme is produced by certain species of Bacillus. Cyclodextrins form inclusion complexes with a wide variety of substances.
The intracellular transfer of information (biological activation/inhibition) through a signal pathway. In each signal transduction system, an activation/inhibition signal from a biologically active molecule (hormone, neurotransmitter) is mediated via the coupling of a receptor/enzyme to a second messenger system or to an ion channel. Signal transduction plays an important role in activating cellular functions, cell differentiation, and cell proliferation. Examples of signal transduction systems are the GAMMA-AMINOBUTYRIC ACID-postsynaptic receptor-calcium ion channel system, the receptor-mediated T-cell activation pathway, and the receptor-mediated activation of phospholipases. Those coupled to membrane depolarization or intracellular release of calcium include the receptor-mediated activation of cytotoxic functions in granulocytes and the synaptic potentiation of protein kinase activation. Some signal transduction pathways may be part of larger signal transduction pathways; for example, protein kinase activation is part of the platelet activation signal pathway.
The domestic dog, Canis familiaris, comprising about 400 breeds, of the carnivore family CANIDAE. They are worldwide in distribution and live in association with people. (Walker's Mammals of the World, 5th ed, p1065)
Established cell cultures that have the potential to propagate indefinitely.
A CALCIUM-dependent, constitutively-expressed form of nitric oxide synthase found primarily in ENDOTHELIAL CELLS.
Microscopy in which the samples are first stained immunocytochemically and then examined using an electron microscope. Immunoelectron microscopy is used extensively in diagnostic virology as part of very sensitive immunoassays.
Techniques to partition various components of the cell into SUBCELLULAR FRACTIONS.
Cell lines whose original growing procedure consisted being transferred (T) every 3 days and plated at 300,000 cells per plate (J Cell Biol 17:299-313, 1963). Lines have been developed using several different strains of mice. Tissues are usually fibroblasts derived from mouse embryos but other types and sources have been developed as well. The 3T3 lines are valuable in vitro host systems for oncogenic virus transformation studies, since 3T3 cells possess a high sensitivity to CONTACT INHIBITION.
A stack of flattened vesicles that functions in posttranslational processing and sorting of proteins, receiving them from the rough ENDOPLASMIC RETICULUM and directing them to secretory vesicles, LYSOSOMES, or the CELL MEMBRANE. The movement of proteins takes place by transfer vesicles that bud off from the rough endoplasmic reticulum or Golgi apparatus and fuse with the Golgi, lysosomes or cell membrane. (From Glick, Glossary of Biochemistry and Molecular Biology, 1990)
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The process of moving proteins from one cellular compartment (including extracellular) to another by various sorting and transport mechanisms such as gated transport, protein translocation, and vesicular transport.
Protein of the annexin family with a probable role in exocytotic and endocytotic membrane events.
Neoplasms composed of fatty tissue or connective tissue made up of fat cells in a meshwork of areolar tissue. The concept does not refer to neoplasms located in adipose tissue.
A subtype of dynamin found ubiquitously expressed in a variety of tissues.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
Cells in the body that store FATS, usually in the form of TRIGLYCERIDES. WHITE ADIPOCYTES are the predominant type and found mostly in the abdominal cavity and subcutaneous tissue. BROWN ADIPOCYTES are thermogenic cells that can be found in newborns of some species and hibernating mammals.
Compounds containing carbohydrate or glycosyl groups linked to phosphatidylinositols. They anchor GPI-LINKED PROTEINS or polysaccharides to cell membranes.
Membrane-limited structures derived from the plasma membrane or various intracellular membranes which function in storage, transport or metabolism.
Short tracts of DNA sequence that are used as landmarks in GENOME mapping. In most instances, 200 to 500 base pairs of sequence define a Sequence Tagged Site (STS) that is operationally unique in the human genome (i.e., can be specifically detected by the polymerase chain reaction in the presence of all other genomic sequences). The overwhelming advantage of STSs over mapping landmarks defined in other ways is that the means of testing for the presence of a particular STS can be completely described as information in a database.
A family of high molecular weight GTP phosphohydrolases that play a direct role in vesicle transport. They associate with microtubule bundles (MICROTUBULES) and are believed to produce mechanical force via a process linked to GTP hydrolysis. This enzyme was formerly listed as EC 3.6.1.50.
The movement of materials (including biochemical substances and drugs) through a biological system at the cellular level. The transport can be across cell membranes and epithelial layers. It also can occur within intracellular compartments and extracellular compartments.
A light microscopic technique in which only a small spot is illuminated and observed at a time. An image is constructed through point-by-point scanning of the field in this manner. Light sources may be conventional or laser, and fluorescence or transmitted observations are possible.
An NADPH-dependent enzyme that catalyzes the conversion of L-ARGININE and OXYGEN to produce CITRULLINE and NITRIC OXIDE.
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
The extension of endometrial tissue (ENDOMETRIUM) into the MYOMETRIUM. It usually occurs in women in their reproductive years and may result in a diffusely enlarged uterus with ectopic and benign endometrial glands and stroma.
The ability of a substance to be dissolved, i.e. to form a solution with another substance. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
Cytoplasmic vesicles formed when COATED VESICLES shed their CLATHRIN coat. Endosomes internalize macromolecules bound by receptors on the cell surface.
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
Microscopy using an electron beam, instead of light, to visualize the sample, thereby allowing much greater magnification. The interactions of ELECTRONS with specimens are used to provide information about the fine structure of that specimen. In TRANSMISSION ELECTRON MICROSCOPY the reactions of the electrons that are transmitted through the specimen are imaged. In SCANNING ELECTRON MICROSCOPY an electron beam falls at a non-normal angle on the specimen and the image is derived from the reactions occurring above the plane of the specimen.
Centrifugation using a rotating chamber of large capacity in which to separate cell organelles by density-gradient centrifugation. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The protein constituents of muscle, the major ones being ACTINS and MYOSINS. More than a dozen accessory proteins exist including TROPONIN; TROPOMYOSIN; and DYSTROPHIN.
Amino acids containing an aromatic side chain.
A glucose transport protein found in mature MUSCLE CELLS and ADIPOCYTES. It promotes transport of glucose from the BLOOD into target TISSUES. The inactive form of the protein is localized in CYTOPLASMIC VESICLES. In response to INSULIN, it is translocated to the PLASMA MEMBRANE where it facilitates glucose uptake.
Microscopy of specimens stained with fluorescent dye (usually fluorescein isothiocyanate) or of naturally fluorescent materials, which emit light when exposed to ultraviolet or blue light. Immunofluorescence microscopy utilizes antibodies that are labeled with fluorescent dye.
Src-family kinases that associate with T-CELL ANTIGEN RECEPTOR and phosphorylate a wide variety of intracellular signaling molecules.
Connective tissue cells which secrete an extracellular matrix rich in collagen and other macromolecules.
Serologic tests in which a positive reaction manifested by visible CHEMICAL PRECIPITATION occurs when a soluble ANTIGEN reacts with its precipitins, i.e., ANTIBODIES that can form a precipitate.
Lipids, predominantly phospholipids, cholesterol and small amounts of glycolipids found in membranes including cellular and intracellular membranes. These lipids may be arranged in bilayers in the membranes with integral proteins between the layers and peripheral proteins attached to the outside. Membrane lipids are required for active transport, several enzymatic activities and membrane formation.
Unsaturated derivatives of the steroid androstane containing at least one double bond at any site in any of the rings.
Transport proteins that carry specific substances in the blood or across cell membranes.
Strains of mice in which certain GENES of their GENOMES have been disrupted, or "knocked-out". To produce knockouts, using RECOMBINANT DNA technology, the normal DNA sequence of the gene being studied is altered to prevent synthesis of a normal gene product. Cloned cells in which this DNA alteration is successful are then injected into mouse EMBRYOS to produce chimeric mice. The chimeric mice are then bred to yield a strain in which all the cells of the mouse contain the disrupted gene. Knockout mice are used as EXPERIMENTAL ANIMAL MODELS for diseases (DISEASE MODELS, ANIMAL) and to clarify the functions of the genes.
A PROTEIN-TYROSINE KINASE family that was originally identified by homology to the Rous sarcoma virus ONCOGENE PROTEIN PP60(V-SRC). They interact with a variety of cell-surface receptors and participate in intracellular signal transduction pathways. Oncogenic forms of src-family kinases can occur through altered regulation or expression of the endogenous protein and by virally encoded src (v-src) genes.
A genus of owlet moths of the family Noctuidae. These insects are used in molecular biology studies during all stages of their life cycle.
Test for tissue antigen using either a direct method, by conjugation of antibody with fluorescent dye (FLUORESCENT ANTIBODY TECHNIQUE, DIRECT) or an indirect method, by formation of antigen-antibody complex which is then labeled with fluorescein-conjugated anti-immunoglobulin antibody (FLUORESCENT ANTIBODY TECHNIQUE, INDIRECT). The tissue is then examined by fluorescence microscopy.
An enzyme that catalyzes the oxidation of cholesterol in the presence of molecular oxygen to 4-cholesten-3-one and hydrogen peroxide. The enzyme is not specific for cholesterol, but will also oxidize other 3-hydroxysteroids. EC 1.1.3.6.
Histochemical localization of immunoreactive substances using labeled antibodies as reagents.
A subtype of thioredoxin reductase found primarily in the CYTOSOL.
A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.
A heterogeneous group of inherited MYOPATHIES, characterized by wasting and weakness of the SKELETAL MUSCLE. They are categorized by the sites of MUSCLE WEAKNESS; AGE OF ONSET; and INHERITANCE PATTERNS.
The introduction of a phosphoryl group into a compound through the formation of an ester bond between the compound and a phosphorus moiety.
A form of fluorescent antibody technique commonly used to detect serum antibodies and immune complexes in tissues and microorganisms in specimens from patients with infectious diseases. The technique involves formation of an antigen-antibody complex which is labeled with fluorescein-conjugated anti-immunoglobulin antibody. (From Bennington, Saunders Dictionary & Encyclopedia of Laboratory Medicine and Technology, 1984)
Proteins prepared by recombinant DNA technology.
Components of a cell produced by various separation techniques which, though they disrupt the delicate anatomy of a cell, preserve the structure and physiology of its functioning constituents for biochemical and ultrastructural analysis. (From Alberts et al., Molecular Biology of the Cell, 2d ed, p163)
A free radical gas produced endogenously by a variety of mammalian cells, synthesized from ARGININE by NITRIC OXIDE SYNTHASE. Nitric oxide is one of the ENDOTHELIUM-DEPENDENT RELAXING FACTORS released by the vascular endothelium and mediates VASODILATION. It also inhibits platelet aggregation, induces disaggregation of aggregated platelets, and inhibits platelet adhesion to the vascular endothelium. Nitric oxide activates cytosolic GUANYLATE CYCLASE and thus elevates intracellular levels of CYCLIC GMP.
A 700-kDa cytosolic protein complex consisting of seven equimolar subunits (alpha, beta, beta', gamma, delta, epsilon and zeta). COATOMER PROTEIN and ADP-RIBOSYLATION FACTOR 1 are principle components of COAT PROTEIN COMPLEX I and are involved in vesicle transport between the ENDOPLASMIC RETICULUM and the GOLGI APPARATUS.
GPI-linked membrane proteins broadly distributed among hematopoietic and non-hematopoietic cells. CD55 prevents the assembly of C3 CONVERTASE or accelerates the disassembly of preformed convertase, thus blocking the formation of the membrane attack complex.
A low affinity receptor that binds NERVE GROWTH FACTOR; BRAIN-DERIVED NEUROTROPHIC FACTOR; NEUROTROPHIN 3; and neurotrophin 4.
A large group of membrane transport proteins that shuttle MONOSACCHARIDES across CELL MEMBRANES.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
Immunologic method used for detecting or quantifying immunoreactive substances. The substance is identified by first immobilizing it by blotting onto a membrane and then tagging it with labeled antibodies.
Single pavement layer of cells which line the luminal surface of the entire vascular system and regulate the transport of macromolecules and blood components.
Vesicles formed when cell-membrane coated pits (COATED PITS, CELL-MEMBRANE) invaginate and pinch off. The outer surface of these vesicles is covered with a lattice-like network of the protein CLATHRIN. Shortly after formation, however, the clathrin coat is removed and the vesicles are referred to as ENDOSOMES.
Enzymes that hydrolyze GTP to GDP. EC 3.6.1.-.
CELL LINES derived from the CV-1 cell line by transformation with a replication origin defective mutant of SV40 VIRUS, which codes for wild type large T antigen (ANTIGENS, POLYOMAVIRUS TRANSFORMING). They are used for transfection and cloning. (The CV-1 cell line was derived from the kidney of an adult male African green monkey (CERCOPITHECUS AETHIOPS).)
Thin structures that encapsulate subcellular structures or ORGANELLES in EUKARYOTIC CELLS. They include a variety of membranes associated with the CELL NUCLEUS; the MITOCHONDRIA; the GOLGI APPARATUS; the ENDOPLASMIC RETICULUM; LYSOSOMES; PLASTIDS; and VACUOLES.
A specific monosialoganglioside that accumulates abnormally within the nervous system due to a deficiency of GM1-b-galactosidase, resulting in GM1 gangliosidosis.
Lipids containing at least one monosaccharide residue and either a sphingoid or a ceramide (CERAMIDES). They are subdivided into NEUTRAL GLYCOSPHINGOLIPIDS comprising monoglycosyl- and oligoglycosylsphingoids and monoglycosyl- and oligoglycosylceramides; and ACIDIC GLYCOSPHINGOLIPIDS which comprises sialosylglycosylsphingolipids (GANGLIOSIDES); SULFOGLYCOSPHINGOLIPIDS (formerly known as sulfatides), glycuronoglycosphingolipids, and phospho- and phosphonoglycosphingolipids. (From IUPAC's webpage)
Accumulation of a drug or chemical substance in various organs (including those not relevant to its pharmacologic or therapeutic action). This distribution depends on the blood flow or perfusion rate of the organ, the ability of the drug to penetrate organ membranes, tissue specificity, protein binding. The distribution is usually expressed as tissue to plasma ratios.
A strain of albino rat used widely for experimental purposes because of its calmness and ease of handling. It was developed by the Sprague-Dawley Animal Company.
GTP-BINDING PROTEINS that contain three non-identical subunits. They are found associated with members of the seven transmembrane domain superfamily of G-PROTEIN-COUPLED RECEPTORS. Upon activation the GTP-BINDING PROTEIN ALPHA SUBUNIT of the complex dissociates leaving a dimer of a GTP-BINDING PROTEIN BETA SUBUNIT bound to a GTP-BINDING PROTEIN GAMMA SUBUNIT.
A fungal metabolite which is a macrocyclic lactone exhibiting a wide range of antibiotic activity.
An essential amino acid that is required for the production of HISTAMINE.
A family of heterotrimeric GTP-binding protein alpha subunits that were originally identified by their ability to inhibit ADENYLYL CYCLASES. Members of this family can couple to beta and gamma G-protein subunits that activate POTASSIUM CHANNELS. The Gi-Go part of the name is also spelled Gi/Go.
Single-stranded complementary DNA synthesized from an RNA template by the action of RNA-dependent DNA polymerase. cDNA (i.e., complementary DNA, not circular DNA, not C-DNA) is used in a variety of molecular cloning experiments as well as serving as a specific hybridization probe.
CELL LINE derived from the ovary of the Chinese hamster, Cricetulus griseus (CRICETULUS). The species is a favorite for cytogenetic studies because of its small chromosome number. The cell line has provided model systems for the study of genetic alterations in cultured mammalian cells.
The entering of cells by viruses following VIRUS ATTACHMENT. This is achieved by ENDOCYTOSIS, by direct MEMBRANE FUSION of the viral membrane with the CELL MEMBRANE, or by translocation of the whole virus across the cell membrane.

Tyrosine-phosphorylated caveolin-1: immunolocalization and molecular characterization. (1/121)

Caveolin-1 was discovered as a major substrate for v-Src, but the effect of its tyrosine phosphorylation has not been known. We generated a specific antibody (PY14) to caveolin-1 phosphorylated at tyrosine 14 and studied the significance of the modification. By Western blotting of lysates of v-Src-expressing cells, PY14 recognized not only a 22-kDa band (the position of nonphosphorylated caveolin-1) but bands at 23-24 and 25 kDa. Bands of slower mobility were diminished by dephosphorylation and were also observed for mutant caveolin-1 lacking tyrosine 14. By immunofluorescence microscopy, PY14 did not label normal cells but detected large dots in v-Src-expressing cells. Immunoelectron microscopy revealed that the dots corresponded to aggregated caveolae and/or vesicles of various sizes; besides, the label was observed in intramembrane particle-free areas in the plasma membrane, which appeared to have been formed by fusion of flattened caveolae. A positive reaction with PY14 was found in normal cells after vanadate or pervanadate treatment; it occurred mainly at 22 kDa by Western blotting and was not seen as large dots by immunofluorescence microscopy. Detergent solubility, oligomerization, and association with caveolin-2 were observed similarly for caveolin-1 in normal and v-Src-expressing cells. The results indicate that phosphorylation of caveolin-1 in v-Src-expressing cells occurs at multiple residues and induces flattening, aggregation, and fusion of caveolae and/or caveolae-derived vesicles.  (+info)

Sequence and detailed organization of the human caveolin-1 and -2 genes located near the D7S522 locus (7q31.1). Methylation of a CpG island in the 5' promoter region of the caveolin-1 gene in human breast cancer cell lines. (2/121)

The CA microsatellite repeat marker, D7S522, is located at the center of a approximately 1000 kb smallest common deleted region that is lost in many forms of human cancer. It has been proposed that a putative tumor suppressor gene lies in close proximity to D7S522, within this smallest common deleted region. However, the genes located in proximity to D7S522 have remained elusive. Recently, we identified five independent BAC clones (approximately 100-200 kb) containing D7S522 and the human genes encoding caveolins 1 and 2. Here, we present the detailed organization of the caveolin locus and its relationship to D7S522, as deduced using a shot-gun sequencing approach. We derived two adjacent contigs for a total coverage of approximately 250 kb. Analysis of these contigs reveals that D7S522 is located approximately 67 kb upstream of the caveolin-2 gene and that the caveolin-2 gene is located approximately 19 kb upstream of the caveolin-1 gene, providing for the first time a detailed genetic map of this region. Further sequence analysis reveals many interesting features of the caveolin genes; these include the intron-exon boundaries and several previously unrecognized CA repeats that lie within or in close proximity to the caveolin genes. The first and second exons of both caveolin genes are embedded within CpG islands. These results suggest that regulation of caveolin gene expression may be controlled, in part, by methylation of these CpG regions. In support of this notion, we show here that the CGs in the 5' promoter region of the caveolin-1 gene are functionally methylated in two human breast cancer cell lines (MCF7 and T-47D) that fail to express the caveolin-1 protein. In contrast, the same CGs in cultured normal human mammary epithelial cells (NHMECs) are non-methylated and these cells express high levels of the caveolin-1 protein. Comparison of the human locus with the same locus in the pufferfish Fugu rubripes reveals that the overall organization of the caveolin-1/-2 locus is conserved from pufferfish to man. In conclusion, our current studies provide a systematic basis for diagnostically evaluating the potential deletion, mutation, or methylation of the caveolin genes in a variety of human tumors.  (+info)

The membrane-spanning domains of caveolins-1 and -2 mediate the formation of caveolin hetero-oligomers. Implications for the assembly of caveolae membranes in vivo. (3/121)

The mammalian caveolin gene family consists of caveolins-1, -2, and -3. The expression of caveolin-3 is muscle-specific. In contrast, caveolins-1 and -2 are co-expressed, and they form a hetero-oligomeric complex in many cell types, with particularly high levels in adipocytes, endothelial cells, and fibroblasts. These caveolin hetero-oligomers are thought to represent the functional assembly units that drive caveolae formation in vivo. Here, we investigate the mechanism by which caveolins-1 and -2 form hetero-oligomers. We reconstituted this reciprocal interaction in vivo and in vitro using a variety of complementary approaches, including the generation of glutathione S-transferase fusion proteins and synthetic peptides. Taken together, our results indicate that the membrane-spanning domains of both caveolins-1 and -2 play a critical role in mediating their ability to interact with each other. This is the first demonstration that these unusual membrane-spanning regions found in the caveolin family play a specific role in protein-protein interactions.  (+info)

Vimentin-dependent utilization of LDL-cholesterol in human adrenal tumor cells is not associated with the level of expression of apoE, sterol carrier protein-2, or caveolin. (4/121)

SW-13 adrenal tumor cells that lack detectable intermediate filaments (IF-free) exhibit an impaired capacity to esterify lipoprotein-derived cholesterol compared with cells that contain vimentin filaments. IF-free cells were found to synthesize and secrete significant amounts of apoE, while apoE secretion was nearly undetectable in cell lines that spontaneously express vimentin. However, stable transfectants that express a mouse vimentin cDNA exhibited elevated levels of cholesterol esterification and apoE secretion compared with untransfected IF-free cells, indicating that apoE secretion is not directly related to the capacity of these cells to esterify cholesterol. Some of the cell lines that differed in the level of apoE synthesis and secretion had similar levels of apoE mRNA, suggesting that the differences in expression involve a post-transcriptional mechanism. Treatment of these cells with forskolin and IBMX, 8br-cAMP, or TPA had no effect on apoE secretion. The level of sterol carrier protein-2 (SCP(2)) synthesis and the distribution of SCP(2) between membrane and soluble cellular fractions was not observably different in cells that contained or lacked vimentin. SW-13 cell lines contained little or no detectable caveolin-1 or caveolin-2. These studies demonstrate that the difference in the capacity of these adrenal tumor cells that contain or lack vimentin filaments to esterify low density lipoprotein-cholesterol is not obviously associated with the level of expression or distribution of apoE, SCP(2), or caveolins.  (+info)

Caveolin-2 localizes to the golgi complex but redistributes to plasma membrane, caveolae, and rafts when co-expressed with caveolin-1. (5/121)

We have characterized comparatively the subcellular distributions of caveolins-1 and -2, their interactions and their roles in caveolar formation in polarized epithelial cells. In Fischer rat thyroid (FRT) cells, which express low levels of caveolin-2 and no caveolin-1, caveolin-2 localizes exclusively to the Golgi complex but is partially redistributed to the plasma membrane upon co-expression of caveolin-1 by transfection or by adenovirus-mediated transduction. In Madin-Darby canine kidney (MDCK) cells, which constitutively express both caveolin-1 and -2, caveolin-2 localized to both the Golgi complex and to the plasma membrane, where it co-distributed with caveolin-1 in flat patches and in caveolae. In FRT cells, endogenous or overexpressed caveolin-2 did not associate with low density Triton insoluble membranes that floated in sucrose density gradients but was recruited to these membranes when co-expressed together with caveolin-1. In MDCK cells, both caveolin-1 and caveolin-2 associated with low density Triton-insoluble membranes. In FRT cells, transfection of caveolin-1 promoted the assembly of plasma membrane caveolae that localized preferentially (over 99%) to the basolateral surface, like constitutive caveolae of MDCK cells. In contrast, as expected from its intracellular distribution, endogenous or overexpressed caveolin-2 did not promote the assembly of caveolae; rather, it appeared to promote the assembly of intracellular vesicles in the peri-Golgi area. The data reported here demonstrate that caveolin-1 and -2 have different and complementary subcellular localizations and functional properties in polarized epithelial cells and suggest that the two proteins co-operate to carry out specific as yet unknown tasks between the Golgi complex and the cell surface.  (+info)

Expression of caveolin-1 is required for the transport of caveolin-2 to the plasma membrane. Retention of caveolin-2 at the level of the golgi complex. (6/121)

Caveolins-1 and -2 are normally co-expressed, and they form a hetero-oligomeric complex in many cell types. These caveolin hetero-oligomers are thought to represent the assembly units that drive caveolae formation in vivo. However, the functional significance of the interaction between caveolins-1 and -2 remains unknown. Here, we show that caveolin-1 co-expression is required for the transport of caveolin-2 from the Golgi complex to the plasma membrane. We identified a human erythroleukemic cell line, K562, that expresses caveolin-2 but fails to express detectable levels of caveolin-1. This allowed us to stringently assess the effects of recombinant caveolin-1 expression on the behavior of endogenous caveolin-2. We show that expression of caveolin-1 in K562 cells is sufficient to reconstitute the de novo formation of caveolae in these cells. In addition, recombinant expression of caveolin-1 allows caveolin-2 to form high molecular mass oligomers that are targeted to caveolae-enriched membrane fractions. In striking contrast, in the absence of caveolin-1 expression, caveolin-2 forms low molecular mass oligomers that are retained at the level of the Golgi complex. Interestingly, we also show that expression of caveolin-1 in K562 cells dramatically up-regulates the expression of endogenous caveolin-2. Northern blot analysis reveals that caveolin-2 mRNA levels remain constant under these conditions, suggesting that the expression of caveolin-1 stabilizes the caveolin-2 protein. Conversely, transient expression of caveolin-2 in CHO cells is sufficient to up-regulate endogenous caveolin-1 expression. Thus, the formation of a hetero-oligomeric complex between caveolins-1 and -2 stabilizes the caveolin-2 protein product and allows caveolin-2 to be transported from the Golgi complex to the plasma membrane.  (+info)

Caveolin-1 inhibits epidermal growth factor-stimulated lamellipod extension and cell migration in metastatic mammary adenocarcinoma cells (MTLn3). Transformation suppressor effects of adenovirus-mediated gene delivery of caveolin-1. (7/121)

Caveolin-1 is a principal component of caveolae membranes that may function as a transformation suppressor. For example, the human caveolin-1 gene is localized to a suspected tumor suppressor locus (D7S522; 7q31.1) that is deleted in human cancers, including mammary carcinomas. However, little is known about the role of caveolins in regulating cell movement, a critical parameter in determining metastatic potential. Here, we examine the role of caveolin-1 in cell movement. For this purpose, we employed an established cellular model, MTLn3, a metastatic rat mammary adenocarcinoma cell line. In this system, epidermal growth factor (EGF) stimulation induces rapid lamellipod extension and cell migration. Interestingly, we find that MTLn3 cells fail to express detectable levels of endogenous caveolin-1. To restore caveolin-1 expression in MTLn3 cells efficiently, we employed an inducible adenoviral gene delivery system to achieve tightly controlled expression of caveolin-1. We show here that caveolin-1 expression in MTLn3 cells inhibits EGF-stimulated lamellipod extension and cell migration and blocks their anchorage-independent growth. Under these conditions, EGF-induced activation of the p42/44 mitogen-activated protein kinase cascade is also blunted. Our results suggest that caveolin-1 expression in motile MTLn3 cells induces a non-motile phenotype.  (+info)

A molecular dissection of caveolin-1 membrane attachment and oligomerization. Two separate regions of the caveolin-1 C-terminal domain mediate membrane binding and oligomer/oligomer interactions in vivo. (8/121)

Caveolins form interlocking networks on the cytoplasmic face of caveolae. The cytoplasmically directed N and C termini of caveolins are separated by a central hydrophobic segment, which is believed to form a hairpin within the membrane. Here, we report that the caveolin scaffolding domain (CSD, residues 82-101), and the C terminus (residues 135-178) of caveolin-1 are each sufficient to anchor green fluorescent protein (GFP) to membranes in vivo. We also show that the first 16 residues of the C terminus (i.e. residues 135-150) are necessary and sufficient to attach GFP to membranes. When fused to the caveolin-1 C terminus, GFP co-localizes with two trans-Golgi markers and is excluded from caveolae. In contrast, the CSD targets GFP to caveolae, albeit less efficiently than full-length caveolin-1. Thus, caveolin-1 contains at least two membrane attachment signals: the CSD, dictating caveolar localization, and the C terminus, driving trans-Golgi localization. Additionally, we find that caveolin-1 oligomer/oligomer interactions require the distal third of the caveolin-1 C terminus. Thus, the caveolin-1 C-terminal domain has two separate functions: (i) membrane attachment (proximal third) and (ii) protein/protein interactions (distal third).  (+info)

Gentaur molecular products has all kinds of products like :search , Prospecbio \ Mouse Anti Human Caveolin-1 CAV1 \ ant-027 for more molecular products just contact us
SWISS-MODEL is a fully automated protein structure homology-modelling server. The purpose of this server is to make protein modelling accessible to all life science researchers worldwide.
In the last 15 years, the incidence of Type 2 diabetes associated with cardiovascular disease has more than doubled. The underlying pathology includes both endo...
DI-fusion, le Dépôt institutionnel numérique de lULB, est loutil de référencementde la production scientifique de lULB.Linterface de recherche DI-fusion permet de consulter les publications des chercheurs de lULB et les thèses qui y ont été défendues.
www.MOLUNA.de Caveolins in Cancer Pathogenesis, Prevention and Therapy [4196990] - Caveolins play an important role in the pathogenesis of multiple cancers. This volume focuses mainly on the importance of Caveolin-1 in breast, prostate, lung, skin, colon, pancreatic and brain cancers. It also studies the role of Caveolin-3 in breast cancer.Caveolins are important structural proteins of Caveolae, small invaginations of the
opamine D3 receptor, Caveolin1, Caveolin 1, 3 dopamine receptor, D, Dopamine receptor D3, DRD, ETM1, FET1, Cav-1, ETM1, CAV 1, CAV1, CAV1_HUMAN.
Caveolae are specialized flask-shaped lipid rafts enriched in cholesterol, sphingolipids, and structural marker proteins termed caveolins. Caveolins are highly conserved hairpin loop-shaped, oligomeric proteins of 22-24 kDa. Besides the plasma cell membrane, caveolins are also present in mitochondri …
Caveolin-3 is a protein that in humans is encoded by the CAV3 gene. Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), HyperCKemia, distal myopathy or rippling muscle disease (RMD). Other mutations in Caveolin causes Long QT Syndrome or familial hypertrophic cardiomyopathy, although the role of Cav3 in Long QT syndrome has recently been disputed. Caveolin ...
This download caveolins was been, and received on the treatment by Sir Henry Irving in 1875. Harold was in 1876, The Cup in 1881( at the Lyceum), The Promise of May( at the Globe) in 1882, Becket in 1884, with The Foresters in 1892. The download is one from which I give, not right of secure single-player of the purchase and of of rendering for the analysis.
Caveolae. Caveolae were described in the fifties of the last century by P. Palade after observing animal tissues at transmission electron microscopy. They are small invaginations (45-80 nm) of the plasma membrane that can be observed in most of the eukaryotic cells. It was suggested that most of the caveolae become vesicles (but see below). Caveolae are abundant in endothelial cells, muscle cells and adipocytes. The membrane of the caveolae contains caveolin, as well as other integral proteins linked to glycosylphosphatidylinositol, many sphingolipids (sphingomyelin and glycosphingolipids), and is enriched in cholesterol. The presence of caveolin in a cell is enought to form caveolae. There are around 100 to 200 caveolin molecules in one caveola and there are different types of caveolin in one caveola. Caveolin 1 is expressed in smooth muscle cells and in most of the non muscle cells, and it is necessary for caveolae formation in these cells. Caveolin 2, which can be expressed in the same cells ...
Angiogenic growth factor-induced endothelial cell migration is a key step towards tumor angiogenesis. When cells are migrating, caveolin-1, the principle protein component of caveolae, is excluded from the leading edge and polarized to the cell rear. The migration-stimulated caveolin rear translocation appears to play an important role in endothelial cell polarization and directional movement. In
Expression of caveolins in RMS tumours. Double immunostain showing that in skeletal muscle Cav-1 and Cav-3 mark satellite cells and the plasmalemma of myofibres
Caveolin 1 Polyclonal Antibody from Invitrogen for Immunohistochemistry (Paraffin) applications. This antibody reacts with Human samples. Supplied as 50 ug purified antibody (1 mg/ml) in PBS with | 0.1% sodium azide.
Caveolae, Membrane, Endocytosis, Plasma, Plasma Membrane, Senescence, Binding Protein, Caveolin-1, Cellular Senescence, Fibroblasts, Insulin, Mutations, ATP, Mutation, and Blood
Caveolin-2兔单克隆抗体[EPR2220(3)](ab124883)可与人样本反应并经WB, Flow Cyt实验严格验证。中国75%以上现货,所有产品均提供质保服务,可通过电话、电邮或微信获得本地专属技术支持。
TY - CHAP. T1 - Role of caveolae in the airway. AU - Pabelick, Christina M. AU - Singh, Brij B.. AU - Prakash, Y.s.. PY - 2013/11/1. Y1 - 2013/11/1. N2 - Caveolae are flask-shaped invaginations of the plasma membrane that are rich in lipids and serve as microdomains to facilitate interactions between proteins at the membrane as well as intracellular components, thus modulating signal transduction, protein and lipid transport, and other processes. Constituent caveolar proteins such as caveolins and cavins also have scaffolding domains that anchor and regulate protein function. There is now evidence that caveolae and their constituent proteins are present in airway smooth muscle in a variety of species. Caveolae in airway cells contain or interact with molecules such as receptors, ion channels, and regulatory proteins that are key to the roles of airway epithelium and smooth muscle in regulating airway structure and function. Furthermore, caveolar protein expression and regulation appear to be ...
Caveolins act as scaffold proteins in multiprotein complexes and have been implicated in signaling by G protein-coupled receptors. Studies using knock-out mice suggest that beta(3)-adrenoceptor (beta(3)-AR) signaling is dependent on caveolin-1; however, it is not known whether caveolin-1 is associated with the beta(3)-AR or solely with downstream signaling proteins. We have addressed this question by examining the impact of membrane rafts and caveolin-1 on the differential signaling of mouse beta(3a)- and beta(3b)-AR isoforms that diverge at the distal C terminus. Only the beta(3b)-AR promotes pertussis toxin (PTX)-sensitive cAMP accumulation. When cells expressing the beta(3a)-AR were treated with filipin III to disrupt membrane rafts or transfected with caveolin-1 siRNA, the cyclic AMP response to the beta(3)-AR agonist CL316243 became PTX-sensitive, suggesting G alpha(i/o) coupling. The beta(3a)-AR C terminus, S (P-384) under bar PLNR (P-389) under bar DG (Y-392) under bar EGARP (P-398) under ...
This work establishes an impact of cavin‐1 on pressure regulation in the pulmonary circulation. Right ventricular systolic pressure was robustly increased compared to WT littermate controls and accompanied by an increased right ventricular mass and remodeling of airway‐associated blood vessels. Because PAH is a progressive disease and we used younger animals, one may predict a more full‐blown PAH phenotype with aging. Since expression of caveolin‐1 was partly maintained, cavin‐1‐knockout mice may constitute a more adequate model of heritable PAH due to mutations in caveolin‐1 than do caveolin‐1‐knockout mice. This is because the disease‐causing mutations cause a partial reduction of caveolin‐1 (Austin et al. 2012), contrasting with the situation in caveolin‐1‐knockout mice where the protein is completely lacking.. In agreement with our current findings, thicker alveolar septa, hypercellularity, and elevated pulmonary pressure have been reported in ...
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).
Buy our Caveolin-2 peptide. Ab4929 is a blocking peptide and has been validated in BL. Abcam provides free protocols, tips and expert support for WB and a 12…
Plasmid CAV1-mEGFP from Dr. Ari Heleniuss lab contains the insert caveolin-1 and is published in Traffic. 2010 Mar . 11(3):361-82. This plasmid is available through Addgene.
Caveolin is the principal protein of caveolae and has been implicated in the pathogenesis of cerebral ischemia. To investigate whether changed expression of caveolins has a pivotal role in focal cerebral ischemia, we induced middle cerebral artery occlusion (MCAo)-reperfusion and examined expression of caveolins, inflammatory activation markers, and mediators of autophagic cell death. We also treated MCAo rats with forced exercise to determine its effects on neurological outcome. Particularly, spontaneously hypertensive rats (SHR) and normotensive Wistar-Kyoto (WKY) rats were used to compare the effects of hypertension on focal cerebral ischemia. All MCAo groups showed neurological deficiencies, motor dysfunction, and disruption of balancing ability; however, these pathological changes were more severe in SHR than WKY rats. Expression of caveolins was decreased in MCAo brain tissue, whereas the levels of iNOS and glial fibrillary acidic protein (GFAP) increased. Additionally, LC3-II and beclin-1 levels
This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008 ...
Caveolae are small, cholesterol-rich, hydrophobic membrane domains, characterized by the presence of the protein caveolin and involved in several cellular processes, including clathrin-independent endocytosis, the regulation and transport of cellular cholesterol, and signal transduction. Recently, c …
TY - JOUR. T1 - Caveolin-2 is targeted to lipid droplets, a new membrane domain in the cell. AU - Fujimoto, Toyoshi. AU - Kogo, Hiroshi. AU - Ishiguro, Kimiko. AU - Tauchi, Kumi. AU - Nomura, Ryuji. PY - 2001/3/5. Y1 - 2001/3/5. N2 - Caveolin-1 and -2 constitute a framework of caveolae in nonmuscle cells. In the present study, we showed that caveolin-2, especially its β isoform, is targeted to the surface of lipid droplets (LD) by immunofluorescence and immunoelectron microscopy, and by subcellular fractionation. Brefeldin A treatment induced further accumulation of caveolin-2 along with caveolin-1 in LD. Analysis of mouse caveolin-2 deletion mutants revealed that the central hydrophobic domain (residues 87-119) and the NH2-terminal (residues 70-86) and COOH-terminal (residues 120-150) hydrophilic domains are all necessary for the localization in LD. The NH2- and COOH-terminal domains appeared to be related to membrane binding and exit from ER, respectively, implying that caveolin-2 is ...
Caveolin-1 (Cav-1) is a 21?kDa protein enriched in caveolae and continues to be implicated in oncogenic cell transformation CHC tumorigenesis and metastasis. response to chemotherapy and radiation and tumor growth. We found Cav-1 is definitely overexpressed in human being Personal computer cell lines mouse models and human being pancreatic tumors and is associated with worse tumor grade and clinical results. In Personal computer cell lines disruption/depletion of caveolae/Cav-1 reduces proliferation colony formation and invasion. Radiation and chemotherapy up-regulate Cav-1 manifestation while Cav-1 depletion induces both chemosensitization and radiosensitization through modified apoptotic and DNA restoration signaling. and and transgene (KPC mouse) (Fig. 1B). Cav-1 manifestation was also tested on a cells microarray of 110 individuals with pancreatic malignancy and obtained semi-quantitatively for low versus high CHC manifestation. While Cav-1 is definitely virtually absent in pancreatic ...
Polyclonal antibody for CAVEOLIN 1/CAV1 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. CAVEOLIN 1/CAV1 information: Molecular Weight: 20472 MW; Subcellular Localization: Golgi apparatus membrane; Peripheral
Proteins and other substances can cross the endothelial layer that lines a blood vessel via two routes. Caveolin-1 is essential for both, Siddiqui et al. show.. Researchers already knew that caveolin-1 was necessary for transcellular protein trafficking, in which macromolecules such as albumin enter an endothelial cell from the bloodstream and exit on the tissue side. Caveolae swallow these molecular travelers and bundle them into vesicles that wend through the cell. In an alternative pathway, known as the paracellular route, molecules slip between the cells of the endothelial layer, passing through the adherens junctions that fasten adjacent cells together. Previous work showed that adherens junctions become permeable in mice lacking caveolin-1, suggesting that the protein helps seal the junctions.. Siddiqui et al. dissected the molecular chain of events that connects caveolin-1 to adherens junction integrity. Loss of caveolin-1 activated the enzyme eNOS, which spawns nitric oxide (NO) that ...
where to get vector overexpressing caveolin-1? - posted in Molecular Cloning: Trying to overexpress caveolin-1 in human cancer cells...are there readymade products out there which already has cav-1 attached to a dependable promoter? If so, where should I look? Thanks in advance!
Background: Muscle-restricted coiled-coil protein (MURC)/cavin-4 is a novel member of the cavin family that regulates caveolae function. Caveolae formation and function are also regulated by caveolin-3 in cardiomyocytes (CMs). Overexpression of caveolin-3 induces cardiac protection, and loss of caveolin-3 causes progressive cardiomyopathy. Mutations in MURC have been identified in patients with dilated cardiomyopathy. However, the role of MURC as a caveolar component protein remains unknown.. Methods and Results: To assess the role of MURC in the development of heart failure, MURC-knockout (KO) and wild-type (WT) mice were subjected to pressure overload by transverse aortic constriction (TAC). After TAC, WT mice developed overt heart failure and eccentric cardiac hypertrophy, whereas MURC-KO mice showed preserved cardiac function accompanied by attenuated cardiac hypertrophy. We then focused on β-adrenergic receptor (AR) signaling, because MURC was colocalized and associated with β1-AR. ...
Summary is not available for the mouse gene. This summary is for the human ortholog.] The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010 ...
In biology, caveolae (Latin for little caves; singular, caveola), which are a special type of lipid raft, are small (50-100 nanometer) invaginations of the plasma membrane in many vertebrate cell types, especially in endothelial cells, adipocytes and embryonic notochord cells. They were originally discovered by E. Yamada in 1955. These flask-shaped structures are rich in proteins as well as lipids such as cholesterol and sphingolipids and have several functions in signal transduction. They are also believed to play a role in mechanoprotection, mechanosensation, endocytosis, oncogenesis, and the uptake of pathogenic bacteria and certain viruses. Formation and maintenance of caveolae was initially thought to be primarily due to caveolin, a 21 kD protein. There are three homologous genes of caveolin expressed in mammalian cells: Cav1, Cav2 and Cav3. These proteins have a common topology: cytoplasmic N-terminus with scaffolding domain, long hairpin transmembrane domain and cytoplasmic C-terminus. ...
Learn about Nashua CC RN program. You can enter nursing with either an associates degree or BSN. As a licensed vocational nurse (LVN), you may provide patient care under the supervision of a registered nurse (RN).
Nucleoside diphosphate kinase B (NME2) is ubiquitously expressed; it is an enzyme responsible for the synthesis of nucleoside triphosphates.. NME2 acts as a transcriptional activator, plays a role in T-cell (TCR) receptor activation and TCR-mediated calcium influx. It is also involved in caveolae formation.. ...
The scaffolding protein CAV1 is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to…
Cav-1 expression is negatively related with COL I expression in chronologically-aged human and mouse skinTo compare the age-dependent change of Cav-1 and COL I,
The plasma membrane is not uniform, but can be divided into different microdomains. Whereas some microdomains, such as clathrin-coated pits, are morphologically identifiable, others can be identified only upon colocalization with domain-specific marker molecules. Caveolae are microdomains originally identified morphologically as small noncoated invaginations of the plasma membrane. The formation of caveolae depends on expression of caveolin and, since the plasma membrane contains different noncoated invaginations, caveolae can be identified only by labeling for caveolin. Some confusion exists with respect to the relationship between caveolae and lipid rafts [see raft nomenclature ( Simons and Toomre, 2000)]. This is partly due to difficulties in isolating pure caveolae and to the various methods used for this purpose. Initially, subcellular fractionation upon Triton X-100 extraction at 4°C was used. Such fractionation allows the isolation of detergent-resistant membranes [DRMs; also called DIGs ...
This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3 end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. [provided by RefSeq, Nov 2009 ...
TY - JOUR. T1 - AMP-dependent kinase inhibits oxidative stress-induced caveolin-1 phosphorylation and endocytosis by suppressing the dissociation between c-Abl and Prdx1 proteins in endothelial cells. AU - Takeuchi, Kimio. AU - Morizane, Yuki. AU - Kamami-Levy, Cynthia. AU - Suzuki, Jun. AU - Kayama, Maki. AU - Cai, Wenyi. AU - Miller, Joan W.. AU - Vavvas, Demetrios G.. PY - 2013/7/12. Y1 - 2013/7/12. N2 - Caveolin-1 is the primary structural component of endothelial caveolae that is essential for transcellular trafficking of albumin and is also a critical scaffolding protein that regulates the activity of signaling molecules in caveolae. Phosphorylation of caveolin-1 plays a fundamental role in the mechanism of oxidant-induced vascular hyper permeability. However, the regulatory mechanism of caveolin-1 phosphorylation remains unclear. Here we identify a previously unexpected role for AMPKin inhibition of caveolin-1 phosphorylation under oxidative stress. A pharmacological activator of AMPK, ...
Shibata and colleagues have shown previously that the application of peptides derived from the Gαs sequence in inside-out macropatches enhanced isoproterenol-evoked sodium current (INa), attributable to an apparent increase in the number of functional channels.5,6⇓ In this issue of Circulation Research, Shibata and colleagues (Yarbrough et al8) report that the source of these new channels could be caveolae. Using antibodies directed against caveolin-3, the muscle-specific isoform of caveolin, these investigators were able to block the direct effect of isoproterenol on the Na+ channel (ie, the PKA-independent, Gαs membrane-delimited pathway). Importantly, this effect seems specific, given that antibodies directed against other caveolin isoforms did not affect isoproterenol activation of Na+ channel activity. Moreover, Yarbrough et al8 also documented, in cardiac myocytes, the apparent preferential enrichment into caveolar microdomains of Na+ channels and Gαs. Although these data led the ...
Caveolae are specialised forms of lipid rafts in the plasma membrane of most cells. They form dynamic assemblies of sphingolipids and cholesterol containing scaffolding domains with different affinities for proteins resulting in a variety of functions [1]. The constitutive Cav-1 protein is distributed ubiquitously, while Cav-2 is usually associated with Cav-1 [3, 28]. Although Cav-3 is thought to be muscle specific and is expressed in striated muscles [3, 28, 29], we and others have found that Cav-3 is not expressed within human ASM [6, 30]. Recent studies have established that ASM caveolae contain a number of proteins important to [Ca2+]i regulation (e.g. agonist receptors, Ca2+ influx channels, and force regulatory proteins such as RhoA). In canine ASM, it has been established that caveolar-enriched membrane fractions express Cav-1, L-type Ca2+ channels and plasma membrane Ca2+ ATPase, but not SR proteins such as IP3R or RyR channels [31].. In ASM of different species, in addition to Ca2+ ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Objectives Reduced caveolin-1 levels in lung fibroblasts from patients with scleroderma and the lungs of bleomycin-treated mice promote collagen overexpression and lung fibrosis. This study was undertaken to determine whether caveolin-1 is deficient in leucocytes from bleomycin-treated mice and patients with scleroderma and to examine the consequences of this deficiency and its reversal.. Methods Mice or cells received the caveolin-1 scaffolding domain (CSD) peptide to reverse the pathological effects of reduced caveolin-1 expression. In bleomycin-treated mice, the levels of caveolin-1 in leucocytes and the effect of CSD peptide on leucocyte accumulation in lung tissue were examined. To validate the results in human disease and to identify caveolin-1-regulated molecular mechanisms, monocytes and neutrophils were isolated from patients with scleroderma and control subjects and caveolin-1, extracellular signal-regulated protein kinase (ERK), c-Jun N-terminal kinase (JNK), p38, CXC chemokine ...
At the European Molecular Biology Laboratory (EMBL) in Heidelberg, Professor Parton was mentored by Gareth Griffiths, where he honed his skills in electron microscopy while collaborating with other groups throughout the institute including Jean Gruenberg and Marino Zerial. He has maintained these collaborations to this day, despite the groups now being spread around the globe.. Collaboration has been central to his career. In a collaborative project with the laboratory of Kai Simons, he observed that the newly-discovered protein, VIP21 (later renamed caveolin-1), was an abundant marker protein of caveolae. Also at the EMBL Parton and Michael Way discovered a second member of the caveolin family, M-caveolin, now termed caveolin-3.. At The University of Queensland he collaborated with Professor John Hancock. Together they showed that caveolin mutants can act as dominant negative inhibitory mutants and that one of the mutants was a highly potent inhibitor of Ras signalling. Inhibition was specific ...
This task aims to unveil the morpho-functional basis of the highly organized structure and function of invadopodia in tumour cells. The role of membrane lipids, particularly cholesterol and caveolin 1, will be studied through the manipulation of membrane lipid composition. 1.2 Role of Fgd1 and podoplanin in linking ECM-cell interactions and formation of invadopodia ...
This task aims to unveil the morpho-functional basis of the highly organized structure and function of invadopodia in tumour cells. The role of membrane lipids, particularly cholesterol and caveolin 1, will be studied through the manipulation of membrane lipid composition. 1.2 Role of Fgd1 and podoplanin in linking ECM-cell interactions and formation of invadopodia ...
Received 6 November 2009. Accepted 1 December 2009. Uncorrected manuscript published online 3 December 2009. Published online 8 January 2010 ...
Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer ... Lee H, Park DS, Wang XB, Scherer PE, Schwartz PE, Lisanti MP (September 2002). "Src-induced phosphorylation of caveolin-2 on ... 19 (2): 177-87. doi:10.1038/sj.onc.1203304. PMID 10644995. Hock B, Böhme B, Karn T, Feller S, Rübsamen-Waigmann H, Strebhardt K ... 17 (2): 255-60. doi:10.1038/sj.onc.1201907. PMID 9674711. Koehler JA, Moran MF (May 2001). "RACK1, a protein kinase C ...
... has been shown to interact with Caveolin 1 and peroxisomal receptor PEX5. GRCh38: Ensembl release 89: ENSG00000116171 - ... 3 (2): 341-6. doi:10.1093/hmg/3.2.341. PMID 8004106. Seedorf U, Brysch P, Engel T, et al. (1994). "Sterol carrier protein X is ... 24 (2): 370-4. doi:10.1006/geno.1994.1630. PMID 7698762. Woodford JK, Colles SM, Myers-Payne S, et al. (1995). "Sterol carrier ... 1432 (2): 265-74. doi:10.1016/S0167-4838(99)00114-4. PMID 10407148. Kimura H, Fujii H, Suzuki S, et al. (1999). "Lipid-binding ...
... from invading murine lung epithelial cells by knocking down the caveolin-2 (CAV2) gene. Thus, though bacteria cannot be ... "Pseudomonas invasion of type I pneumocytes is dependent on the expression and phosphorylation of caveolin-2". The Journal of ... 7 (1&2): 41-46. Ferreira, S. A.; Pitz, K. Y.; Manshardt, R.; Zee, F.; Fitch, M.; Gonsalves, D. (2002). "Virus Coat Protein ... 313 (2): 514-24. doi:10.1016/s0042-6822(03)00341-6. PMID 12954218. Fan Q, Wei C, Xia M, Jiang X (January 2013). "Inhibition of ...
Many proteins such as Caveolin 1/2, Survivin are researched as possible classification or prognostic factors. TNBCs have been ... 232 (2): 142-50. doi:10.1002/path.4280. PMC 4090031. PMID 24114677. Pruss D, Morris B, Hughes E, Eggington JM, Esterling L, ... 17 (2): 445-53. doi:10.7314/apjcp.2016.17.2.445. PMID 26925626. Lehmann BD, Pietenpol JA (January 2014). "Identification and ... In 2019, CytoDyn initiated a Phase 1b/2 trial with its humanized monoclonal antibody, leronlimab (PRO 140), in combination with ...
Junctophilin 2, also known as JPH2, is a protein which in humans is encoded by the JPH2 gene. Alternative splicing has been ... 2 (1): 47-53. doi:10.1038/nmeth726. PMID 15782160. S2CID 6135437. Olsen JV, Blagoev B, Gnad F, et al. (2006). "Global, in vivo ... 2005). "Junctophilin type 2 is associated with caveolin-3 and is down-regulated in the hypertrophic and dilated ... "Entrez Gene: JPH2 junctophilin 2". Takeshima H, Komazaki S, Nishi M, Iino M, Kangawa K (July 2000). "Junctophilins: a novel ...
One of these cases is tyrosine phosphorylation of caveolin 2 (Cav-2) that negatively regulates the anti-proliferative function ... 2012). "N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta ... 15 (2): 787-800. doi:10.1091/mbc.E03-09-0689. PMC 329393. PMID 14657239. Lin M, Lee YH, Xu W, Baker MA, Aitken RJ (2006). " ... 116 (2): 191-203. doi:10.1016/s0092-8674(03)01077-8. PMID 14744431. S2CID 15962886. Alonso A, Sasin J, Bottini N, Friedberg I, ...
Caveolin is paradoxically tumour promoting. NF-κB pathway activation overexpression may contribute to the inflammatory ... caveolin-1 and -2 are overexpressed and may contribute to tumour cell motility[13] ... RhoC GTPase is overexpressed, possibly related to overexpression (hypomethylation) of caveolin-1 and -2. ... "Overexpression of caveolin-1 and -2 in cell lines and in human samples of inflammatory breast cancer". Breast Cancer Research ...
Clathrin and Caveolin 2-Dependent Manner". Cellular Microbiology. 11 (4): 629-644. doi:10.1111/j.1462-5822.2008.01279.x. PMC ... 65 (2): 1-44. doi:10.15585/mmwr.rr6502a1. ISSN 1057-5987. PMID 27172113. Saraiva DG, Soares HS, Soares JF, Labruna MB (2014). " ... 6 (2): e00323-15. doi:10.1128/mBio.00323-15. PMC 4453529. PMID 25827414. Woods CR (April 2013). "Rocky Mountain spotted fever ... 60 (2): 455-70. doi:10.1016/j.pcl.2012.12.001. PMID 23481111. Pace, EJ; O'Reilly, M (1 May 2020). "Tickborne Diseases: ...
PTGS2 has been shown to interact with caveolin 1. PTGS2 (COX-2) was discovered in 1991 by the Daniel Simmons laboratory at ... PGHS-2 is a sequence homodimer. Each monomer of the enzyme has a peroxidase and a PTGS (COX) active site. The PTGS (COX) ... Wang Q1, He Y, Shen Y, Zhang Q, Chen D, Zuo C, Qin J, Wang H, Wang J, Yu Y. (2014). "Vitamin D inhibits COX-2 expression and ... 88 (1-2): 24-30. doi:10.1016/j.lfs.2010.10.017. PMC 3046773. PMID 21035466. Wang D, Patel VV, Ricciotti E, Zhou R, Levin MD, ...
Martin, S; Parton, RG (Apr 2005). "Caveolin, cholesterol, and lipid bodies". Seminars in Cell & Developmental Biology. 16 (2): ... These include perilipin 1 (PLIN1), perilipin 2 (PLIN2/ ADRP), perilipin 3 (PLIN3/ TIP47), perilipin 4 (PLIN4/ S3-12) and ... "Perilipin 2 improves insulin sensitivity in skeletal muscle despite elevated intramuscular lipid levels". Diabetes. 61 (11): ...
... caveolin 1 MeSH D12.644.360.024.272 - caveolin 2 MeSH D12.644.360.024.280 - cortactin MeSH D12.644.360.024.295 - crk-associated ... map kinase kinase 2 MeSH D12.644.360.440.300 - map kinase kinase 3 MeSH D12.644.360.440.400 - map kinase kinase 4 MeSH D12.644. ... leucine-2-alanine MeSH D12.644.468.281.381 - enkephalin, methionine MeSH D12.644.468.281.381.300 - d-ala(2),mephe(4),met(0)-ol- ... bcl-2 homologous antagonist-killer protein MeSH D12.644.360.075.718.937 - bcl-x protein MeSH D12.644.360.075.718.968 - bh3 ...
PTGS2 has been shown to interact with Caveolin 1.[35]. See also[edit]. *Arachidonic acid ... 23 (1-2): 63-75. PMID 15000150. doi:10.1023/A:1025863029529.. *. Jain S, Khuri FR, Shin DM (2004). "Prevention of head and neck ... PGHS-2 is a sequence homodimer. Each monomer of the enzyme has a peroxidase and a PTGS (COX) active site. The PTGS (COX) ... Prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (The HUGO official symbol is PTGS2; HGNC ...
It has been shown that Caveolin-1-deficient mice show insulin resistance. MicroRNA-103/107 inhibition in Caveolin-1-deficient ... Thus, micro103/107 may affect insulin sensitivity by targeting Caveolin-1. The blockmir CD5-2 has been shown to inhibit the ... 27 (12 Suppl 2): 1893-902. doi:10.1016/S0026-0495(78)80007-9. PMID 723640. Young, J. A.; Ting, K. K.; Li, J.; Moller, T.; Dunn ... Usually, antagomirs have some sort of modification, such as 2'-methoxy groups and phosphorothioates, to make them more ...
There are two isoforms of caveolin-1: caveolin-1α and caveolin-1β, the latter lacking a part of the N-terminus. Caveolins are ... The caveolin gene family has three members in vertebrates: CAV1, CAV2, and CAV3, coding for the proteins caveolin-1, caveolin-2 ... Caveolin-1 has also been shown to play a role in the integrin signaling. The tyrosine phosphorylated form of caveolin-1 ... Furthermore, caveolin-3 has been associated with long QT syndrome. Caveolin-3 has been implicated in the development of certain ...
... has been shown to interact with: ARF1, Aldolase A, Amphiphysin, BIN1, Caveolin 1, Glyceraldehyde 3-phosphate dehydrogenase ... Zheng X, Bollinger Bollag W (December 2003). "Aquaporin 3 colocates with phospholipase d2 in caveolin-rich membrane ... functional interaction with caveolin in low-density membrane microdomains". FEBS Letters. 467 (2-3): 326-32. doi:10.1016/s0014- ... functional interaction with caveolin in low-density membrane microdomains". FEBS Letters. 467 (2-3): 326-32. doi:10.1016/S0014- ...
... within caveolin-1 molecule. Molecules that interact with caveolin-1 contain caveolin-binding motifs (CBM). Caveolin GRCh38: ... Fra AM, Mastroianni N, Mancini M, Pasqualetto E, Sitia R (March 1999). "Human caveolin-1 and caveolin-2 are closely linked ... caveolin. Caveolin binding negatively regulates the auto-activation of Src tyrosine kinases". The Journal of Biological ... Caveolin-1 is a protein that in humans is encoded by the CAV1 gene. The scaffolding protein encoded by this gene is the main ...
Caveolin-3 is one of three isoforms of the protein caveolin. Caveolin-3 is concentrated in the caveolae of myocytes, and ... Knockout of caveolin-3 genes are sufficient to induce these manifestations. Similarly, dominant-negative genotypes for caveolin ... Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting ... There are many proteins that associate with caveolin-3, including ion channels and exchangers. In cardiac myocytes, caveolin-3 ...
Fra AM, Mastroianni N, Mancini M, Pasqualetto E, Sitia R (May 1999). "Human caveolin-1 and caveolin-2 are closely linked genes ... "Genomic organization and transcriptional analysis of the human genes coding for caveolin-1 and caveolin-2". Gene. 243 (1-2): 75 ... Caveolin-2 is a protein that in humans is encoded by the CAV2 gene. The protein encoded by this gene is a major component of ... Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer ...
1998). "T-cadherin and signal-transducing molecules co-localize in caveolin-rich membrane domains of vascular smooth muscle ... 2 (4): 261-70. doi:10.1091/mbc.2.4.261. PMC 361775. PMID 2059658. Tanihara H, Sano K, Heimark RL, et al. (1995). "Cloning of ... 463 (1-2): 29-34. doi:10.1016/S0014-5793(99)01594-X. PMID 10601632. S2CID 5950399. Takeuchi T, Misaki A, Liang SB, et al. (2000 ... 429 (2): 207-10. doi:10.1016/S0014-5793(98)00598-5. PMID 9650591. S2CID 18838349. Sato M, Mori Y, Sakurada A, et al. (1998). " ...
... has been shown to interact with: CRK, Caveolin 1, Grb2, NCK1, NCK2, PDGFR-α, PTPN11, RAS p21 protein activator 1, SHC1 ... Yamamoto M, Toya Y, Jensen RA, Ishikawa Y (March 1999). "Caveolin is an inhibitor of platelet-derived growth factor receptor ... 152 (2): 325-34. doi:10.1083/jcb.152.2.325. PMC 2199605. PMID 11266449. Lechleider RJ, Sugimoto S, Bennett AM, Kashishian AS, ... 103 (2): 157-8. doi:10.1172/JCI6127. PMC 407889. PMID 9916126. Olson LE, Soriano P (2011). "PDGFRβ signaling regulates mural ...
Yamamoto H, Komekado H, Kikuchi A (2006). "Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation ... 328 (2): 533-9. doi:10.1016/j.bbrc.2005.01.009. PMID 15694380. Hillier LW, Graves TA, Fulton RS, et al. (2005). "Generation and ... 11 (2): 213-23. doi:10.1016/j.devcel.2006.07.003. PMID 16890161. Katoh Y, Katoh M (2007). "Conserved POU-binding site linked to ... 25 (2): 81-90. doi:10.1080/13816810490514270. PMID 15370539. S2CID 32817238. Holmen SL, Robertson SA, Zylstra CR, Williams BO ( ...
Scherer PE, Lisanti MP (Aug 1997). "Association of phosphofructokinase-M with caveolin-3 in differentiated skeletal myotubes. ... 103 (2): 169-73. doi:10.1016/0009-8981(80)90210-7. PMID 6445244. Musumeci O, Bruno C, Mongini T, Rodolico C, Aguennouz M, Barca ... 104 (2): 277-82. doi:10.1016/0378-1119(91)90262-A. PMID 1833270. Sharma PM, Reddy GR, Babior BM, McLachlan A (Jun 1990). " ... Even though PFKM functions to drive glycolysis, its overexpression has been associated with type 2 diabetes and insulin ...
Wary KK, Mariotti A, Zurzolo C, Giancotti FG (Sep 1998). "A requirement for caveolin-1 and associated kinase Fyn in integrin ... 348 (2): 381-7. doi:10.1042/0264-6021:3480381. PMC 1221077. PMID 10816433. Schaak S, Cussac D, Cayla C, Devedjian JC, Guyot R, ... 47 (2): 242-50. doi:10.1136/gut.47.2.242. PMC 1728001. PMID 10896916. Imokawa G, Kobayasi T, Miyagishi M (Oct 2000). " ... Paris H, Denis C (Aug 2000). "Alpha(2) adrenoceptors regulate proliferation of human intestinal epithelial cells". Gut. ...
... has been shown to interact with: AKT1, BAG1, Beta-catenin, BRCA1, C-jun, Calmodulin 1, Caveolin 1, CDK9, ... Lu ML, Schneider MC, Zheng Y, Zhang X, Richie JP (April 2001). "Caveolin-1 interacts with androgen receptor. A positive ... 277 (2): 1240-8. doi:10.1074/jbc.M108855200. PMID 11707452. Hayes SA, Zarnegar M, Sharma M, Yang F, Peehl DM, ten Dijke P, Sun ... 13 (2): 670-82. doi:10.1091/mbc.01-10-0513. PMC 65658. PMID 11854421. Sharma M, Li X, Wang Y, Zarnegar M, Huang CY, Palvimo JJ ...
Yamamoto, M; Toya Y; Jensen R A; Ishikawa Y (March 1999). "Caveolin is an inhibitor of platelet-derived growth factor receptor ... B enzm: 1.1/2/3/4/5/6/7/8/10/11/13/14/15-18, 2.1/2/3/4/5/6/7/8, 2.7.10, 2.7.11-12, 3.1/2/3/4/5/6/7, 3.1.3.48, 3.4.21/22/23/24, ... CD201 • CD202b • CD204 • CD205 • CD206 • CD207 • CD208 • CD209 • CDw210 (a, b) • CD212 • CD213a (1, 2) • CD217 • CD218 (a, b) ... PDGFRA formira interakcije sa PDGFRB,[2][3] PLCG1,[4] Natrijum-vodonik antiporter 3 regulator 1,[5] Cbl gene,[6] CRK,[7][8] ...
Bhatnagar A, Sheffler DJ, Kroeze WK, Compton-Toth B, Roth BL (Aug 2004). "Caveolin-1 interacts with 5-HT2A serotonin receptors ... 3.0.CO;2-L. PMID 9632173. Klein MT, Dukat M, Glennon RA, Teitler M (Jun 2011). "Toward selective drug development for the human ... 92 (2-3): 179-212. doi:10.1016/S0163-7258(01)00169-3. PMID 11916537. Amlaiky N, Ramboz S, Boschert U, Plassat JL, Hen R (Oct ... 90 (2): 408-12. Bibcode:1993PNAS...90..408A. doi:10.1073/pnas.90.2.408. PMC 45671. PMID 8380639. Lovenberg TW, Erlander MG, ...
High levels of caveolin Cav1 are expressed in adipocytes. Caveolin associates with cholesterol, fatty acids and lipid droplets ... The presence of caveolin leads to a local change in morphology of the membrane. Cavin proteins emerged in the late 2000s to be ... Formation and maintenance of caveolae was initially thought to be primarily due to caveolin, a 21 kD protein. There are three ... However, some bacteria do not use typical caveolae but only caveolin-rich areas of the plasma membrane. The pathogens ...
"Interaction of the immunoglobulin-like cell adhesion molecule hepaCAM with caveolin-1". Biochemical and Biophysical Research ... 219 (2): 382-91. doi:10.1002/jcp.21685. PMID 19142852. S2CID 206047365. Moh MC, Lee LH, Zhang T, Shen S (January 2009). " ... Klopfleisch R, Klose P, da Costa A, Brunnberg L, Gruber AD (2010). "HEPACAM1 and 2 are differentially regulated in canine ... Structurally, hepaCAM is a glycoprotein containing an extracellular domain with 2 Ig-like loops, a transmembrane region and a ...
Feng X, Gaeta ML, Madge LA, Yang JH, Bradley JR, Pober JS (March 2001). "Caveolin-1 associates with TRAF2 to form a complex ... Caveolin 1, EDARADD, HIVEP3, IKK2, Low affinity nerve growth factor receptor, MAP3K14, MAP3K1, MAP3K7IP2, MAP4K2, MAP4K5, RANK ... "A phosphotyrosine-dependent protein interaction screen reveals a role for phosphorylation of caveolin-1 on tyrosine 14: ... 2 (3): 389-95. doi:10.1016/s1097-2765(00)80283-x. PMID 9774977. Hoeflich KP, Yeh WC, Yao Z, Mak TW, Woodgett JR (October 1999 ...
2011). "Chapter 2 - Overview of the Microstructure of the Nervous System". Gray's Clinical Neuroanatomy: The Anatomic Basis for ... 2) Fusimotor set: Gamma motoneurons are activated according to the novelty or difficulty of a task. Whereas static gamma ... Secondary type II sensory fibers (medium diameter) end adjacent to the central regions of the static bag and chain fibres.[2] ... The static axons innervate the chain or static bag2 fibers. They increase the firing rate of Ia and II afferents at a given ...
The endocytic pathway can be hijacked by viruses and other pathogens in order to gain entry to the cell during infection.[2] ... Two chemical compounds called Pitstop 1 and Pitstop 2, selective clathrin inhibitors, can interfere with the pathogenic ... "Pitstop 2 is a potent inhibitor of clathrin-independent endocytosis". PLoS ONE. 7 (9): e45799. doi:10.1371/journal.pone. ... "Pitstop 2 is a potent inhibitor of clathrin-independent endocytosis". PLoS ONE. 7 (9): e45799. doi:10.1371/journal.pone. ...
"Amyloid β-Protein Stimulates Trafficking of Cholesterol and Caveolin-1 from the Plasma Membrane to the Golgi Complex in Mouse ... 62,0 62,1 62,2 62,3 62,4 Kang JE, Lim MM, Bateman RJ, Lee JJ, Smyth LP, Cirrito JR, Fujiki N, Nishino S, Holtzman DM (November ... doi:10.1016/S0169-409X(02)00155-2.. *↑ Vassar R, Bennett BD, Babu-Khan S, Kahn S, Mendiaz EA, Denis P, Teplow DB, Ross S, ... 21,0 21,1 21,2 Ghiso J, Frangione B (December 2002). "Amyloidosis and Alzheimer's disease". Adv. Drug Deliv. Rev. 54 (12): 1539 ...
154 (2): 206-216. doi:10.1016/j.jsb.2006.01.002. ISSN 1047-8477. PMID 16503167.. CS1 maint: multiple names: authors list (link) ...
96 (2): 145-55. doi:10.1113/expphysiol.2010.053975. PMID 20889606.. *^ Parcell AC, Woolstenhulme MT, Sawyer RD (March 2009). " ... It also aids in preventing overstretching of the thick filament, recoiling like a spring whenever a muscle is stretched.[2] ... 23 (2): 359-65. doi:10.1519/JSC.0b013e318198fd62. PMID 19209072.. *^ Gore, Jessica. "Muscle Growth in Bodybuilders". http:// ...
... caveolin, dynamin and actin. Once within the cell the viruses are rapidly delivered to endosomes via vesicular trafficking ... 235 (2): 414-8. doi:10.1006/viro.1997.8722. PMID 9281522.. *^ a b Cao, W.; Henry, M. D.; Borrow, P.; Yamada, H.; Elder, J. H.; ... doi:10.1016/s0166-3542(02)00201-2. PMID 12615304.. *^ a b Yun NE, Walker DH (October 2012). "Pathogenesis of Lassa Fever". ... 2 (2): 151-6. doi:10.1016/j.coviro.2012.01.003. PMC 3758253. PMID 22482712.. ...
"Membrane Localization, Caveolin-3 Association and Rapid Actions of Vitamin D Receptor in Cardiac Myocytes". Steroids 75 (8-9 ... Commun. 253 (2): 358-63. PMID 9878542. doi:10.1006/bbrc.1998.9799.. *↑ 15,0 15,1 15,2 15,3 Puccetti E, Obradovic D, Beissert T ... 11,0 11,1 11,2 11,3 11,4 Kitagawa H, Fujiki R, Yoshimura K, Mezaki Y, Uematsu Y, Matsui D, Ogawa S, Unno K, Okubo M, Tokita A, ... 13,0 13,1 13,2 Ito M, Yuan CX, Malik S, Gu W, Fondell JD, Yamamura S, Fu ZY, Zhang X, Qin J, Roeder RG (March 1999). "Identity ...
At the terminal (2) the vesicle is filled with neurotransmitter. (3) The vesicle is transported to the active zone and docked ... 2] As an action potential propagates down an axon it reaches the axon terminal called the presynaptic bouton. In the ...
... localizes in a lipid raft/caveola and inhibits ERK activation in collaboration with caveolin-1". Genes to Cells. 10 (9): 887-95 ... Lock P, I ST, Straffon AF, Schieb H, Hovens CM, Stylli SS (December 2006). "Spred-2 steady-state levels are regulated by ... 2 Frameshift (c.1048_c1049 delGG, c.149_1152del 4 bp)[9] ...
Vargas L, Nore BF, Berglof A, Heinonen JE, Mattsson PT, Smith CI, Mohamed AJ (March 2002). "Functional interaction of caveolin- ... 245 (2): 337-43. doi:10.1006/bbrc.1998.8420. PMID 9571151.. *^ Yamadori T, Baba Y, Matsushita M, Hashimoto S, Kurosaki M, ... 32 (Pt 2): 326-9. doi:10.1042/BST0320326. PMID 15046600.. *. Hendriks RW, Kersseboom R (2006). "Involvement of SLP-65 and Btk ... which in turn hydrolyzes PIP2, a phosphatidylinositol, into two second messengers, inositol triphosphate (IP3) and ...
2011). "Chapter 2 - Overview of the Microstructure of the Nervous System". Gray's Clinical Neuroanatomy: The Anatomic Basis for ... 2] This sheath has a spindle or "fusiform" shape, hence the name "intrafusal". ...
Although receptors and their ligands can be brought into the cell through a few mechanisms (e.g. caveolin), clathrin-mediated ... 2:43.. *^ Kholodenko BN (June 2003). "Four-dimensional organization of protein kinase signaling cascades: the roles of ... 2] forming a clathrin-coated vesicle that then uncoats and typically fuses to a sorting endosome. Once fused, the endocytosed ...
Frank P, Lisanti M (2004). "Caveolin-1 and caveolae in atherosclerosis: differential roles in fatty streak formation and ...
2. =. muscle volume. ⋅. cos. ⁡. Φ. fiber length. =. muscle mass. ⋅. cos. ⁡. Φ. ρ. ⋅. fiber length. ,. {\displaystyle {\text{ ... 2. =. PCSA. ⋅. cos. ⁡. Φ. .. {\displaystyle {\text{PCSA}}_{2}={\text{PCSA}}\cdot \cos \Phi .}. in a pennate muscle, since cos. ... 2. ⋅. Specific tension. {\displaystyle {\text{Muscle force}}={\text{PCSA}}_{2}\cdot {\text{Specific tension}}}. [7]. Currently ... is always smaller than 1, PCSA2 is always smaller than PCSA. Hence, it cannot be described as the total area of the cross- ...
277(2): H603-9. PMID 10444485.. *^ Moench, I.; Meekhof, K. E.; Cheng, L. F.; Lopatin, A. N. (July 2013). "Resolution of ... The protein amphiphysin-2 is encoded by the gene BIN1 and is responsible for forming the structure of the T-tubule and ensuring ... 277 (5 Pt 2): H1841-1848. doi:10.1152/ajpheart.1999.277.5.H1841. ISSN 0002-9513. PMID 10564138.. ... 2] The inside or lumen of the T-tubule is open at the cell surface, meaning that the T-tubule is filled with fluid containing ...
4 (2): a008342. doi:10.1101/cshperspect.a008342. PMC 3281568 . PMID 22300977.. *^ a b c Ferrari, Roberto. "Healthy versus sick ... 317 (2): 614-9. doi:10.1016/j.ydbio.2008.03.013. PMC 2423416 . PMID 18400219. Archived from the original on 2018-06-05.. ... Kindlin-2 plays a role in developmental elongation during myogenesis.[19] Muscle fiber growth[edit]. Muscle fibers grow when ... Myocytes are long, tubular cells that develop from myoblasts to form muscles in a process known as myogenesis.[2] There are ...
"Membrane Localization, Caveolin-3 Association and Rapid Actions of Vitamin D Receptor in Cardiac Myocytes". Steroids 75 (8-9 ... Commun. 253 (2): 358-63. PMID 9878542. doi:10.1006/bbrc.1998.9799. *^ a b c d Puccetti E, Obradovic D, Beissert T, Bianchini A ... doi:10.1124/pr.58.4.2. *^ Adorini L, Daniel KC, Penna G (2006). "Vitamin D receptor agonists, cancer and the immune system: an ... 2] Kod ljudi, receptor vitamina D je kodiran genom VDR.[3] ...
Caveolin 1. *Caveolin 3. *Collagen, type I, alpha 2. *Complement component 1r ...
Lu, Zhimin; Ghosh, Sourav; Wang, Zhiyong; Hunter, Tony (December 2003). "Downregulation of caveolin-1 function by EGF leads to ... 85 (2): 204-206. ISSN 0340-6245. PMID 11246533.. *^ Assoian, R. K.; Komoriya, A.; Meyers, C. A.; Miller, D. M.; Sporn, M. B. ( ... 13 (2): 97-110. doi:10.1038/nrc3447. PMID 23344542.. *^ Chakrabarti R, Hwang J, Andres Blanco M, Wei Y, Lukačišin M, Romano RA ... 7 (2): 131-142. doi:10.1038/nrm1835. PMID 16493418.. *^ Phua, YL; Martel, N; Pennisi, DJ; Little, MH; Wilkinson, L (April 2013 ...
32 (1-2): 35-40. PMID 1541245.. *^ [1], Peak Performance - Endurance training: understanding your slow twitch muscle fibres ... Another group of cells, the myosatellite cells are found between the basement membrane and the sarcolemma of muscle fibers.[2] ... to the nucleus and leading to the activation of slow-type muscle proteins in cooperation with myocyte enhancer factor 2 (MEF2) ...
... s (/ˈmaɪəsɪn, -oʊ-/[1][2]) are a superfamily of motor proteins best known for their roles in muscle contraction and in a ... 5 (2): 171-2. doi:10.1038/ncb924. PMID 12563277. S2CID 687308.. *^ Lu Q, Ye F, Wei Z, Wen Z, Zhang M (October 2012). " ... 2 (6): 1351-8. doi:10.1093/mp/ssp094. PMID 19995734.. *^ Peremyslov VV, Prokhnevsky AI, Avisar D, Dolja VV (March 2008). "Two ... doi:10.1186/gb-2001-2-7-research0024. PMC 55321. PMID 11516337.. *^ Baluska F, Cvrcková F, Kendrick-Jones J, Volkmann D (May ...
77 (2): 493-501. doi:10.1152/jappl.1994.77.2.493. PMID 8002492.. *^ a b Caiozzo VJ, Baker MJ, Huang K, Chou H, Wu YZ, Baldwin ... The concept was proposed by Charles Scott Sherrington.[2] All muscle fibers in a motor unit are of the same fiber type. When a ... 7 (2): e1000050. doi:10.1371/journal.pbio.1000050. PMC 2637923. PMID 20076726.. ...
相关:一氧化氮合成酶1(英语:NOS1) · 小窝蛋白3(英语:caveolin 3) ... 肌肉(肌細胞)是長型的細胞,其長度從數毫米到十厘米不等,寬
doi:10.1016/S0960-9822(01)00042-2. PMID 11231171.. *^ Seaman MN (Apr 2004). "Cargo-selective endosomal sorting for retrieval to ... 2014 Feb 1;6(2). pii: a016774. doi: 10.1101/cshperspect.a016774. "Retromer: a master conductor of endosome sorting". ... 2) SNX-BAR dimers which consist of SNX1 or SNX2 and SNX5 or SNX6 that facilitates endosomal membrane remodulation and curvature ...
Huynh H, Bottini N, Williams S, Cherepanov V, Musumeci L, Saito K, Bruckner S, Vachon E, Wang X, Kruger J, Chow CW, Pellecchia M, Monosov E, Greer PA, Trimble W, Downey GP, Mustelin T (Sep 2004). "Control of vesicle fusion by a tyrosine phosphatase". Nature Cell Biology. 6 (9): 831-9. doi:10.1038/ncb1164. PMID 15322554 ...
77 (1-2): 43-9. doi:10.1006/geno.2001.6619. PMID 11543631.. *. Wiemann S, Arlt D, Huber W, Wellenreuther R, Schleeger S, Mehrle ...
Fra AM, Mastroianni N, Mancini M, Pasqualetto E, Sitia R (May 1999). "Human caveolin-1 and caveolin-2 are closely linked genes ... "Genomic organization and transcriptional analysis of the human genes coding for caveolin-1 and caveolin-2". Gene. 243 (1-2): 75 ... Caveolin-2 is a protein that in humans is encoded by the CAV2 gene. The protein encoded by this gene is a major component of ... Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer ...
Buy our Caveolin-2 peptide. Ab4929 is a blocking peptide and has been validated in BL. Abcam provides free protocols, tips and ... Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle ... for neutralization and control experiments with the polyclonal antibody that reacts with this product and endogenous caveolin-2 ...
Rabbit polyclonal Caveolin-2 antibody. Validated in WB, IP, IHC, ICC/IF and tested in Mouse, Rat. Cited in 8 publication(s). ... Recently, I purchased rabbit caveolin-1 polyclonal (ab2910) and rabbit caveolin-2 polyclonal (ab2911). caveolin-1 worked ... caveolin-2 was completely absent, which is a little surprising since the literature suggests that caveolin-1 and 2 are co- ... Intestinal Salmonella typhimurium infection leads to miR-29a induced caveolin 2 regulation.. PLoS One 8:e67300 (2013). WB . ...
Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer ... Belongs to the caveolin family.Curated. Phylogenomic databases. evolutionary genealogy of genes: Non-supervised Orthologous ... sp,Q9WVC3,CAV2_MOUSE Caveolin-2 OS=Mus musculus GN=Cav2 PE=1 SV=1 MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQLNSHLKLGFEDLIAEP ... forms a high molecular mass hetero-oligomer with caveolin-1.". Lee H., Park D.S., Wang X.B., Scherer P.E., Schwartz P.E., ...
The lollipop plot above illustrates recurrent (observed in 3 or more out of 4440 TCGA tumor samples from 15 cancer types) and therefore potentially oncogenic missense mutations (click on Show Cancer Mutations). The bar plot below shows the proportion of tumor samples that have any kind of altering mutation(s) in the given protein. ...
... Wladimir Gerstenberger,1 Michaela ... Caveolin-1 (CAV1) and caveolin-2 (CAV2) are integral membrane proteins found in the outer cell membrane called caveolae and in ... D. Kim, H. Kim, and J. S. Koo, "Expression of caveolin-1, caveolin-2 and caveolin-3 in thyroid cancer and stroma," Pathobiology ... using primary mouse monoclonal anti-caveolin-1 (clone 2297) and anti-caveolin-2 (clone 65) antibodies (BD Transduction ...
The migration-stimulated caveolin rear translocation appears to play an important role in endothelial cell polarization and ... When cells are migrating, caveolin-1, the principle protein component of caveolae, is excluded from the leading edge and ... Our results show that wild-type caveolin-1, Cav1-178-GFP, was polarized to the cell rear in migrating caveolin-1 deficient ... suggesting that aa 1-60 were essential for caveolin-1 polarization. Interestingly, deletion of aa 1-60 did not prevent caveolin ...
Compare and order Caveolin 2 ELISA Kits. View citations, images, detection ranges, sensitivity, prices and more. Recommended ... Caveolin 2 Antigen Profile Beschreibung des Gens The protein encoded by this gene is a major component of the inner surface of ... Compare ABIN418644 to our alternative Human Caveolin 2 ELISA Kits Relevance Score. uniqeid. Catalogue Id. Detection Method. ... Caveolin 2 in Regulation of G-Protein Coupled Receptor Protein Signaling * Caveolin 2 in Regulation of G-Protein Coupled ...
Here we show that tyrosine phosphorylation of caveolin-2 (Cav-2) negatively regulates the anti-proliferative function of ... N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in ... N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in ... N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in ...
Recombinant protein of human caveolin 2 (CAV2), transcript variant 1. Human. > 80 % Preparation: Recombint protein was captured ... Background of Caveolin-2 antibody. CAV2 is a major component of the inner surface of caveolae, small invaginations of the ... Caveolin-2 (full length, N-term HIS tag, transcript variant 2). Not available. ... Caveolin 2 antibody immunoprecipitates caveolin 2 protein in IP experiments. IP samples: A549 whole cell extract. A. 30 ug A549 ...
1 for α-caveolin-1/β-caveolin-1/caveolin-2 (summing the major 21- and minor 19-kD spots of caveolin-2) (Fig. 4, top). On the ... sequence identity to caveolin-1 was isolated from caveolin-enriched membranes and termed caveolin-2 (Scherer et al., 1996). ... Effect of anti- caveolin-1 antibodies on ER-to-Golgi (E-G), basolateral (BL), and apical (AP) transport. Anti-caveolin-1 ... α- and β-caveolin-1 are marked by arrowheads. Caveolin-2 is marked by arrows. Filter-grown MDCK cells metabolically labeled ...
Caveolin-2 is an accessory molecule and the binding partner of caveolin-1. Previously, we showed that c-Src expression leads to ... Tyrosine phosphorylation of caveolin-2 at residue 27: differences in the spatial and temporal behavior of phospho-Cav-2 (pY19 ... Phospho-Cav-2 (pY19) is concentrated at cell edges and at cell-cell contacts, whereas phospho-Cav-2 (pY27) is distributed in a ... Cav-2 is phosphorylated at tyrosine 19 in a rapid and transient fashion, whereas phosphorylation at tyrosine 27 is sustained ...
1C) for caveolin-1 and caveolin-3. Caveolin-1 expression appeared to be reduced to various levels in certain Cav-2−/− tissues ( ... Thus, the dyslipidemia observed in caveolin-1-deficient mice is exclusively due to a loss of caveolin-1 and not caveolin-2. ... and anti-caveolin-3 MAb (clone 65). A longer exposure of the same blot is also shown. Both caveolin-1 and caveolin-3 are ... Induction of caveolin during adipogenesis and association of GLUT4 with caveolin-rich vesicles. J. Cell Biol. 127:1233-1243. ...
Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). Validated for ELISA, ... Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). Validated for ELISA, ... Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). Validated for ELISA, ...
Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and ... Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and ... Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and ... Caveolin-1 (CAV-1) plays important roles in many aspects of cellular biology, including vesicular transport, cholesterol ...
Caveolin 2 antibody LS-C481421 is a biotin-conjugated rabbit polyclonal antibody to Caveolin 2 (CAV2) from human, mouse, rat ... CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. Antibody concentration 1 ug/ml. This image was taken for the ... CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. Antibody concentration 1 ug/ml. This image was taken for the ... CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. Antibody concentration 1 ug/ml. This image was taken for the ...
Caveolin-1 knockdown inhibited the EPC proliferative and adherent abilities. The AT+RT group showed higher levels of caveolin-1 ... We then explored the effect of caveolin-1 knockdown (lentiviral vector with caveolin-1-siRNA) on the proliferation and ... Combined AT and RT is an effective way to improve EPC function through upregulation of caveolin-1 in mice with type 2 diabetes. ... adherence of EPCs and the concentration of caveolin-1 and PI3K/AKT via western blot analyses. Compared to the mice in the ...
The caveolin gene family has three members in vertebrates: CAV1, CAV2, and CAV3, coding for the proteins caveolin-1, caveolin-2 ... There are two isoforms of caveolin-1: caveolin-1α and caveolin-1β, the latter lacking a part of the N-terminus. ... Caveolin-1 has also been shown to play a role in the integrin signaling. The tyrosine phosphorylated form of caveolin-1 ... Genetically engineered mice that lack caveolin-1 and caveolin-2 are viable and fertile, showing that neither the caveolins nor ...
On the other hand, microarray analysis of HT29 and HT29 MTX resistant cells unveiled overexpression of caveolin 1, enolase 2 ... We provide functional evidences indicating that caveolin 1 and E-cadherin, deregulated in MTX resistant cells, may play a ... Combined treatments targeting siRNA inhibition of caveolin 1 and overexpression of E-cadherin markedly reduced cell viability ... The union is performed between the caveolin 1 scaffolding domain peptide and PKCα caveolin 1 binding motif [59]. Further, ...
Caveolin-1, Cellular Senescence, Fibroblasts, Insulin, Mutations, ATP, Mutation, and Blood ... Detection of caveolin-3/caveolin-1/P2X7R complexes in mice atrial cardiomyocytes in vivo and in vitro. Abstract ... Caveolin-1 is required for vascular endothelial insulin uptake. < 0.05 for each). Over-expression of caveolin-1 increased ... Knockdown of caveolin-1 also inhibited insulin-induced caveolin-1 and IGF-1 receptor translocation to the plasma membrane. ...
Mammals have three caveolin proteins:caveolin-1 (Cav-1, or VIP21), caveolin-2 and caveolin-3 (or M-caveolin). Various classes ... Evaluating caveolin interactions: do proteins interact with the caveolin scaffolding domain through a widespread aromatic ... Caveolae require the caveolin protein for formation. Caveolins may act as scaffolding proteins within caveolar membranes by ...
"ウサギ・ポリクローナル抗体 ab3417 交差種: Ms,Rat,Hu 適用: WB,IP,IHC-P,ICC,ICC/IF…Caveolin-2抗体一覧…画像、プロトコール、文献など ... Synthetic peptide corresponding to Mouse Caveolin-2 aa 14-25.. Sequence: MADDAYpSHHSGC (Peptide available as ab4962). Run BLAST ... Fatty acylated caveolin-2 is a substrate of insulin receptor tyrosine kinase for insulin receptor substrate-1-directed ... Immunocytochemistry/ Immunofluorescence - Anti-Caveolin-2 (phospho Y19) antibody (ab3417)Image courtesy of Y Pak by
... within caveolin-1 molecule. Molecules that interact with caveolin-1 contain caveolin-binding motifs (CBM). Caveolin GRCh38: ... Fra AM, Mastroianni N, Mancini M, Pasqualetto E, Sitia R (March 1999). "Human caveolin-1 and caveolin-2 are closely linked ... caveolin. Caveolin binding negatively regulates the auto-activation of Src tyrosine kinases". The Journal of Biological ... Caveolin-1 is a protein that in humans is encoded by the CAV1 gene. The scaffolding protein encoded by this gene is the main ...
... wild-type caveolin-3 protein stained with the anti-caveolin-3 or anti-c-myc mAb was similar to that of endogenous caveolin-3 ... wild-type caveolin-3 protein stained with anti-caveolin-3 or anti-c-myc mAb was similar to that of endogenous caveolin-3 ... In cardiomyocytes, caveolin-3 is the dominant isotype.3 Caveolin-3 is critical for normal muscle function. It is involved in ... Thus, caveolin-3 might act as an inhibitor of myocyte hypertrophy. The effects of overexpression of wild-type caveolin-3 were ...
Delivery of cell permeable caveolin-1 scaffolding domain reduced the occludin protein level. Over all, these results suggest ... Delivery of cell permeable caveolin-1 scaffolding domain reduced the occludin protein level. Over all, these results suggest ... Delivery of cell permeable caveolin-1 scaffolding domain reduced the occludin protein level. Over all, these results suggest ... Delivery of cell permeable caveolin-1 scaffolding domain reduced the occludin protein level. Over all, these results suggest ...
Caveolin-1 regulates nitric oxide-mediated matrix metalloproteinases activity and blood-brain barrier permeability in focal ... and cytosolic translocation of caveolin-1 (Cav-1). This same OGD treatment also led to rapid degradation of tight junction ... Using selective MMP-2/9 inhibitor SB-3CT (2-[[(4-phenoxyphenyl)sulfonyl]methyl]-thiirane) or their neutralizing antibodies or ... Matrix metalloproteinase-2 and -9 secreted by leukemic cells increase the permeability of blood-brain barrier by disrupting ...
2001) Caveolin-1 and caveolin-2 expression in mouse macrophages. High density lipoprotein 3-stimulated secretion and a lack of ... 2013) Caveolin isoform switching as a molecular, structural, and metabolic regulator of microglia. Mol Cell Neurosci 56:283-297 ... 2001) Caveolin-1 null mice are viable but show evidence of hyperproliferative and vascular abnormalities. J Biol Chem 276:38121 ... Caveolin-1 (Cav-1) is a major structural protein of caveolae found in cell membranes and is critical for numerous cellular ...
Expression of caveolin-3 in skeletal, cardiac, and smooth muscle cells: caveolin-3 is a component of the sarcolemma and co- ... Aberrant dysferlin trafficking in cells lacking caveolin or expressing dystrophy mutants of caveolin-3. Hum. Mol. Genet. 15, ... For caveolin-3 expression, immortalized WT and P28L myoblasts were transduced with lentiviral vectors expressing WT caveolin-3 ... Way, M. & Parton, G. M-caveolin, a muscle-specific caveolin-related protein. FEBS Lett. 376, 108-112 (1995). ...
Expression of caveolin-3 in skeletal, cardiac, and smooth muscle cells. Caveolin-3 is a component of the sarcolemma and co- ... Caveolin-1 regulation of store-operated Ca2+ influx in human airway smooth muscle. Venkatachalem Sathish, Amard J. Abcejo, ... Antifibrotic properties of caveolin-1 scaffolding domain in vitro and in vivo. Am J Physiol Lung Cell Mol Physiol 2008; 294: ... Caveolin-1 and force regulation in porcine airway smooth muscle. Am J Physiol Lung Cell Mol Physiol 2011; 300; L920-L929. ...
B) Caveolin expression in NIH v-Src cells, treated with siRNA against caveolin, was evaluated by western blotting of whole-cell ... The presence of caveolin negatively regulates bacterial internalization. (A) Wild-type (CavWT) or caveolin-1-deficient (Cav1−/− ... Caveolin-1 interferes with membrane protein mobility and blocks integrin-mediated uptake of S. aureus. Caveolin-1 has ... S6). To investigate the role of caveolin, we used a fibroblast line derived from caveolin-1-deficient mice (Cav1−/− cells) ( ...
  • The expression of caveolin-1 (CAV1) in both tumor cell and cancer-associated fibroblasts (CAFs) has been found to correlate with tumor aggressiveness in different epithelial tumor entities, whereas less is known for caveolin-2 (CAV2). (hindawi.com)
  • Caveolin-1 (CAV1) and caveolin-2 (CAV2) are integral membrane proteins found in the outer cell membrane called caveolae and in other intracellular membranes of the endoplasmic reticulum, Golgi apparatus, and transport vesicles [ 1 , 2 ]. (hindawi.com)
  • Our results show that wild-type caveolin-1, Cav1-178-GFP, was polarized to the cell rear in migrating caveolin-1 deficient mouse embryonic fibroblasts (MEFs). (cdc.gov)
  • Caveolin-1 is a protein that in humans is encoded by the CAV1 gene. (wikipedia.org)
  • Whereas dominant-negative versions of flotillin-2 did not affect bacterial attachment or internalization, cells deficient for caveolin-1 ( Cav1 −/− ) showed increased uptake of S. aureus and other Fn-binding pathogens. (biologists.org)
  • We found that loss of emp2 in zebrafish upregulated caveolin-1 (cav1), a major component of caveolae, in embryos and adult mesonephric glomeruli and exacerbated podocyte injury. (umich.edu)
  • Caveolin-1 or CAV1 is a scaffolding proteins within caveolar membranes. (thermofisher.com)
  • Caveolae and their structural protein caveolin 1 (CAV1) have roles in cellular lipid processing and systemic lipid metabolism. (biologists.org)
  • Frequency of common polymorphisms in Caveolin 1 (CAV1) gene in adults with high serum triglycerides from Colombian Caribbean Coast. (univalle.edu.co)
  • Caveolin 1 gene (CAV1) has been associated with insulin resistance, metabolic syndrome and hypertension in humans. (univalle.edu.co)
  • Interplay Between Statins, Cav1 (Caveolin-1), and Aldosterone. (harvard.edu)
  • The protein levels of caveolin‑1 (Cav‑1) and copper-zinc superoxide dismutase (SOD)1 were determined by western blotting, and the interaction of Cav1 and HSC70 was investigated by co‑immunoprecipitation experiments. (spandidos-publications.com)
  • Caveolin-1 (Cav1) is an important component of caveolae and is known to function as a scaffolding protein in the regulation of several signaling pathways ( 7 - 9 ). (spandidos-publications.com)
  • Both proteins are also found as soluble proteins [ 2 , 3 ] and are expressed in fibroblasts, endothelial cells, lipocytes, and in type I pneumocytes [ 4 , 5 ]. (hindawi.com)
  • In the present study, we generated a series of domain deletion mutants of caveolin-1 as GFP-fusion proteins and investigated domain or sequence that was required for caveolin-1 polarization in migrating cells. (cdc.gov)
  • Three SH2 domain-containing proteins, c-Src, Nck, and Ras-GAP, were found to associate with Cav-2 in a phosphorylation-dependent manner. (uniprot.org)
  • In an effort to discover other novel resident proteins of caveolae, Scherer and colleagues identified a second caveolin homologue through the microsequencing of purified adipocyte caveolar membranes. (asm.org)
  • Mammals have three caveolin proteins:caveolin-1 (Cav-1, or VIP21), caveolin-2 and caveolin-3 (or M-caveolin). (ebi.ac.uk)
  • Evaluating caveolin interactions: do proteins interact with the caveolin scaffolding domain through a widespread aromatic residue-rich motif? (ebi.ac.uk)
  • It has been reported that molecules involved in cardiac hypertrophic responses are concentrated in caveolae, eg, G proteins, extracellular signal-regulated kinases (ERKs), Src family kinases, Ras, and protein kinase C. 1,4 We have reported that caveolin-3 is upregulated in hypertrophied cardiomyocytes induced by phenylephrine (PE). (ahajournals.org)
  • Matrix metalloproteinase-2 and -9 secreted by leukemic cells increase the permeability of blood-brain barrier by disrupting tight junction proteins. (qxmd.com)
  • Caveolae, plasma membrane invaginations with constitutive caveolin proteins, harbour proteins involved in intracellular calcium ([Ca 2+ ] i ) regulation. (ersjournals.com)
  • Caveolae are flask-shaped plasma membrane invaginations expressing the scaffolding caveolin proteins-1 to -3 [ 1 , 2 ], as well as a variety of proteins important in signal transduction [ 3 ]. (ersjournals.com)
  • We and others have demonstrated that human airway smooth muscle (ASM) cells express caveolin-1 (Cav-1), and that ASM caveolae contain a number of proteins involved in regulation of intracellular Ca 2+ ([Ca 2+ ] i ) [ 6 - 8 ]. (ersjournals.com)
  • Several membrane-microdomain-associated proteins, such as flotillin-1 and flotillin-2, as well as caveolin, were recruited to sites of bacterial attachment. (biologists.org)
  • However, fluorescence recovery after photobleaching (FRAP) revealed an enhanced mobility of membrane-microdomain-associated proteins in the absence of caveolin-1. (biologists.org)
  • Caveolin interacts with and regulates heterotrimeric G-proteins. (novusbio.com)
  • Currently, there are three members of the caveolin multigene family which are known to encode 21-24 kDa integral membrane proteins that comprise the major structural component of the caveolar membrane in vivo. (novusbio.com)
  • This is specific for caveolin alpha and beta proteins. (novusbio.com)
  • Caveolin-2 is another member of the caveolin family of proteins that is present in caveolae, but of unknown function. (springer.com)
  • Nevertheless, this second caveolin protein can now be added to the small number of host proteins that are associated with the inclusions of this obligate intracellular pathogen. (springer.com)
  • Implications for the interaction of caveolin with caveolae-associated proteins. (biologists.org)
  • Numerous studies have demonstrated that caveolin scaffolding domain binding inhibits the function of multiple caveolar proteins involved in cell growth and proliferation. (ahajournals.org)
  • Only a subset of additional caveolar components (cavin-2 and EHD2) are present at sites of bacterial transfer, and although clathrin and the clathrin-associated proteins Eps15 and AP2 are absent from the bacterial invaginations, efficient L. monocytogenes spreading requires the clathrin-interacting protein epsin-1. (asm.org)
  • 144 caveolin proteins are present in a single caveola ( Parton and Simons, 2007 ). (biologists.org)
  • The proteomic data indicated that PLB inhibited cell proliferation, activated death receptor-mediated apoptotic pathway, remodeled epithelial adherens junctions pathway, and manipulated nuclear factor erythroid 2-related factor 2 (Nrf2)-mediated oxidative stress response signaling pathway in SCC25 cells with the involvement of a number of key functional proteins. (dovepress.com)
  • The list of identified MMP-2 substrates continues to grow and includes sarcomeric proteins, membrane receptors, cytokines, and growth factors. (springer.com)
  • Three proteins, caveolin-1, caveolin-2 and caveolin-3 have been identified as principle components of caveolae. (creativebiomart.net)
  • Caveolae and lipid rafts are related microdomains of the plasma membrane that are enriched in cholesterol, sphingolipids, and many signaling proteins ( 1 , 2 ). (sciencemag.org)
  • Another route for CIE occurs through the lipid raft-associated proteins, flotillin-1 and -2 which form noncaveolar microdomains highly expressed in neurones (16-17). (deepdyve.com)
  • Caveolin-2 is a protein that in humans is encoded by the CAV2 gene. (wikipedia.org)
  • Caveolin 2 antibody LS-C498386 is an unconjugated rabbit polyclonal antibody to human Caveolin 2 (CAV2). (lsbio.com)
  • Caveolin 2 antibody LS-C481421 is a biotin-conjugated rabbit polyclonal antibody to Caveolin 2 (CAV2) from human, mouse, rat and other species. (lsbio.com)
  • CAV2 / Caveolin 2 antibody Western blot of Fetal Lung lysate. (lsbio.com)
  • Here we show that tyrosine phosphorylation of caveolin-2 (Cav-2) negatively regulates the anti-proliferative function of transforming growth factor beta (TGF-beta) in endothelial cells. (nih.gov)
  • Caveolin-1 regulates nitric oxide-mediated matrix metalloproteinases activity and blood-brain barrier permeability in focal cerebral ischemia and reperfusion injury. (qxmd.com)
  • Calycosin-7-O- β -d-glucoside regulates nitric oxide /caveolin-1/matrix metalloproteinases pathway and protects blood-brain barrier integrity in experimental cerebral ischemia-reperfusion injury," Journal of Ethnopharmacology , vol. 155, no. 1, pp. 692-701, 2014. (hindawi.com)
  • Consequently, MMP-2 regulates a vast range of physiological processes, from angiogenesis to wound healing and tissue remodeling. (springer.com)
  • A functional activating protein 1 (AP-1) site regulates matrix metalloproteinase 2 (MMP-2) transcription by cardiac cells through interactions with JunB-Fra1 and JunB-FosB heterodimers. (springer.com)
  • Caveolin-1 selectively regulates microRNA sorting into microvesicles after noxious stimuli. (harvard.edu)
  • Caveolin-1 Regulates Atherogenesis by Attenuating Low-Density Lipoprotein Transcytosis and Vascular Inflammation Independently of Endothelial Nitric Oxide Synthase Activation. (harvard.edu)
  • Caveolin-1 regulates lung cancer stem-like cell induction and p53 inactivation in carbon nanotube -driven tumorigenesis. (cdc.gov)
  • This peptide may be used for neutralization and control experiments with the polyclonal antibody that reacts with this product and endogenous caveolin-2, catalog ab2911 . (abcam.com)
  • This antibody does not detect caveolin-1 or -3. (abcam.com)
  • Western blot analysis of extracts from HepG2 cells treated with EGF 200ng/ml 5' , using Caveolin 2 (Phospho-Tyr27) Antibody. (acris-antibodies.com)
  • Immunohistochemical analysis of paraffin-embedded FaDu xenograft, using Caveolin 2(TA308863) antibody at 1:500 dilution. (acris-antibodies.com)
  • Caveolin 2 antibody detects Caveolin 2 protein at membrane by immunofluorescent analysis. (acris-antibodies.com)
  • Green: Caveolin 2 protein stained by Caveolin 2 antibody (TA308863) diluted at 1:500. (acris-antibodies.com)
  • Caveolin 2 antibody immunoprecipitates caveolin 2 protein in IP experiments. (acris-antibodies.com)
  • To further investigate the tyrosine phosphorylation of Cav-2, we have now generated a novel phospho-specific antibody directed against phospho-Cav-2 (pY27). (uniprot.org)
  • Flow Cytometry: Caveolin-1 Antibody (7C8) [Allophycocyanin] [NB100-615APC] - An intracellular stain was performed on HeLa cells with Caveolin-1 Antibody (7C8) NB100-615APC (blue) and a matched isotype control (orange). (novusbio.com)
  • This Caveolin 1 antibody is useful for Flow Cytometry, Western blot, Immunocytochemistry/Immunofluorescence, Immunoprecipitation and Immunohistochemistry-paraffin embedded sections. (novusbio.com)
  • The following product was used in this experiment: Caveolin 1 Polyclonal Antibody from Thermo Fisher Scientific, catalog # PA5-17447, RRID AB_10985023. (thermofisher.com)
  • This antibody is not cross-reactive with caveolin-2 or -3. (thermofisher.com)
  • They are involved in various mechanisms like membrane trafficking as well as signal transduction and gene regulation of cell growth and apoptosis [ 2 , 6 - 8 ]. (hindawi.com)
  • Caveolin-1 is present on both the apical and basolateral plasma membrane, whereas caveolin-2 is enriched on the basolateral surface where caveolae are present. (rupress.org)
  • This suggests that caveolin-1 and -2 heterooligomers are involved in caveolar biogenesis in the basolateral plasma membrane. (rupress.org)
  • In contrast, smaller caveolin-1/-2 heterooligomers are routed to the basolateral membrane where caveolin-2 is enriched and caveolar structures are found. (rupress.org)
  • In the absence of caveolin-2 protein expression, caveolae still form and caveolin-1 maintains its localization in plasma membrane caveolae, although in certain tissues caveolin-1 is partially destabilized and shows modestly diminished protein levels. (asm.org)
  • Despite an intact caveolar membrane system, the Cav-2-null lung parenchyma shows hypercellularity, with thickened alveolar septa and an increase in the number of endothelial cells. (asm.org)
  • Caveolin forms oligomers and associates with cholesterol and sphingolipids in certain areas of the cell membrane , leading to the formation of caveolae . (wikipedia.org)
  • Src tyrosine kinases, Galpha subunits, and H-Ras share a common membrane-anchored scaffolding protein, caveolin. (wikipedia.org)
  • Caveolae are cup-shaped plasma membrane invaginations that were first observed in the 1950s by Palade and Yamada on electron micrographs from vascular and gall bladder tissues 1 , 2 . (nature.com)
  • Enhanced membrane microdomain mobility and increased uptake of S. aureus was repressed by expression of wild-type caveolin-1, but not caveolin-1 G83S, which harbors a point mutation in the caveolin scaffolding domain. (biologists.org)
  • These results highlight a crucial role for caveolin-1 in negative regulation of membrane microdomain mobility, thereby affecting endocytosis of bacteria-engaged integrins. (biologists.org)
  • The NH 2 - and COOH-terminal domains appeared to be related to membrane binding and exit from ER, respectively, implying that caveolin-2 is synthesized and transported to LD as a membrane protein. (fujita-hu.ac.jp)
  • Loss of Epithelial Membrane Protein 2 Aggravates Podocyte Injury via Upregulation of Caveolin-1. (umich.edu)
  • We previously identified mutations in epithelial membrane protein 2 (EMP2) as a monogenic cause of this disease. (umich.edu)
  • We looked for mutations in the caveolin-1 gene, encoding a critical molecule for membrane signaling to cell growth, in 92 primary human breast cancers, and we report here the identification of a mutation in caveolin-1 at codon 132 (P132L) in 16% of cases. (aacrjournals.org)
  • This site is evolutionarily conserved from worms to man, providing evidence that this region of the membrane-spanning domain is critical for Caveolin function. (aacrjournals.org)
  • Caveolin knockdown significantly decreased Gα s localization in detergent insoluble lipid raft/caveolae membrane fractions, suggesting that caveolin localizes a portion of Gα s to these membrane microdomains. (aspetjournals.org)
  • Glenney JR Jr, Soppet D. Sequence and expression of caveolin, a protein component of caveolae plasma membrane domains phosphorylated on tyrosine in Rous sarcoma virus-transformed fibroblasts. (univalle.edu.co)
  • Moreover, we show that the exocyst inhibitor endosidin-2 (ES2) and a heterozygous knockout of EXOC5 in skeletal myoblast cells both lead to impaired GLUT4 trafficking to the plasma membrane and hinder glucose uptake in response to an insulin stimulus. (medworm.com)
  • Hughes BG, Fan X, Cho WJ, Schulz R. MMP-2 is localized to the mitochondria-associated membrane of the heart. (springer.com)
  • Caveolae are invaginations of the plasma membrane, located in ordered lipid raft domains (13) and enriched with caveolin-1, -2, or -3 (11,14). (deepdyve.com)
  • A major advance in the study of caveolae was the discovery of the 21- to 24-kDa caveolar marker protein named caveolin (now called caveolin-1) ( 38 ). (asm.org)
  • The functional role of caveolin-1 is now a primary focus of the caveolar research field. (asm.org)
  • Genetically engineered mice that lack caveolin-1 and caveolin-2 are viable and fertile, showing that neither the caveolins nor the caveolae are essential in embryonic development or reproduction of these animals. (wikipedia.org)
  • Caveolins 1 and 2 co-localize and form a stable hetero-oligomeric complex in vivo," The Journal of Biological Chemistry , vol. 272, no. 46, pp. 29337-29346, 1997. (hindawi.com)
  • The epitope-tagged and overexpressed caveolin-2 colocalized with caveolin-1 in fibroblasts, as judged by immunofluorescence microscopy. (rupress.org)
  • Caveolin-1 and -2 are coexpressed and abundantly expressed in adipocytes, endothelial cells, and fibroblasts. (ahajournals.org)
  • Caveolin-2 protein is abundantly expressed in fibroblasts and differentiated adipocytes, smooth and skeletal muscle, and endothelial cells. (novusbio.com)
  • Increased abundance of cytoplasmic and nuclear caveolin 1 in human diploid fibroblasts in H(2)O(2)-induced premature senescence and interplay with p38alpha(MAPK). (unamur.be)
  • Haines P, Samuel GH, Cohen H, Trojanowska M and Bujor AM: Caveolin-1 is a negative regulator of MMP-1 gene expression in human dermal fibroblasts via inhibition of Erk1/2/Ets1 signaling pathway. (spandidos-publications.com)
  • Caveolin-1 (Cav-1) expression deficiency and autophagy in tumor stromal fibroblasts (hereafter fibroblasts) are involved in tumor proliferation and progression, particularly in breast and prostate cancer. (mdpi.com)
  • Caveolin-2 is a member of the caveolin gene family with no known function. (asm.org)
  • When cells are migrating, caveolin-1, the principle protein component of caveolae, is excluded from the leading edge and polarized to the cell rear. (cdc.gov)
  • In the TGN caveolin-1/-2 heterooligomers are sorted into basolateral vesicles, whereas larger caveolin-1 homooligomers are targeted to the apical side. (rupress.org)
  • 11 However, the role of caveolin-3 in cardiomyocyte hypertrophy still remains unknown: it might promote hypertrophy, might inhibit hypertrophy, or might simply be a consequence of hypertrophy. (ahajournals.org)
  • We also examined the role of Caveolin-1 in the pathogenesis of PVR. (arvojournals.org)
  • 9 , 10 However, the role of caveolin in APN transmembrane signaling, ie, functioning as either an inhibitor or activator, has never been previously investigated. (ahajournals.org)
  • Therefore, the aims of the present study were to (1) determine the role of caveolin-3 (Cav-3) (the predominant form of caveolin expressed in cardiomyocytes) in the cardioprotective actions of APN, and (2) investigate the molecular mechanisms responsible for Cav-3 regulation of APN transmembrane signaling. (ahajournals.org)
  • Ma X, Liu L, Nie W, Li Y, Zhang B, Zhang J and Zhou R: Prognostic role of caveolin in breast cancer: A meta-analysis. (spandidos-publications.com)
  • IDIBAPS researchers studied the role of caveolin-1 in this process, comparing the regenerative capacity of normal mice and modified mice, which do not express the caveolin-1 gene. (psychcentral.com)
  • Role of Caveolin-1 in carbon nanotube -induced stem-like cells and tumorigenesis. (cdc.gov)
  • Cav-1 and Cav-2 genes map to a known tumor suppressor locus (6-A2/ 7q31). (biologists.org)
  • Tumor stroma is increasingly recognized as an active participant in tumor progression, metastasis and drug resistance [ 1 , 2 ]. (mdpi.com)
  • Replication Study: Biomechanical remodeling of the microenvironment by stromal caveolin-1 favors tumor invasion and metastasis. (harvard.edu)
  • These CSCs, which were found to overexpress tumor promoter caveolin-1 (Cav-1), displayed aggressive cancer phenotypes of apoptosis resistance and enhanced cell invasion and migration compared with their non-CSC counterpart. (cdc.gov)
  • Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) corresponding to Human Caveolin-2 aa 1-100. (abcam.cn)
  • 1999 ). Sequence and detailed organization of the human caveolin-1 and-2 genes located near the D7S522 locus (7q31. (biologists.org)
  • b , DNA sequence and restriction enzyme sites corresponding to around the Pro-132 in caveolin-1 are shown. (aacrjournals.org)
  • PGHS-2 is a sequence homodimer. (wikipedia.org)
  • Src-induced phosphorylation of caveolin-2 on tyrosine 19. (wikipedia.org)
  • N-terminal tyrosine phosphorylation of caveolin-2 negates anti-proliferative effect of transforming growth factor beta in endothelial cells. (nih.gov)
  • This differential effect of tyrosine and serine phosphorylation mutants of Cav-2 correlated with TGF-beta-induced Smad3 phosphorylation and transcriptional activation of plasminogen activator inhibitor-1. (nih.gov)
  • Effect of TGF-β on proliferation of Cav-2 KO MLECs re-expressing WT and phosphorylation-deficient mutants of Cav-2. (nih.gov)
  • Tyrosine phosphorylation of caveolin-2 at residue 27: differences in the spatial and temporal behavior of phospho-Cav-2 (pY19 and pY27). (uniprot.org)
  • Previously, we showed that c-Src expression leads to the tyrosine phosphorylation of Cav-2 at position 19. (uniprot.org)
  • We reconstituted this phosphorylation event by recombinantly coexpressing c-Src and Cav-2. (uniprot.org)
  • Recombinant expression of these mutants in Cos-7 cells demonstrated that neither tyrosine is the unique phosphorylation site, and that double mutation of tyrosines 19 and 27 to alanine abrogates Cav-2 tyrosine phosphorylation. (uniprot.org)
  • Further functional analysis revealed that tyrosine phosphorylation of Cav-2 has no effect on its targeting to lipid rafts, but clearly disrupts the hetero-oligomerization of Cav-2 with Cav-1. (uniprot.org)
  • In an attempt to identify upstream mediators, we investigated Cav-2 tyrosine phosphorylation in an endogenous setting. (uniprot.org)
  • We found that in A431 cells, EGF stimulation is sufficient to induce Cav-2 phosphorylation at tyrosines 19 and 27. (uniprot.org)
  • Cav-2 is phosphorylated at tyrosine 19 in a rapid and transient fashion, whereas phosphorylation at tyrosine 27 is sustained over time. (uniprot.org)
  • In contrast, Ad.Cav-3Δ significantly augmented hypertrophic responses to ET, which were associated with increased ET-induced phosphorylation of ERK1/2. (ahajournals.org)
  • Phosphorylation status of 72 kDa MMP-2 determines its structure and activity in response to peroxynitrite. (springer.com)
  • 1995 ). A photo-reactive derivative of ganglioside GM1 specifically cross-links VIP21-caveolin on the cell surface. (biologists.org)
  • On the other hand, microarray analysis of HT29 and HT29 MTX resistant cells unveiled overexpression of caveolin 1, enolase 2 and PKCα genes in resistant cells without concomitant copy number gain. (biomedcentral.com)
  • Four isotypes encoded in 3 different genes have been identified (caveolin-1α and -1β, caveolin-2, and caveolin-3). (ahajournals.org)
  • The down-regulated genes included caveolin 1 and 2, and TIMP3. (nih.gov)
  • Molecular cloning had identified three distinct caveolin genes (1 , 2 , 3 , 4) caveolin-1 , caveolin-2 , and caveolin-3 . (aacrjournals.org)
  • Parental NIH3T3 cells were transfected, with the mutant or wild-type caveolin-1 genes introduced into pcDNA3 expression vector using a lipofection protocol. (aacrjournals.org)
  • Interestingly, deletion of aa 1-60 did not prevent caveolin-1 polarization in HUVECs as well as wild-type MEFs, suggesting that Cav61-178-GFP mutant might be interacting with endogenous caveolin-1 during polarization. (cdc.gov)
  • Consistent with this, Cav61-178-GFP and Cav61-178-Flag were co-immunoprecipitated with endogenous caveolin-1. (cdc.gov)
  • In this paper we have analyzed the routing and biochemical characteristics of endogenous, newly synthesized caveolin-1 and -2 in MDCK cells. (rupress.org)
  • To investigate whether caveolin-1 (cav-1) may modulate inducible nitric oxide synthase (iNOS) function in intact cells, the human intestinal carcinoma cell lines HT29 and DLD1 that have low endogenous cav-1 levels were transfected with cav-1 cDNA. (semanticscholar.org)
  • Oligomers can also be produced from in vitro-synthesized caveolin-1 after translocation into microsomal membranes. (rupress.org)
  • Moreover, caveolin-2 appears to be specifically, or indirectly, associated with the pathogens at the inclusion membranes. (springer.com)
  • Furthermore, forskolin- and aluminum tetrafluoride-stimulated adenylyl cyclase activity was significantly increased by caveolin knockdown in cells or in brain membranes obtained from caveolin-1 knockout mice, indicating that caveolin attenuates signaling at the level of Gα s /adenylyl cyclase and distal to GPCRs. (aspetjournals.org)
  • Figure 2: Annexin assemblies on membranes. (nature.com)
  • Caveolin-1 interacts with androgen receptor. (wikipedia.org)
  • The caveolin scaffolding domain interacts with several signaling molecules, sequestering them in the absence of activating signals, and thereby reducing the signal-to-noise ratio. (biologists.org)
  • Santibanez JF, Blanco FJ, Garrido-Martin EM, Sanz-Rodriguez F, del Pozo MA and Bernabeu C: Caveolin-1 interacts and cooperates with the transforming growth factor-beta type I receptor ALK1 in endothelial caveolae. (spandidos-publications.com)
  • 1] "Molecular cloning and developmental expression of the caveolin gene family in the amphibian Xenopus laevis. (tcdb.org)
  • 1998 ). Chromosomal localization, genomic organization and developmental expression of the murine caveolin gene family (Cav-1,-2 and-3). (biologists.org)
  • b Growth curves of the EPCs after knockdown of caveolin-1. (biomedcentral.com)
  • The alpha-smooth muscle actin (αSMA) expression and migration ability were increased in RPE cells with knockout or knockdown of Caveolin-1 , whereas zonula occludens-1 (ZO-1) immunohistochemistry showed reduced morphology and expression of ZO-1. (arvojournals.org)
  • Lipid rafts/caveolae were disrupted in C6 cells by either short-term cholesterol chelation using methyl-β-cyclodextrin or by stable knockdown of caveolin-1 and -2 by RNA interference. (aspetjournals.org)
  • however, this trafficking was blocked by methyl-β-cyclodextrin or by caveolin knockdown. (aspetjournals.org)
  • Methyl-β-cyclodextrin or caveolin knockdown significantly increased isoproterenol or thyrotropin-stimulated cAMP accumulation. (aspetjournals.org)
  • Conversely, mRNA expression of caveolin 1, Ube2e3, and ET-1, all negative effectors of epithelial sodium channel, was induced after Per1 knockdown. (ahajournals.org)
  • The molecular mechanisms underlying caveolin-associated diseases are still poorly understood. (nature.com)
  • High serum MiR-130a levels are associated with severe perihematomal edema and predict adverse outcome in acute ICH," Molecular Neurobiology , vol. 53, no. 2, pp. 1310-1321, 2016. (hindawi.com)
  • 2 - 5 However, knowledge of the molecular mechanisms responsible for APN-induced cardiomyocyte protection against MI injury remains elusive. (ahajournals.org)
  • Publication date: Available online 22 November 2019Source: Biochimica et Biophysica Acta (BBA) - Molecular Basis of DiseaseAuthor(s): Oktawia Nilsson, Rita Del Giudice, Mototsugu Nagao, Caitriona Grönberg, Lena Eliasson, Jens O. LagerstedtAbstractThe increase of plasma levels of high-density lipoproteins and Apolipoprotein A-I (ApoA-I), its main protein component, has been shown to have a positive action on glucose disposal in type 2 diabetic patients. (medworm.com)
  • PTGS2 (COX-2) exists as a homodimer, each monomer with a molecular mass of about 70 kDa. (wikipedia.org)
  • 2 , 3 Although these clinical correlations have been established, the underlying molecular mechanisms are poorly understood. (ahajournals.org)
  • WT-Cav-2, S23/36A-Cav-2, and Y19/27F-Cav-2 MLECs were plated at 3 × 10 5 cells onto 150 mm dishes, 24 h later incubated without or with TGF-β (1 ng/ml) for additional 48 h, lysed and processed for SDS-PAGE and immunoblotting with indicated antibodies as described in Section 2. (nih.gov)
  • Anti-caveolin-1 antibodies inhibit the apical delivery of influenza virus hemagglutinin without affecting basolateral transport of vesicular stomatitis virus G protein. (rupress.org)
  • Apical but not basolateral exocytosis can be inhibited with caveolin-1 antibodies, suggesting that two different caveolin complexes function in TGN to surface transport. (rupress.org)
  • Using selective MMP-2/9 inhibitor SB-3CT (2-[[(4-phenoxyphenyl)sulfonyl]methyl]-thiirane) or their neutralizing antibodies or Cav-1 siRNA, we found that MMP-2 was the major enzyme mediating OGD-induced occludin degradation, while Cav-1 was responsible for claudin-5 redistribution. (qxmd.com)
  • In cardiomyocytes, caveolin-3 might be involved in the regulation of channel functions. (ahajournals.org)
  • Over all, these results suggest that ClC- 2 enhances TJ barrier function in intestinal epithelial cells via regulation of caveolin-1 and caveolae-mediated trafficking of occludin. (elsevier.com)
  • Down-regulation of caveolin-1 protein expression leads to deregulated signaling and consequently tumorigenesis, whereas naturally occurring dominant-negative caveolin-3 mutations cause muscular dystrophy. (biologists.org)
  • 1999 ). Regulation of G protein-coupled receptor kinases (GRKs) by caveolin. (biologists.org)
  • 1998 ). Reciprocal regulation of Neu tyrosine kinase activity and caveolin-1 protein expression in vitro and in vivo. (biologists.org)
  • Expression and compartmentalization of caveolin in adipose cells: coordinate regulation with and structural segregation from GLUT4. (univalle.edu.co)
  • 10 This increase is associated with agonist-stimulated contractile augmentation by inhibition of nitric oxide synthase, suggesting that caveolin-3 is involved in nitric oxide influences on contractility in failing myocardium. (ahajournals.org)
  • Previous studies have demonstrated that the chloride channel ClC-2 plays a critical role in intestinal epithelial tight junction (TJ) barrier function via intracellular trafficking of TJ protein occludin. (elsevier.com)
  • The verification results showed that PLB markedly induced cell cycle arrest at G 2 /M phase and extrinsic apoptosis, and inhibited epithelial to mesenchymal transition (EMT) and stemness in SCC25 cells. (dovepress.com)
  • Synthetic peptide corresponding to Rat Caveolin-2 aa 1-19. (abcam.com)
  • Can be blocked with Caveolin-2 peptide (ab4929) . (abcam.com)
  • Synthetic peptide corresponding to Mouse Caveolin-2 aa 14-25. (abcam.co.jp)
  • Detects a band of approximately 21 kDa.Can be blocked with Mouse Caveolin-2 peptide (ab4962) . (abcam.co.jp)
  • 1997 ). Identification of peptide and protein ligands for the caveolin-scaffolding domain. (biologists.org)
  • Identification of candidate angiogenic inhibitors processed by matrix metalloproteinase 2 (MMP-2) in cell-based proteomic screens: disruption of vascular endothelial growth factor (VEGF)/heparin affin regulatory peptide (pleiotrophin) and VEGF/Connective tissue growth factor angiogenic inhibitory complexes by MMP-2 proteolysis. (springer.com)
  • Caveolin-1 scaffolding domain peptide prevents hyperoxia-induced airway remodeling in a neonatal mouse model. (harvard.edu)
  • Surface biotinylation assay revealed reduced steady state endocytosis of occludin in Caco-2 CLCN2 cells. (elsevier.com)
  • Here, we show that caveolin endocytosis is key to this event as bacterial cell-to-cell transfer is severely impaired when cells are depleted of caveolin-1. (asm.org)
  • 2. Internalisation by caveolin-mediated endocytosis. (jle.com)
  • γ-Secretase then cleaves βCTF to produce Aβ and a C-terminal fragment (2-3), primarily after APP has undergone endocytosis (4). (deepdyve.com)
  • Detects caveolin-2 from rat tissues. (abcam.com)
  • Detects phospho-caveolin-2 phosphorylated on Tyr 19. (abcam.co.jp)
  • Cell-type and tissue-specific expression of caveolin-2. (wikipedia.org)
  • Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and related to inflammation. (cun.es)
  • The expression of caveolin-3 is restricted to striated and smooth muscle . (wikipedia.org)
  • In the dog with pacing-induced heart failure, expression of caveolin-3 protein is increased. (ahajournals.org)
  • These defects are fully reversed by reassembling functional caveolae through expression of caveolin-3. (nature.com)
  • Small interference RNA (siRNA) or overexpression vectors were used to alter expression of caveolin-1 (Cav-1), Orai1 or STIM1. (ersjournals.com)
  • The expression of caveolin-1 is similar to that of caveolin-2 while caveolin-3 expression appears to be limited to muscle tissue types. (novusbio.com)
  • In this study, we examined the expression of Caveolin-1 in human FVMs from patients with PVR. (arvojournals.org)
  • 1997 ). Recombinant expression of caveolin-1 in oncogenically transformed cells abrogates anchorage-independent growth. (biologists.org)
  • The tyrosine phosphorylated form of caveolin-1 colocalizes with focal adhesions , suggesting a role for caveolin-1 in migration . (wikipedia.org)
  • 2 ] hypothesized that the genetic features related with the progression pathway in colorectal cancer may condition its chemoresistance capability. (biomedcentral.com)
  • Triptolide inhibits the migration and invasion of human prostate cancer cells via Caveolin-1/CD147/MMPs pathway. (cancerindex.org)
  • In cell lines expressing the same mutant of caveolin-1 , we observed that the mutant Caveolin-1 expression seemed to induce cellular transformation and activation of mitogen-activated protein kinase-signaling pathway and to promote invasion-ability as well as altered actin networks in the cells. (aacrjournals.org)
  • Static pressure drives proliferation of vascular smooth muscle cells via caveolin-1/ERK1/2 pathway. (biomedsearch.com)
  • Aβ is produced in the amyloidogenic pathway where amyloid precursor protein (APP) is cleaved by β-secretase APP-cleaving enzyme (BACE1) to liberate soluble APPβ (sAPPβ) and the intracellular β-carboxy-terminal fragment (βCTF) (2). (deepdyve.com)
  • In contrast to wild-type-Cav-2, retroviral re-expression of Y19/27F-Cav-2 in Cav-2 knockout endothelial cells did not affect anti-proliferative effect of TGF-beta compared to empty vector. (nih.gov)
  • The aim of the present study was to explore gene expression levels of CAV-1 in human adipose tissue in obesity and obesity-associated type 2 diabetes mellitus (T2DM) and to analyse its potential implication in the inflammatory state associated with obesity. (cun.es)
  • To investigate the effect of adenovirus-mediated overexpression of caveolin-3 on hypertrophic responses in cardiomyocytes, we constructed an adenovirus that encoded human wild-type caveolin-3 (Ad.Cav-3), mutant caveolin-3 (Ad.Cav-3Δ), or bacterial β-galactosidase (Ad.LacZ). (ahajournals.org)
  • Ca 2+ ] i was measured in human ASM cells using fura-2. (ersjournals.com)
  • Caveolin-1 contributes to realgar nanoparticle therapy in human chronic myelogenous leukemia K562 cells. (cancerindex.org)
  • Cell migration assays were performed to evaluate the involvement of Caveolin-1 in EMT using primary human and mouse RPE cells. (arvojournals.org)
  • Caveolin-1 was expressed in human FVMs and upregulated in the mouse eyes with PVR. (arvojournals.org)
  • 1). Methylation of a CpG island in the 5′ promoter region of the caveolin-1 gene in human breast cancer cell lines. (biologists.org)
  • These results provide, for the first time, genetic evidence that a functioning Caveolin-1 mutation may have a role in the malignant progression of human breast cancer. (aacrjournals.org)
  • Alignment of the protein sequences encoded by the human caveolin-1 , caveolin-2 , and caveolin-3 . (aacrjournals.org)
  • Objective- We have previously shown that phospholipid oxidation products of 1-palmitoyl-2-arachidonoyl- sn -glycero-3-phosphorylcholine (ox-PAPC) inhibit lipopolysaccharide (LPS)-induced E-selectin expression and neutrophil binding in human aortic endothelial cells (HAECs). (ahajournals.org)
  • Recombinant Human Caveolin-3 full length protein expressed in E.coli, shows a 50 kDa band on SDS-PAGE (Including GST). (creativebiomart.net)
  • Triple-negative breast cancer (TNBC) is defined as an invasive mammary carcinoma lacking clinically significant expression of the three most commonly targeted biomarkers in the treatment of breast cancer: estrogen receptor (ER), progesterone receptor (PR), and human epidermal growth factor receptor 2 (HER2). (springer.com)
  • Recommendations for human epidermal growth factor receptor 2 testing in breast cancer: American Society of Clinical Oncology/College of American Pathologists clinical practice guideline update. (springer.com)
  • It has been found that human PTGS2 (COX-2) functions as a conformational heterodimer having a catalytic monomer (E-cat) and an allosteric monomer (E-allo). (wikipedia.org)
  • We now directly address the functional significance of caveolin-2 by genetically targeting the caveolin-2 locus (Cav-2) in mice. (asm.org)
  • As a result of these pathological changes, these Cav-2-null mice are markedly exercise intolerant. (asm.org)
  • Interestingly, these Cav-2-null phenotypes are identical to the ones we and others have recently reported for Cav-1-null mice. (asm.org)
  • As caveolin-2 expression is also severely reduced in Cav-1-null mice, we conclude that caveolin-2 deficiency is the clear culprit in this lung disorder. (asm.org)
  • Our analysis of several different phenotypes observed in caveolin-1-deficient mice (i.e., abnormal vascular responses and altered lipid homeostasis) reveals that Cav-2-null mice do not show any of these other phenotypes, indicating a selective role for caveolin-2 in lung function. (asm.org)
  • Genetically modified mice, not expressing caveolin-1, were incapable of forming the lipidic bodies necessary in order to provide energy for the regeneration. (psychcentral.com)
  • Similar results were obtained by avoiding caveolin-1 expression with the interference RNA technique, and the administration of glucose in mice without caveolin allowed them to have an alternative energy source and were able to regenerate liver with more normality. (psychcentral.com)
  • Although caveolin-2 is coexpressed and heterooligomerizes with caveolin-1 in many cell types (most notably adipocytes and endothelial cells), caveolin-2 has traditionally been considered the dispensable structural partner of the widely studied caveolin-1. (asm.org)
  • The protein caveolin-3, a structural component of cardiac caveolae, is associated with cellular signaling. (ahajournals.org)
  • Caveolin-3 is the major structural protein of caveolae in muscle. (nature.com)
  • 1 , 2 Although the robust improvement in surgical instruments has enabled a very high rate of structural attachment in RD, 3 - 5 RDs with severe complications, including giant retinal tears, multiple retinal tears, and/or vitreous hemorrhage, often develop into PVR. (arvojournals.org)
  • The migration-stimulated caveolin rear translocation appears to play an important role in endothelial cell polarization and directional movement. (cdc.gov)
  • Exposure of bEND3 monolayer to OGD for 2 h significantly increased its permeability to FITC-labeled dextran and promoted the secretion of metalloproteinase-2 and -9 (MMP-2/9) and cytosolic translocation of caveolin-1 (Cav-1). (qxmd.com)
  • Our results indicate that aa 1-60 in caveolin-1 were essential for its polarization in migrating cells. (cdc.gov)
  • Thus tyrosine-phosphorylated Cav-2 counteracts anti-proliferative effect of TGF-beta in endothelial cells. (nih.gov)
  • pBABE, WT-Cav-2, S23/36A-Cav-2, and Y19/27F-Cav-2 MLECs were plated at 10 4 cells per well of six well plates and 24 h later incubated without or with TGF-β (1 ng/ml) for 5 days. (nih.gov)
  • pBABE, WT-Cav-2, S23/36A-Cav-2, and Y19/27F-Cav-2 MLECs were plated at 2 × 10 3 cells per well of 24 well plates and 24 h later incubated without or with TGF-β (1 ng/ml) for 5 days, followed by processing for MTT proliferation assay. (nih.gov)
  • WT-Cav-2, S23/36A-Cav-2, and Y19/27F-Cav-2 MLECs were plated at 5 × 10 5 cells onto 60 mm dishes, 24 h later incubated without or with TGF-β (1 ng/ml) for 1 h, followed by cytosol (C) and nuclear (N) fractionation (Biovision). (nih.gov)
  • Immunofluorescence analysis of NIH 3T3 cells revealed that the two tyrosine-phosphorylated forms of Cav-2 exhibited some distinct properties. (uniprot.org)
  • Combined treatments targeting siRNA inhibition of caveolin 1 and overexpression of E-cadherin markedly reduced cell viability in both sensitive and MTX-resistant HT29 cells. (biomedcentral.com)
  • We provide functional evidences indicating that caveolin 1 and E-cadherin, deregulated in MTX resistant cells, may play a critical role in cell survival and may constitute potential targets for coadjuvant therapy. (biomedcentral.com)
  • ClC-2 over-expression (Caco-2 CLCN2 ) significantly enhanced TJ barrier (increased TER by ≥2 times and reduced inulin flux by 50%) compared to control Caco-2 pEZ cells. (elsevier.com)
  • ClC-2 over-expression (Caco-2 CLCN2 ) increased occludin protein level compared to control Caco-2 pEZ cells. (elsevier.com)
  • Caveolae disruption increased TJ permeability in control but not ClC-2 over-expressing Caco-2 CLCN2 cells. (elsevier.com)
  • ClC-2 over-expression (Caco-2CLCN2) significantly enhanced TJ barrier (increased TER by ≥2 times and reduced inulin flux by 50%) compared to control Caco-2pEZ cells. (elsevier.com)
  • ClC-2 over-expression (Caco-2CLCN2) increased occludin protein level compared to control Caco-2pEZ cells. (elsevier.com)
  • Caveolae disruption increased TJ permeability in control but not ClC-2 over-expressing Caco-2CLCN2 cells. (elsevier.com)
  • We show here that in infected HeLa cells, caveolin-2, as well as caveolin-1, colocalizes with inclusions of C. pneumoniae (Cp), C. caviae (GPIC), and C. trachomatis serovars E, F and K. In addition, caveolin-2 also associates with C. trachomatis serovars A, B and C, although caveolin-1 did not colocalize with these organisms. (springer.com)
  • Using caveolin-1 deficient FRT cells, we show that although caveolin-2 normally is not transported out of the Golgi in the absence of caveolin-1, it nevertheless colocalizes with chlamydial inclusions in these cells. (springer.com)
  • However, our results also show that caveolin-2 did not colocalize with UV-irradiated Chlamydia in FRT cells, suggesting that in these caveolin-1 negative cells, pathogen viability and very likely pathogen gene expression are necessary for the acquisition of caveolin-2 from the Golgi. (springer.com)
  • Caveolin-1 and -2 constitute a framework of caveolae in nonmuscle cells. (fujita-hu.ac.jp)
  • These results indicated that Caveolin-1 in RPE cells prevents PVR by blocking EMT. (arvojournals.org)
  • More recently, in vitro studies have demonstrated EZE-sensitive cholesterol transport into McArdles RH7777 hepatoma ( 6 ), CaCo-2 ( 7 ), and MDCKII cells ( 8 ) overexpressing NPC1L1. (pnas.org)
  • Using a simplified model system in C6 glioma cells, this study disrupts rafts/caveolae using both pharmacological and genetic approaches to test whether caveolin-1 and lipid microdomains regulate G s trafficking and signaling. (aspetjournals.org)
  • Here we show that metabolism of tryptophan to kynurenine by indoleamine 2,3-dioxygenase (Ido) expressed in endothelial cells contributes to arterial vessel relaxation and the control of blood pressure. (biomedsearch.com)
  • We found that the large conductance Ca(2+)-activated K+ (BK) channels are associated with caveolin-1 in bovine aortic endothelial cells (BAECs). (semanticscholar.org)
  • Ectopic expression of miR-199a-3p significantly inhibited RA-FLS proliferation and induced apoptosis, which was demonstrated by an increase in caspase-3 activity and Bax/Bcl-2 ratio. (portlandpress.com)
  • It has long been reported that sclareol, a labdane-type diterpene isolated from the Salvia sclarea plant can inhibit the proliferation and induce the apoptosis of several cancer cell lines ( 2 - 6 ). (spandidos-publications.com)
  • First, phospho-Cav-2 (pY19) and phospho-Cav-2 (pY27) display different localization patterns. (uniprot.org)
  • Analysis of mouse caveolin-2 deletion mutants revealed that the central hydrophobic domain (residues 87-119) and the NH 2 -terminal (residues 70-86) and COOH-terminal (residues 120-150) hydrophilic domains are all necessary for the localization in LD. (fujita-hu.ac.jp)
  • We recently found that host cell caveolin-1 is associated with the intracellular vacuoles and inclusions of some chlamydial strains and species, and that entry of those strains depends on intact lipid raft domains. (springer.com)
  • Caveolin-1 (CAV-1) plays important roles in many aspects of cellular biology, including vesicular transport, cholesterol homeostasis and signal transduction. (cun.es)
  • Filoviruses belong to one of three serologically, biochemically and genetically distinct genera-Ebolavirus, Marburgvirus, and "Cuevavirus" (tentative) [ 1 , 2 ]. (mdpi.com)
  • The oligomers become larger, increasingly detergent insoluble, and phosphorylated on caveolin-2 during transport to the cell surface. (rupress.org)
  • Phospho-Cav-2 (pY19) is concentrated at cell edges and at cell-cell contacts, whereas phospho-Cav-2 (pY27) is distributed in a dotlike pattern throughout the cell surface and cytoplasm. (uniprot.org)
  • To study the mechanism of ClC-2-mediated TJ barrier function and intracellular trafficking of occludin, we established ClC-2 over-expressing Caco-2 cell line (Caco-2 CLCN2 ) by full length ClC-2 ORF transfection. (elsevier.com)
  • Delivery of cell permeable caveolin-1 scaffolding domain reduced the occludin protein level. (elsevier.com)
  • To study the mechanism of ClC-2-mediated TJ barrier function and intracellular trafficking of occludin, we established ClC-2 over-expressing Caco-2 cell line (Caco-2CLCN2) by full length ClC-2 ORF transfection. (elsevier.com)
  • We utilized a caveolin-1 negative/caveolin-2 positive FRT cell line and laser confocal immunofluorescence techniques to visualize the colocalization of caveolin-2 with the chlamydial inclusions. (springer.com)
  • The function of caveolin-2, either in the uninfected cell or in the chlamydial developmental cycle, remains to be elucidated. (springer.com)
  • SARS-CoV-2 has to use nuclear factor-κB ( NF-kB ), caveloae, clathrin , lipoxin , serine protease and proteasome pathways in addition to ACE2 to enter the target cell and initiate damage. (bvsalud.org)
  • Caveolin-1 protects against hepatic ischemia/reperfusion injury through ameliorating peroxynitrite-mediated cell death. (semanticscholar.org)
  • In addition, migration assays showed that Caveolin-1 reduction increased RPE cell migration abilities. (arvojournals.org)
  • Caveolin-1 is also involved in the co-stimulatory signal essential for T-cell receptor (TCR) mediated T-cell activation. (thermofisher.com)
  • Giannelli G, Falk-Marzillier J, Schiraldi O, Stetler-Stevenson WG, Quaranta V. Induction of cell migration by matrix metalloprotease-2 cleavage of laminin-5. (springer.com)
  • and the neuropilin receptors 1 and 2 ( 8 , 9 ), as well as via interaction with heparin sulfate proteoglycans ( 10 ). (diabetesjournals.org)
  • Expression and characterization of recombinant caveolin. (wikipedia.org)
  • We investigated the effect of adenovirus-mediated overexpression of wild-type and dominant-negative caveolin-3 on hypertrophic responses to G q -dependent agonists in cardiomyocytes. (ahajournals.org)
  • Cardiac-Specific Caveolin-3 Overexpression Prevents Post-Myocardial Infarction Ventricular Arrhythmias by Inhibiting Ryanodine Receptor-2 Hyperphosphorylation. (physiciansweekly.com)
  • Oligomers of caveolin form the coat of these domains. (wikipedia.org)
  • In the present study, we showed that caveolin-2, especially its β isoform, is targeted to the surface of lipid droplets (LD) by immunofluorescence and immunoelectron microscopy, and by subcellular fractionation. (fujita-hu.ac.jp)