AnatomyDiseasesChemicals and Drugs
Cathepsin CCathepsinsPapillon-Lefevre DiseaseCathepsin BCathepsin LCathepsin DDipeptidyl-Peptidases and Tripeptidyl-PeptidasesCathepsin KCathepsin GCathepsin HCathepsin ECystatinsCathepsin FCysteine EndopeptidasesHyperkeratosis, EpidermolyticLysosomesCathepsin ZProtease InhibitorsDipeptidesSerine EndopeptidasesEndopeptidasesEnzyme PrecursorsCathepsin WLeukocyte Elastase
Cathepsin C
A papain-like cysteine protease that has specificity for amino terminal dipeptides. The enzyme plays a role in the activation of several pro-inflammatory serine proteases by removal of their aminoterminal inhibitory dipeptides. Genetic mutations that cause loss of cathepsin C activity in humans are associated with PAPILLON-LEFEVRE DISEASE.
Cathepsins
A group of lysosomal proteinases or endopeptidases found in aqueous extracts of a variety of animal tissues. They function optimally within an acidic pH range. The cathepsins occur as a variety of enzyme subtypes including SERINE PROTEASES; ASPARTIC PROTEINASES; and CYSTEINE PROTEASES.
Papillon-Lefevre Disease
Rare, autosomal recessive disorder occurring between the first and fifth years of life. It is characterized by palmoplantar keratoderma with periodontitis followed by the premature shedding of both deciduous and permanent teeth. Mutations in the gene for CATHEPSIN C have been associated with this disease.
Cathepsin B
A lysosomal cysteine proteinase with a specificity similar to that of PAPAIN. The enzyme is present in a variety of tissues and is important in many physiological and pathological processes. In pathology, cathepsin B has been found to be involved in DEMYELINATION; EMPHYSEMA; RHEUMATOID ARTHRITIS, and NEOPLASM INVASIVENESS.
Cathepsin L
A ubiquitously-expressed cysteine protease that plays an enzymatic role in POST-TRANSLATIONAL PROTEIN PROCESSING of proteins within SECRETORY GRANULES.
Cathepsin D
An intracellular proteinase found in a variety of tissue. It has specificity similar to but narrower than that of pepsin A. The enzyme is involved in catabolism of cartilage and connective tissue. EC 3.4.23.5. (Formerly EC 3.4.4.23).
Dipeptidyl-Peptidases and Tripeptidyl-Peptidases
A subclass of exopeptidases that includes enzymes which cleave either two or three AMINO ACIDS from the end of a peptide chain.
Cathepsin K
A cysteine protease that is highly expressed in OSTEOCLASTS and plays an essential role in BONE RESORPTION as a potent EXTRACELLULAR MATRIX-degrading enzyme.
Cathepsin G
A serine protease found in the azurophil granules of NEUTROPHILS. It has an enzyme specificity similar to that of chymotrypsin C.
Cathepsin H
An ubiquitously-expressed lysosomal cysteine protease that is involved in protein processing. The enzyme has both endopeptidase and aminopeptidase activities.
Cathepsin E
An aspartic endopeptidase that is similar in structure to CATHEPSIN D. It is found primarily in the cells of the immune system where it may play a role in processing of CELL SURFACE ANTIGENS.
Cystatins
A homologous group of endogenous CYSTEINE PROTEINASE INHIBITORS. The cystatins inhibit most CYSTEINE ENDOPEPTIDASES such as PAPAIN, and other peptidases which have a sulfhydryl group at the active site.
Cathepsin F
A lysosomal papain-related cysteine proteinase that is expressed in a broad variety of cell types.
Cysteine Endopeptidases
ENDOPEPTIDASES which have a cysteine involved in the catalytic process. This group of enzymes is inactivated by CYSTEINE PROTEINASE INHIBITORS such as CYSTATINS and SULFHYDRYL REAGENTS.
Hyperkeratosis, Epidermolytic
A form of congenital ichthyosis inherited as an autosomal dominant trait and characterized by ERYTHRODERMA and severe hyperkeratosis. It is manifested at birth by blisters followed by the appearance of thickened, horny, verruciform scales over the entire body, but accentuated in flexural areas. Mutations in the genes that encode KERATIN-1 and KERATIN-10 have been associated with this disorder.
Lysosomes
A class of morphologically heterogeneous cytoplasmic particles in animal and plant tissues characterized by their content of hydrolytic enzymes and the structure-linked latency of these enzymes. The intracellular functions of lysosomes depend on their lytic potential. The single unit membrane of the lysosome acts as a barrier between the enzymes enclosed in the lysosome and the external substrate. The activity of the enzymes contained in lysosomes is limited or nil unless the vesicle in which they are enclosed is ruptured. Such rupture is supposed to be under metabolic (hormonal) control. (From Rieger et al., Glossary of Genetics: Classical and Molecular, 5th ed)
Cathepsin Z
A ubiquitously-expressed cysteine peptidase that exhibits carboxypeptidase activity. It is highly expressed in a variety of immune cell types and may play a role in inflammatory processes and immune responses.
Protease Inhibitors
Compounds which inhibit or antagonize biosynthesis or actions of proteases (ENDOPEPTIDASES).
Dipeptides
Peptides composed of two amino acid units.
Serine Endopeptidases
Any member of the group of ENDOPEPTIDASES containing at the active site a serine residue involved in catalysis.
Endopeptidases
A subclass of PEPTIDE HYDROLASES that catalyze the internal cleavage of PEPTIDES or PROTEINS.
Enzyme Precursors
Physiologically inactive substances that can be converted to active enzymes.
Cathepsin W
A cysteine endopeptidase found in NATURAL KILLER CELLS and CYTOTOXIC T-LYMPHOCYTES. It may have a specific function in the mechanism or regulation of cytolytic activity of immune cells.
Leukocyte Elastase
An enzyme that catalyzes the hydrolysis of proteins, including elastin. It cleaves preferentially bonds at the carboxyl side of Ala and Val, with greater specificity for Ala. EC 3.4.21.37.

Increased collagenase and dipeptidyl peptidase I activity in leucocytes from healthy elderly people. (1/128)

The incidence of infectious diseases increases with ageing. The enzymatic activity of leucocytes may have a relevant role in the morbidity and mortality due to infections in the elderly. In this study we have compared the activity of enzymes involved in the inflammatory response in leucocytes from young and elderly women. A total of 35 healthy females was studied, 20 volunteers aged 78-98 years (mean 89.1 years) and 15 young controls aged 19-34 years (mean 26 years). All of them were in good clinical condition, without any acute or chronic disease. Intracellular enzyme activity was analysed by flow cytometry in leucocytes from young and elderly women. The enzyme substrates employed were for oxidative burst, L-aminopeptidase, collagenase, cathepsin B, C, D and, G and dipeptidyl peptidase I. The intracellular enzyme activity assessed by flow cytometry in leucocytes from young and elderly women was similar, as far as oxidative burst, L-aminopeptidase, cathepsin B, C, D and G are concerned. An increased collagenase activity was detected in granulocytes from elders. The mean fluorescence channels for this enzyme corresponded to 86 +/- 23 and 60 +/- 15 in cells from elders and controls, respectively (P = 0.01224). An increased dipeptidyl peptidase I activity was detected in lymphocytes from elderly women. The corresponding values for this enzyme in elders and the young were 65.9 +/- 43.3 and 17.3 +/- 5, respectively (P = 0. 0036). The proper functional activity of intracellular enzymes involved in inflammatory responses is likely to be determinant for successful ageing.  (+info)

Dipeptidyl peptidase I is required for the processing and activation of granzymes A and B in vivo. (2/128)

Dipeptidyl peptidase I (DPPI) is a lysosomal cysteine protease that has been implicated in the processing of granzymes, which are neutral serine proteases exclusively expressed in the granules of activated cytotoxic lymphocytes. In this report, we show that cytotoxic lymphocytes derived from DPPI-/- mice contain normal amounts of granzymes A and B, but these molecules retain their prodipeptide domains and are inactive. Cytotoxic assays with DPPI-/- effector cells reveal severe defects in the induction of target cell apoptosis (as measured by [(125)I]UdR release) at both early and late time points; this defect is comparable to that detected in perforin-/- or granzyme A-/- x B-/- cytotoxic lymphocytes. DPPI therefore plays an essential role in the in vivo processing and activation of granzymes A and B, which are required for cytotoxic lymphocyte granule-mediated apoptosis.  (+info)

Location of the binding site for chloride ion activation of cathepsin C. (3/128)

Cathepsin C, a tetrameric lysosomal dipeptidyl-peptide hydrolase, is activated by chloride ion. The activation is shown here to be specific and pH-dependent, dissociation constants for chloride being lower at low pH. Bound chloride decreases the Km for the hydrolysis of chromophore labelled substrates without any significant change in Vmax, confirming its involvement in substrate binding. Determination of the kinetic parameters of chloride activation, using unlabelled substrates, has enabled its site of action to be located. The lower Km for the hydrolysis of simple amide substrates in the presence of Cl- shows that the S sites are involved. Possible involvement of the S' sites is excluded by the finding that the Km for the nucleophile in the transferase reaction is unaffected by chloride. The rates of inhibition by E-64 and iodoacetate are both chloride-dependent and, from the structure of the papain-E-64 complex, it is concluded that chloride binds close to the S2 site. The binding of guanidinium ion, a positively charged inhibitor, to the S site is dependent on chloride. Based on these results, a model is proposed to explain the chloride activation of cathepsin C. The possible physiological role of chloride in the regulation of proteolysis in the lysosome is discussed.  (+info)

Mutations of the cathepsin C gene are responsible for Papillon-Lefevre syndrome. (4/128)

Papillon-Lefevre syndrome (PLS) is an autosomal recessive disorder characterised by palmoplantar hyperkeratosis and severe early onset periodontitis that results in the premature loss of the primary and secondary dentitions. A major gene locus for PLS has been mapped to a 2.8 cM interval on chromosome 11q14. Correlation of physical and genetic maps of this interval indicate it includes at least 40 ESTs and six known genes including the lysosomal protease cathepsin C gene (CTSC). The CTSC message is expressed at high levels in a variety of immune cells including polymorphonuclear leucocytes, macrophages, and their precursors. By RT-PCR, we found CTSC is also expressed in epithelial regions commonly affected by PLS, including the palms, soles, knees, and oral keratinised gingiva. The 4.7 kb CTSC gene consists of two exons. Sequence analysis of CTSC from subjects affected with PLS from five consanguineous Turkish families identified four different mutations. An exon 1 nonsense mutation (856C-->T) introduces a premature stop codon at amino acid 286. Three exon 2 mutations were identified, including a single nucleotide deletion (2692delA) of codon 349 introducing a frameshift and premature termination codon, a 2 bp deletion (2673-2674delCT) that results in introduction of a stop codon at amino acid 343, and a G-->A substitution in codon 429 (2931G-->A) introducing a premature termination codon. All PLS patients were homozygous for cathepsin C mutations inherited from a common ancestor. Parents and sibs heterozygous for cathepsin C mutations do not show either the palmoplantar hyperkeratosis or severe early onset periodontitis characteristic of PLS. A more complete understanding of the functional physiology of cathepsin C carries significant implications for understanding normal and abnormal skin development and periodontal disease susceptibility.  (+info)

Haim-Munk syndrome and Papillon-Lefevre syndrome are allelic mutations in cathepsin C. (5/128)

Of the many palmoplantar keratoderma (PPK) conditions, only Papillon-Lefevre syndrome (PLS) and Haim-Munk syndrome (HMS) are associated with premature periodontal destruction. Although both PLS and HMS share the cardinal features of PPK and severe periodontitis, a number of additional findings are reported in HMS including arachnodactyly, acro-osteolysis, atrophic changes of the nails, and a radiographic deformity of the fingers. While PLS cases have been identified throughout the world, HMS has only been described among descendants of a religious isolate originally from Cochin, India. Parental consanguinity is a characteristic of many cases of both conditions. Although autosomal recessive transmission of PLS is evident, a more "complex" autosomal recessive pattern of inheritance with phenotypic influences from a closely linked modifying locus has been hypothesised for HMS. Recently, mutations of the cathepsin C gene have been identified as the underlying genetic defect in PLS. To determine if a cathepsin C mutation is also responsible for HMS, we sequenced the gene in affected and unaffected subjects from the Cochin isolate in which both the PLS and HMS phenotypes appear. Here we report identification of a mutation of cathepsin C (exon 6, 2127A--> G) that changes a highly conserved amino acid in the cathepsin C peptide. This mutation segregates with HMS in four nuclear families. Additionally, the existence of a shared common haplotype for genetic loci flanking the cathepsin C gene suggests that affected subjects descended from the Cochin isolate are homozygous for a mutation inherited "identical by descent" from a common ancestor. This finding supports simple autosomal recessive inheritance for HMS in these families. We also report a mutation of the same exon 6 CTSC codon (2126C-->T) in a Turkish family with classical PLS. These findings provide evidence that PLS and HMS are allelic variants of cathepsin C gene mutations.  (+info)

Localisation of a gene for prepubertal periodontitis to chromosome 11q14 and identification of a cathepsin C gene mutation. (6/128)

Prepubertal periodontitis (PPP) is a rare and rapidly progressive disease of young children that results in destruction of the periodontal support of the primary dentition. The condition may occur as part of a recognised syndrome or may occur as an isolated finding. Both autosomal dominant and recessive forms of Mendelian transmission have been reported for PPP. We report a consanguineous Jordanian family with four members affected by PPP in two nuclear sibships. The parents of the affected subjects are first cousins. We have localised a gene of major effect for PPP in this kindred (Zmax=3.55 for D11S901 at theta=0.00) to a 14 cM genetic interval on chromosome 11q14 flanked by D11S916 and D11S1367. This PPP candidate interval overlaps the region of chromosome 11q14 that contains the cathepsin C gene responsible for Papillon-Lefevre and Haim-Munk syndromes. Sequence analysis of the cathepsin C gene from PPP affected subjects from this Jordanian family indicated that all were homozygous for a missense mutation (1040A-->G) that changes a tyrosine to a cysteine. All four parents were heterozygous carriers of this Tyr347Cys cathepsin C mutation. None of the family members who were heterozygous carriers for this mutation showed any clinical findings of PPP. None of the 50 controls tested were found to have this Tyr347Cys mutation. This is the first reported gene mutation for non-syndromic periodontitis and shows that non-syndromic PPP is an allelic variant of the type IV palmoplantar ectodermal dysplasias.  (+info)

Arginine-based structures are specific inhibitors of cathepsin C. Application of peptide combinatorial libraries. (7/128)

Novel synthetic peptide inhibitors of lysosomal cysteine proteinase cathepsin C have been designed through the use of soluble peptide combinatorial libraries. The uncovered structural inhibitory module consists of the N-terminal cluster of L-arginine residues. Its modification with D-amino acids or arginine derivatives did not increase the inhibition strength. Inhibitory potency of oligoarginines improves with the elongation of peptide chain reaching a maximum for octa-L-arginine. The oligoarginines specifically interact with the cathepsin C active site as shown by competitive-type inhibition kinetics (Ki approximately 10-5 M) and intrinsic fluorescence measurements. The inhibitory interaction of oligoarginines is established through the specific spatial contact of a net of guanidino groups in the arginine side-chains, as indicated by comparison with inhibitory action of low molecular mass guanidine derivatives (Ki approximately 10-3 M). Nonarginine polyionic compounds cannot mimic the inhibitory effect of oligoarginines. The arginine-based peptide inhibitors were selective towards cathepsin C among other cysteine proteinases tested.  (+info)

Programming for cytotoxic effector function occurs concomitantly with CD4 extinction during CD8(+) T cell differentiation in the thymus. (8/128)

CD4(+) T cells are generally specialized to function as helper cells and CD8(+) T cells are generally specialized to function as cytotoxic effector cells. To explain how such concordance is achieved between co-receptor expression and immune function, we considered two possibilities. In one case, immature CD4(+)CD8(+) thymocyte precursors might first down-regulate expression of one co-receptor molecule, with the remaining co-receptor molecule subsequently activating the appropriate helper or cytotoxic functional program. Alternatively, we considered that the same intrathymic signals that selectively extinguished expression of one or the other co-receptor molecule might simultaneously initiate the appropriate helper or cytotoxic functional program. In the present study, we attempted to distinguish between these alternatives by examining thymocyte precursors of CD8(+) T cells for expression of Cathepsin C and Cathepsin W, molecules important for cytotoxic effector function. We report in developing thymocytes that Cathepsin C and Cathepsin W are expressed coordinately with extinction of CD4 co-receptor expression. We conclude that CD4 extinction and initiation of the cytotoxic functional program occurs simultaneously during differentiation of CD8(+) T cells in the thymus.  (+info)

Cathepsin C - WikipediaCathepsin C - Wikipedia
Cathepsin C (CTSC) also known as dipeptidyl peptidase I (DPP-I) is a lysosomal exo-cysteine protease belonging to the peptidase C1 family. In humans, it is encoded by the CTSC gene. Cathepsin C appears to be a central coordinator for activation of many serine proteases in immune/inflammatory cells. Cathepsin C catalyses excision of dipeptides from the N-terminus of protein and peptide substrates, except if (i) the amino group of the N-terminus is blocked, (ii) the site of cleavage is on either side of a proline residue, (iii) the N-terminal residue is lysine or arginine, or (iv) the structure of the peptide or protein prevents further digestion from the N-terminus. The cDNAs encoding rat, human, murine, bovine, dog and two Schistosome cathepsin Cs have been cloned and sequenced and show that the enzyme is highly conserved. The human and rat cathepsin C cDNAs encode precursors (prepro-cathepsin C) comprising signal peptides of 24 residues, pro-regions of 205 (rat cathepsin C) or 206 (human ...
https://en.wikipedia.org/wiki/Cathepsin_C
Mutation analysis of the cathepsin C gene in Indian families with Papillon-Lefèvre syndrome ePrints@IIScMutation analysis of the cathepsin C gene in Indian families with Papillon-Lefèvre syndrome [email protected]
Background: PLS is a rare autosomal recessive disorder characterized by early onset periodontopathia and palmar plantar keratosis. PLS is caused by mutations in the cathepsin C (CTSC) gene. Dipeptidyl-peptidase I encoded by the CTSC gene removes dipeptides from the aminoterminus of protein substrates and mainly plays an immune and inflammatory role. Several mutations have been reported in this gene in patients from several ethnic groups. We report here mutation analysis of the CTSC gene in three Indian families with PLS. Methods: Peripheral blood samples were obtained from individuals belonging to three Indian families with PLS for genomic DNA isolation. Exon-specific intronic primers were used to amplify DNA samples from individuals. PCR products were subsequently sequenced to detect mutations.PCR-SCCP and ASOH analyses were used to determine if mutations were present in normal control individuals. Results: All patients from three families had a classic PLS phenotype, which included ...
http://eprints.iisc.ac.in/2358/
Neutrophil proteinase 3 and dipeptidyl peptidase I (cathepsin C) as pharmacological targets in granulomatosis with polyangiitis...Neutrophil proteinase 3 and dipeptidyl peptidase I (cathepsin C) as pharmacological targets in granulomatosis with polyangiitis...
Neutrophils are among the first cells implicated in acute inflammation. Leaving the blood circulation, they quickly migrate through the interstitial space of tissues and liberate oxidants and other an
https://link.springer.com/article/10.1007%2Fs00281-013-0362-z
anti-CTSC antibody | Rabbit anti-Bovine Cathepsin C Polyclonal Antibody-AAQ08887.1anti-CTSC antibody | Rabbit anti-Bovine Cathepsin C Polyclonal Antibody-AAQ08887.1
Buy anti-CTSC antibody, Rabbit anti-Bovine Cathepsin C Polyclonal Antibody-AAQ08887.1 (MBS573038) product datasheet at MyBioSource, Primary Antibodies. Application: Immunoprecipitation (IP)
https://www.mybiosource.com/prods/Antibody/Polyclonal/Cathepsin-C/CTSC/datasheet.php?products_id=573038
Dr. AbbaszadeganDr. Abbaszadegan
Dadkhah E, Moghaddasian M, Arab H, Bustani Farkoush H, Kazemi Noughabi M, Abbaszadegan MR. Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever Syndrome. European Human Genetics Conference 2012.Nurnberg, Germany, 2012.. Abbaszadegan MR, Forghanifard MM. Impact of cancer testis antigens crosstalk with self renewal cell signaling pathways in esophageal squamous cell carcinoma. European Human Genetics Conference 2012.Nurnberg, Germany. June 23-26-2012. (Poster presentation).. ...
http://rsc-medgenetics.mums.ac.ir/index.php/fa/2015-03-11-10-59-29/articles/43-persian-category/141-dr-abbaszadegan
Dr. AbbaszadeganDr. Abbaszadegan
Dadkhah E, Moghaddasian M, Arab H, Bustani Farkoush H, Kazemi Noughabi M, Abbaszadegan MR. Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever Syndrome. European Human Genetics Conference 2012.Nurnberg, Germany, 2012.. Abbaszadegan MR, Forghanifard MM. Impact of cancer testis antigens crosstalk with self renewal cell signaling pathways in esophageal squamous cell carcinoma. European Human Genetics Conference 2012.Nurnberg, Germany. June 23-26-2012. (Poster presentation).. ...
http://rsc-medgenetics.mums.ac.ir/index.php/fa/links/43-persian-category/141-dr-abbaszadegan
WikiGenes - CTSC - cathepsin CWikiGenes - CTSC - cathepsin C
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
https://www.wikigenes.org/e/gene/e/1075.html
The action of leucyl-leucine methyl ester on cytotoxic lymphocytes requires uptake by a novel dipeptide-specific facilitated...The action of leucyl-leucine methyl ester on cytotoxic lymphocytes requires uptake by a novel dipeptide-specific facilitated...
The mechanism of toxicity for cytolytic lymphocytes of Leu-Leu-OMe and related dipeptide derivatives was examined. Selective inhibition of dipeptidyl peptidase I (DPPI), a lysosomal thiol protease highly enriched in cytotoxic lymphocytes, prevented all natural killer (NK) toxic effects of such agents. However, many DPPI substrates were found to possess no NK toxic properties. For some such agents, this lack of NK toxicity appeared to be related to the lack of uptake by lymphocytes. In this regard, Leu-Leu-OMe was found to be incorporated by lymphocytes and monocytes via a saturable facilitated transport mechanism with characteristics distinct from previously characterized mammalian dipeptide transport processes. This novel transport process was found to be specific for dipeptides composed of selective L-stereoisomer amino acids and enhanced by hydrophobic ester or amide additions to the COOH terminus of dipeptides. Maximal rates of Leu-Leu-OMe uptake by T8 and NK cell-enriched peripheral blood ...
http://jem.rupress.org/content/172/1/183
GPN does not release lysosomal Ca2+ but evokes Ca2+ release from the ER by increasing the cytosolic pH independently of...GPN does not release lysosomal Ca2+ but evokes Ca2+ release from the ER by increasing the cytosolic pH independently of...
The dipeptide glycyl-l-phenylalanine 2-naphthylamide (GPN) is widely used to perturb lysosomes because its cleavage by the lysosomal enzyme cathepsin C is proposed to rupture lysosomal membranes. We show that GPN evokes a sustained increase in lysosomal pH (pHly), and transient increases in cytosolic pH (pHcyt) and Ca2+ concentration ([Ca2+]c). None of these effects require cathepsin C, nor are they accompanied by rupture of lysosomes, but they are mimicked by structurally unrelated weak bases. GPN-evoked increases in [Ca2+]c require Ca2+ within the endoplasmic reticulum (ER), but they are not mediated by ER Ca2+ channels amplifying Ca2+ release from lysosomes. GPN increases [Ca2+]c by increasing pHcyt, which then directly stimulates Ca2+ release from the ER. We conclude that physiologically relevant increases in pHcyt stimulate Ca2+ release from the ER in a manner that is independent of IP3 and ryanodine receptors, and that GPN does not selectively target lysosomes. ...
https://jcs.biologists.org/content/132/3/jcs223883.abstract
Chk2 | BCR-ABL kinase domain mutation analysis
Background Cystatin F is really a proteins inhibitor of cysteine peptidases, portrayed in immune cells and localised in endosomal/lysosomal compartments predominantly. High-104 cell series were set up, either by treatment by ionomycin or by immunosuppressive changing growth aspect beta. Decreased cytotoxicity correlated with an increase of degrees of cystatin F with attenuated actions of cathepsins C, L and H and of granzyme B. Co-localisation of cystatin cathepsins and F C, L and H and connections between cystatin F and cathepsins C and H were demonstrated. Conclusions Cystatin F is definitely designated as a possible regulator of T cell cytotoxicity, similar to its part in natural killer cells. (BioGenes GmbH, Berlin, Germany), as a negative control. Dynabeads protein G with bound antibodies was then added to lysates. After rotation at 4C over night, beads were washed three times with lysis buffer and boiled for 10 minutes in 1 SDS loading buffer. Eluted proteins were analysed by western blot. ...
https://ovarian-cancersymptoms.com/?cat=34
Addgene: DPAP1-COMP-blac-flag-hisAddgene: DPAP1-COMP-blac-flag-his
Plasmid DPAP1-COMP-blac-flag-his from Dr. Gavin Wrights lab contains the insert cathepsin C, homolog,dipeptidyl aminopeptidase 1 (DPAP1). This plasmid is available through Addgene.
http://www.addgene.org/111019/
UC Davis Health System Feature Story: Innovative, collaborative projects recognized...
Heike Wulff. Seed grants like the CTSC award are very important because they allow us to generate preliminary data for larger NIH grants, which are typically not awarded without existing data showing that the project is feasible, said Heike Wulff, professor of pharmacology and one of this years awardees. Our CTSC grant will allow us to test whether a novel therapeutic principle, the activation of a particular neuronal potassium channel, can indeed reduce neuronal excitability and thus prevent epileptic seizures.. The CTSC awarded seven UC Davis investigators for investigations in three broad categories: highly innovative research, new approaches to neurodevelopmental disorders and mini-biorepositories from clinical research projects. The recipients are working closely with CTSC leadership for additional resources to support their collaborative research projects.. Highly innovative research. ...
http://www.ucdmc.ucdavis.edu/welcome/features/20091104_CTSC_grants/index.html
2016 | Wydział Chemii2016 | Wydział Chemii
Yveline Hamon, Monika Łęgowska, Patricia Fergelot, Sandrine Dallet-Choisy, Louise Newell, Lise Vanderlynden, Ali Kord Valeshabad, Karina Acrich, Hadi Kord, Tsamakis Charalampos, Fanny Morice-Picard, Ian Surplice, Jerome Zoidakis, Karen David, Antonia Vlahou, Shivanna Ragunatha, Nikoletta Nagy, Katalin Farkas, Márta Széll, Cyril Goizet, Beate Schacher, Maurizio Battino, Abdullah Al Farraj Aldosari, Xinwen Wang, Yang Liu, Sylvain Marchand-Adam, Adam Lesner, Elodie Kara, Sevil Korkmaz-Icöz, Celia Moss, Peter Eickholz, Alain Taieb, Salih Kavukcu, Dieter E. Jenne, Francis Gauthier, Brice Korkmaz, Analysis of urinary cathepsin C for diagnosing Papillon-Lefèvre syndrome, The FEBS Journal, 2016, Vol. 283, iss. 3, 498-509, IF: ...
https://chemia.ug.edu.pl/nauka/publikacje_naukowe/2016
Clinical Trial Support Center (CTSC) | Leukemia and Lymphoma Society
We welcome the opportunity to assist you during this challenging time. Clinical Trial Nurse Navigators and Information Specialists will continue to operate on normal business hours. Finding a clinical trial can be overwhelming. Patients are often left to search on their own, leaving them with more questions than answers. Fortunately, The Leukemia & Lymphoma Society now
https://www.schoolandyouth.org/support/information-specialists/clinical-trial-support-center-ctsc
EMBL: CP001994.PE2
CP001994.PE2 Location/Qualifiers FT CDS complement(1457..2011) FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Mmah_0002 FT /product=peptidase S26B, signal peptidase FT /note=InterPro IPR001733; KEGG: hypothetical protein; FT K03100 signal peptidase I; SPTR: Q12VA0 Peptidase S26B, FT signal peptidase; TIGRFAM: peptidase S26B, signal FT peptidase; PFAM: Peptidase S24-like; TIGRFAM: signal FT peptidase I, archaeal type FT /db_xref=EnsemblGenomes-Gn:Mmah_0002 FT /db_xref=EnsemblGenomes-Tr:ADE35540 FT /db_xref=GOA:D5E8N1 FT /db_xref=InterPro:IPR001733 FT /db_xref=InterPro:IPR015927 FT /db_xref=InterPro:IPR036286 FT /db_xref=UniProtKB/TrEMBL:D5E8N1 FT /protein_id=ADE35540.1 FT /translation=MEIGEIIHTFKNSDNFWVGIARDALSVLAILAVIGILSQLFFGMW FT TPMVAVESGSMEPHMYRGDIIFIEDLDRTRIETLRDAPEDYISFEKKGDVILYRPYGQK FT GVTPVIHRAMYFVEEGEQMWEGGPDAPHEGYITKGDNKKTNSYYDQQGQISYLAPVKEE FT WIIGVARYKVPYIGHIRLLLS MEIGEIIHTF KNSDNFWVGI ARDALSVLAI LAVIGILSQL FFGMWTPMVA VESGSMEPHM 60 YRGDIIFIED LDRTRIETLR ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-pe?query=CP001994.PE2&db=EMBL&ident=SCRATCH3701
Agrafe pt. birou colorate, 28mm, 40 buc/cutie, RIO Zebra - DPAP.roAgrafe pt. birou colorate, 28mm, 40 buc/cutie, RIO Zebra - DPAP.ro
Cumpara acum Agrafe pt. birou colorate, 28mm, 40 buc/cutie, RIO Zebra la cel mai mic pret. Confirmarea comenzii in maxim 15 minute.
https://www.dpap.ro/agrafe-pt-birou-colorate-28mm-40-buc-cutie-rio-zebra.html
Papillon-Lefevre syndrome cell, TEM - Stock Image C020/8722 - Science Photo LibraryPapillon-Lefevre syndrome cell, TEM - Stock Image C020/8722 - Science Photo Library
Papillon-Lefevre syndrome. Coloured transmission electron micrograph (TEM) of a cell affected by Papillon-Lefevre syndrome, a rare inherited condition. Plaques of the protein keratin (blue) are seen within the cell. The disease causes hyperkeratosis (thickening of the skin) and severe periodontitis, an inflammation of the tissue that surrounds and supports the teeth. The inflammation results in bone and tooth loss. Magnification: x16,600 when printed at 10 centimetres wide. - Stock Image C020/8722
http://www.sciencephoto.com/media/592605/view
Papillon-Lefevre Disease Summary Report | CureHunterPapillon-Lefevre Disease Summary Report | CureHunter
Papillon-Lefevre Disease: Rare, autosomal recessive disorder occurring between the first and fifth years of life. It is characterized by palmoplantar keratoderma with periodontitis followed by the premature shedding of both deciduous and permanent teeth. Mutations in the gene for CATHEPSIN C have been associated with this disease.
http://www.curehunter.com/public/keywordSummaryD010214-Papillon-Lefevre-Disease.do
Mechanism of L-leucyl-L-leucine methyl ester-mediated killing of cytotoxic lymphocytes: Dependence on a lysosomal thiol...
TY - JOUR. T1 - Mechanism of L-leucyl-L-leucine methyl ester-mediated killing of cytotoxic lymphocytes. T2 - Dependence on a lysosomal thiol protease, dipeptidyl peptidase I, that is enriched in these cells. AU - Thiele, Dwain L. AU - Lipsky, Peter E.. PY - 1990. Y1 - 1990. N2 - Exposure of murine or human lymphocytes to L-leucyl-L-leucine methyl ester (Leu-Leu-OMe) results in selective killing of cytotoxic lymphocytes, whereas helper T cells and B cells remain functionally intact. Cytolytic lymphocytes incubated in the presence of toxic concentrations of Leu-Leu-OMe were found to contain membranolytic metabolites of the structure (Leu-Leu)n-OMe, where n ≥ 3. The sensitivity of cytotoxic lymphocytes to Leu-Leu-OMe was found to be dependent upon production of these metabolites by a lysosomal thiol protease, dipeptidyl peptidase I, which is present at far higher levels in cytotoxic lymphocytes than in cells without cytolytic potential or not of bone marrow origin. Thus, this granule enzyme is ...
https://utsouthwestern.pure.elsevier.com/en/publications/mechanism-of-l-leucyl-l-leucine-methyl-ester-mediated-killing-of-
CONUCO 2.2 | Resultados > Record | Papillon-Lefevre syndrome :a case report and review of the...CONUCO 2.2 | Resultados > Record | Papillon-Lefevre syndrome :a case report and review of the...
Conuco es un índice que trabaja únicamente revistas y publicaciones electrónicas creadas en Puerto Rico o por puertorriqueños fuera de Puerto Rico. Es un índice mixto que recoge tanto material académico como material popular e informativo. Así en Conuco podrá encontrar tanto un artículo erudito como una noticia sobre un incidente criminal.
http://www.conucopr.org/ViewRecord.do?id=11121278&s_ind=0&b_ind=0
Case Report: Keratosis palmoplantaris associated to periodontal disease (Papillon-Lefévre Syndrome)Case Report: Keratosis palmoplantaris associated to periodontal disease (Papillon-Lefévre Syndrome)
The Papillon-Lefèvre syndrome or keratosis palmoplantaris associated to periodontopathy was first described by Papillon-Lefèvre, in 1924. It is an autosomal recessive genetic disease, with alteration in the gene CTSC, located in chromosome 11q14.1-q14.4, more precisely in the protein called cathepsin C (Hart et al., 2000; Shafer et al., 1987; Neville et al., 2001; Tommasi, 2002; Allende & Moreno, 2003; Hewitt et al., 2004; Selvaraju et al., 2003 ). It affects children and young adults of both sexes with no distinction. It is a very rare disease, with a prevalence of one in one million individuals. Its main oral clinical characteristics include periodontopathies, premature loss of deciduous teeth, at the age of 4-5 years and of the permanent teeth at approximately 14 years (Allegra & Gennari, 2000; Regezi & Sciubba, 2000; Tommasi, 2002; Siragusa et al., 2000). According to Shafer et al. (1987), only the permanent dentition is affected in some cases.. Patients also present halitosis, intense ...
http://institutodosorriso.com.br/case-report-keratosis-palmoplantaris-associated-to-periodontal-disease-papillon-lefevre-syndrome/
Community Traffic Safety CoalitionCommunity Traffic Safety Coalition
People make mistakes and poor choices; Vision Zero says those mistakes dont have to cost lives. Working together, we can eliminate deaths and serious injuries on our streets. The CTSC focused on Vision Zero for their 2016-2018 work plan, committing to making Santa Cruz County safer for all road users. Click here to read our 2017 report, The Impact of Traffic Violence On Santa Cruz County, explore interactive maps showing our high-injury corridors and other crash data, and view our Vision Zero workplan.. Our Mission. The mission of the Community Traffic Safety Coalition is to reduce traffic-related injuries while promoting the use of alternative modes of transportation. The primary focus is on bicycle and pedestrian safety issues. The CTSC educates all road users in safety practices to decrease the risk and severity of collisions, and advocates for improved conditions to make all methods of transportation safer.. About the Community Traffic Safety Coalition. The CTSC is a creative and ...
http://www.santacruzhealth.org/HSAHome/HSADivisions/PublicHealth/CommunityHealthEducation/CommunityTrafficSafetyCoalition.aspx
Clinical and Translational Science CenterClinical and Translational Science Center
Congratulations to our KL2 Scholars-Nicole Kucine, MD, and Danielle Novetsky Friedman, MD-on presenting their theses before the Masters Examining Committee in April. Nicole, a WCMC Assistant Professor of Pediatrics, presented on her CTSC KL2 research, Evaluation of Myeloproliferative Neoplasms in Pediatric Patients. Danielle, an MSK Instructor of Pediatrics, presented on her CTSC KL2 research, Chronic Conditions in Adult Survivors of Retinoblastoma. Wed also like to thank their mentors (Drs. Ross Levine, James Bussel, Kevin Oeffinger, Erika Abramson, and Chaya Moskowitz) and our Associate Program Directors (Drs. Yuan-Shan Zhu and Dean Bajorin) for attending and showing tremendous support for their mentees.. CTSC Research in Progress Luncheon ...
http://weill.cornell.edu/ctsc/training_and_education/e_news_digest/mar_apr_2015.html
An enzyme immunoassay for polymorphonuclear leucocyte-mediated fibrinogenolysis :: TNO RepositoryAn enzyme immunoassay for polymorphonuclear leucocyte-mediated fibrinogenolysis :: TNO Repository
Upon stimulation, polymorphonuclear leucocytes (PMNs) release potent serine proteases, i.e. elastase, cathepsin C and proteinase 3, which contribute to the degradation of tissue and plasma components. Here, we describe the development of a plasma test to assess PMN-mediated fibrinogenolysis as a biochemical marker for actual PMN-derived proteolysis in vivo, useful for monitoring therapeutic efficacy, i.e. of elastase inhibitors. We generated a monoclonal antibody (MAb), designated 1-1/B3, with a high affinity for elastase-degraded fibrinogen (EDF). The epitope for 1-1/B3 becomes exposed in a time-dependent manner during digestion of fibrinogen with purified PMN-derived serine proteases and with isolated PMNs in vitro. However, 1-1/B3 does not react with plasma fibrinogen or with fibrin(ogen) degradation products generated by plasmin or by other active proteases that may occur locally, i.e. metalloproteases and lysosomal cathepsins. On the basis of MAb 1-1/B3, we developed a plasma test for the ...
https://repository.tudelft.nl/view/tno/uuid%3A84bdd7ac-d016-46a2-a07c-4b95bfb1c70d
lepB - Signal peptidase I - Salmonella typhi - lepB gene & proteinlepB - Signal peptidase I - Salmonella typhi - lepB gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
https://www.uniprot.org/uniprot/P0A1W3
Mine pentru creion 2mm, HB, 12 buc/etui, STAEDTLER Mars carbon - DPAP.roMine pentru creion 2mm, HB, 12 buc/etui, STAEDTLER Mars carbon - DPAP.ro
Cumpara acum Mine pentru creion 2mm, HB, 12 buc/etui, STAEDTLER Mars carbon la cel mai mic pret. Confirmarea comenzii in maxim 15 minute.
https://www.dpap.ro/mine-pentru-creion-2mm-hb-12-buc-etui-staedtler-mars-carbon.html
CTSC gene - Genetics Home ReferenceCTSC gene - Genetics Home Reference
From NCBI Gene:. This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. A portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. [provided by RefSeq, Nov 2015]. From UniProt: ...
https://ghr.nlm.nih.gov/gene/CTSC
Probable dipeptidyl-peptidase elisa and antibodyProbable dipeptidyl-peptidase elisa and antibody
Shop Probable dipeptidyl-peptidase ELISA Kit, Recombinant Protein and Probable dipeptidyl-peptidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=probable-dipeptidyl-peptidase
A Randomized Phase 2 Trial of 177Lu Radiolabeled Anti-PSMA Monoclonal Antibody J591 in Patients With High-Risk Castrate,...
Clinical trial has received WCMC IRB and CTSC approval with enrollment of initial 6 subjects at WCMC. An additional 38 subjects enrolled 29 treated at participating sub-sites. Reports submitted to WCMC DSMB in December 2014 with approval to proceed without modifications.
https://apps.dtic.mil/sti/citations/AD1036821
L-Alanine- -Naphthylamide Hydrobromide | CAS 3513-56-2 | CLEARSYNTHL-Alanine- -Naphthylamide Hydrobromide | CAS 3513-56-2 | CLEARSYNTH
This page contains information about of L-Alanine- -Naphthylamide Hydrobromide | Purchase L-Alanine- -Naphthylamide Hydrobromide online.
https://www.clearsynth.com/en/CSEP00283.html
Nα-Benzoyl-L-arginine 4-methoxy-β-naphthylamide hydrochloride - Creative EnzymesNα-Benzoyl-L-arginine 4-methoxy-β-naphthylamide hydrochloride - Creative Enzymes
Welcome! For price inquiries, please feel free to contact us through the form on the left side. We will get back to you as soon as possible.. ...
https://www.creative-enzymes.com/product/N-BenzoylLarginine-4methoxy-naphthylamide-Hydrochloride_6350.html
L-trans-Epoxysuccinyl-leucylamido(4-guanidino)butane (E-64) and its analogues as inhibitors of cysteine proteinases including...L-trans-Epoxysuccinyl-leucylamido(4-guanidino)butane (E-64) and its analogues as inhibitors of cysteine proteinases including...
1. L-trans-Epoxysuccinyl-leucylamido(4-guanidino)butane (E-64) at a concentration of 0.5 mM had no effect on the serine proteinases plasma kallikrein and leucocyte elastase or the metalloproteinases thermolysin and clostridial collagenase. In contrast, 10 muM-E-64 rapidly inactivated the cysteine proteinases cathepsins B, H and L and papain (t0.5 = 0.1-17.3s). The streptococcal cysteine proteinase reacted much more slowly, and there was no irreversible inactivation of clostripain. The cysteine-dependent exopeptidase dipeptidyl peptidase I was very slowly inactivated by E-64. 2. the active-site-directed nature of the interaction of cathepsin B and papain with E-64 was established by protection of the enzyme in the presence of the reversible competitive inhibitor leupeptin and by the stereospecificity for inhibition by the L as opposed to the D compound. 3. It was shown that the rapid stoichiometric reaction of the cysteine proteinases related to papain can be used to determine the operational molarity of
https://www.bioseek.eu/us/eng/research/pubmed/L_trans_Epoxysuccinyl_leucylamido_4_guanidino_butane_E_64_and_its_analogues_as_inhibitors_of_cysteine_proteinases_including_cathepsins_B_H_and_L_7044372
Plus itPlus it
Glutamine supplementation has been advocated for patients requiring parenteral nutritional support. However, the direct effect of glutamine on neoplastic cells is poorly understood. We therefore investigated the effects of glutamine on the proliferation, differentiation, and cell-matrix interactions of two human colon carcinoma cell lines (Caco-2 and SW620) adapted to glutamine-free media. Doubling times were calculated by logarithmic transformation of serial cell counts. Alkaline phosphatase, cathepsin C (dipeptidyl peptidase), lactase, and isomaltase expression (markers of differentiation) were assayed by digestion of synthetic substrates. Adhesion to matrix proteins was assessed by colorimetric quantitation of toluidine blue staining of adherent cells. Surface expression of Caco-2 receptors for matrix proteins (integrins) was studied by biotinylation and immunoprecipitation with specific antibodies. Glutamine (1-10 mm) dose-dependently stimulated Caco-2 proliferation on all matrices studied ...
http://cancerres.aacrjournals.org/content/54/22/5974
New grant further solidifies UC Davis leadership role in translational research
The UC Davis Clinical and Translational Science Center (CTSC) and the wide array of services that have supported innovative biomedical research and led to the development of new treatments for diseases during the past 10 years will continue, thanks to a $27.8 million grant from the National Center for Accelerating Translational Science and the ongoing support from the School of Medicine.
http://www.ucdmc.ucdavis.edu/publish/news/internalmedicine/11289
A Study of ARRY-371797 in Patients With Symptomatic Dilated Cardiomyopathy Due to a Lamin A/C Gene Mutation - No Study Results...A Study of ARRY-371797 in Patients With Symptomatic Dilated Cardiomyopathy Due to a Lamin A/C Gene Mutation - No Study Results...
The safety and scientific validity of this study is the responsibility of the study sponsor and investigators. Listing a study does not mean it has been evaluated by the U.S. Federal Government. Know the risks and potential benefits of clinical studies and talk to your health care provider before participating. Read our disclaimer for details ...
https://clinicaltrials.gov/ct2/show/results/NCT03439514?term=Arry-371797&draw=1
Dipeptidyl peptidases and related proteins: multifaceted markers and therapeutic targetsDipeptidyl peptidases and related proteins: multifaceted markers and therapeutic targets
You currently have no access to view or download this content. Please log in with your institutional or personal account if you should have access to this content through either of these. Showing a limited preview of this publication: ...
https://www.degruyter.com/document/doi/10.1515/CCLM.2009.085/html
Betydningen av legumain og cystatin E/M for aktivering av caspase-3
Apoptose er programmert celledød for å fjerne uønskede celler og er en felles egenskap for alle flercellede organismer. Caspase-3 er involvert i intracellulære signalkaskader ved apoptose. En ubalanse i regulering av apoptose kan føre til kreftutvikling. Apoptose spiller en viktig rolle i flere andre sykdommer som immunologisk, iskemiske, og nevrodegenerative sykdommer. For å undersøke betydningen av proteasen legumain og proteaseinhibitoren cystatin E/M for caspase-3 aktivitet, ble det brukt HEK293 (normale kontroll celler), M38L (overutrykker legumain) og M4C (overutrykker cystatin E/M) celler. Cellene ble stimulert med dødsstimulerende stoffer som staurosporin og Leu-Leu-OMe. Staurosporin er kjent for å være en kinasehemmer. Leu-Leu-OMe øker lysosomal membranpermeabilitet. Proteaser som er involvert i apoptose vil dermed frigjøres fra lysosomer til cytosol. Legumain som befinner seg i lysosomene, kan frigjøres til cytosol og dermed påvirke aktiviteten av caspase-3 eller andre ...
https://www.duo.uio.no/handle/10852/40111
ctsb Protein, cathepsin B - Creative BioMart
Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. In humans, it is coded by the CTSB gene. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene.
https://www.creativebiomart.net/symbolsearch_CTSB.htm
Center For Technology And Social ChangeCenter For Technology And Social Change
CTSC is a nonpartisan nonprofit organization that uses the power of technology and internet to empower social change. We do so by creating tools, engaging local developer/hacker community, funding new projects, opening data, releasing media campaigns and advocacy.
https://www.ctsc-india.org/
glycyl-aspartyl-aspartyl-aspartyl-aspartyl-lysine-2-naphthylamide Summary Report | CureHunterglycyl-aspartyl-aspartyl-aspartyl-aspartyl-lysine-2-naphthylamide Summary Report | CureHunter
glycyl-aspartyl-aspartyl-aspartyl-aspartyl-lysine-2-naphthylamide: synthetic substrate linked via amide bond to fluorophore 2-naphthylamine
http://www.curehunter.com/public/keywordSummaryC023519-glycyl-aspartyl-aspartyl-aspartyl-aspartyl-lysine-2-naphthylamide.do
Methanol 3.5L - (pls whatsapp us to (end 12/7/2019 9:15 AM)Methanol 3.5L - (pls whatsapp us to (end 12/7/2019 9:15 AM)
Methanol 3.5L - (pls whatsapp us to check availability),Price: RM36.00,End time 12/7/2019 9:15 AM MYT,Category: Chemical / B2B & Industrial Products
https://www.lelong.com.my/methanol-3-5l-pls-whatsapp-to-check-availability-evacaely-210225355-2019-12-Sale-P.htm
Inhibition of lysosomal cysteine proteases by a series of Au(I) complexes - Research Portal - Converis Standard ConfigInhibition of lysosomal cysteine proteases by a series of Au(I) complexes - Research Portal - Converis Standard Config
Complexes of gold( I) have long been used to treat rheumatoid arthritis although the precise biological targets of gold are not well understood. One intriguing therapeutic target of Au( I) is the cathepsin family of lysosomal cysteine proteases. Here, we present the inhibition of cathepsin B by a known Au( I)-based drug and a series of derivatives. The complexes investigated were reversible, competitive inhibitors with IC50 values ranging from 0.3 to 250 mu M, depending on the substituents around the Au( I). ...
https://converis.upt.pt/converis/portal/detail/Publication/4906004?auxfun=&lang=de_DE
DPP3 - WikipediaDPP3 - Wikipedia
Dipeptidyl-peptidase 3 is an enzyme that in humans is encoded by the DPP3 gene. This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternate transcriptional splice variants have been characterized. GRCh38: Ensembl release 89: ENSG00000254986 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000063904 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Fukasawa KM, Fukasawa K, Harada M (Jun 2000). Assignment of the dipeptidyl peptidase III gene (DPP3) to human chromosome 11 band q12→q13.1 by in situ hybridization. Cytogenet Cell Genet. 88 (1-2): 99-100. doi:10.1159/000015498. PMID 10773679. Entrez Gene: DPP3 dipeptidyl-peptidase ...
https://en.wikipedia.org/wiki/DPP3
New Saccharomyces Sequences 08/25/94New Saccharomyces Sequences 08/25/94
YSCH2B1 J01327 M25040 M25041 V01307 607bp ds-DNA PLN 23-AUG-1994 Yeast (S.cerevisiae) histone H2B-1 gene. histone; histone H2B. YSCH2B2 J01328 V01308 589bp ds-DNA PLN 23-AUG-1994 Yeast (S.cerevisiae) histone H2B-2 gene. histone; histone H2B. YSCLTG3 D16304 1779bp ds-DNA PLN 24-AUG-1994 Yeast LTG3 gene. . YSCSTEYCI L21944 3136bp ds-DNA PLN 23-AUG-1994 Saccharomyces cerevisiae dipeptidyl aminopeptidase (STE13 or YCI1) gene, complete cds. dipeptidyl aminopeptidase ...
http://www.bio.net/bionet/mm/yeast/1994-August/001559.html
DPAP | Program Development and Implementation | Unique Identification | Data Elements
These are the key pieces of data that will be populated within the IUID Registry, that provide information on the item, the supplier, the contract, and the delivery.. Data requirements for IUID data are based on the second DFARS Interim Rule on Unique Item Identification and Valuation which was published in the Federal Register on January 1, 2004 . (DFARS Revision 20040101 or subsequent revisions). In order to capture IUID Item Pedigree, the following core IUID data elements are required:. ...
https://www.acq.osd.mil/dpap/pdi/uid/data_elements.html
RCSB PDB - 2BGR: Crystal structure of HIV-1 Tat derived nonapeptides Tat(1-9) bound to the active site of Dipeptidyl peptidase...RCSB PDB - 2BGR: Crystal structure of HIV-1 Tat derived nonapeptides Tat(1-9) bound to the active site of Dipeptidyl peptidase...
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/structure/2bgr
Changes of Dipeptidyl Peptidase IV Activity Distribution in Glioma Cells Induced by Alteration of Proliferation Rate and Status...Changes of Dipeptidyl Peptidase IV Activity Distribution in Glioma Cells Induced by Alteration of Proliferation Rate and Status...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
http://www.biochemsoctrans.org/content/28/5/A295.3
Inhibitors of dipeptidyl peptidase IV: a novel approach for the prevention and treatment of Type 2 diabetes? - StaffInhibitors of dipeptidyl peptidase IV: a novel approach for the prevention and treatment of Type 2 diabetes? - Staff
This is a list of all employees at the Department of Biomedical Sciences. The list is sorted in alphabetical order in accordance to the employees first name.
https://bmi.ku.dk/english/Staff/?pure=en%2Fpublications%2Finhibitors-of-dipeptidyl-peptidase-iv-a-novel-approach-for-the-prevention-and-treatment-of-type-2-diabetes
anti-CD26 antibody [M-A261] | GeneTexanti-CD26 antibody [M-A261] | GeneTex
CD26 antibody [M-A261] (dipeptidyl peptidase 4) for FACS, IHC-Fr, IP. Anti-CD26 mAb (GTX74879) is tested in Human samples. 100% Ab-Assurance.
http://www.genetex.com/CD26-antibody-M-A261-GTX74879.html
CTSB (Human) Recombinant Protein (P02) - (H00001508-P02) - Products - Abnova
Human CTSB full-length ORF (NP_001899.1, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. (H00001508-P02) - Products - Abnova
http://www.abnova.com/products/products_detail.asp?catalog_id=H00001508-P02
Tripterígids - Viquipèdia, lenciclopèdia lliureTripterígids - Viquipèdia, lenciclopèdia lliure
Rüppell W. P. E. S., 1835-1838. Neue Wirbelthiere zu der Fauna von Abyssinien gehörig. Fische des Rothen Meeres. Frankfurt-am-Main. 1-148, Pls. 1-33. (1835:1-28, Pls. 1-7; 1836:29-52, Pls. 8-14; 1837:53-80, Pls. 15-21; 1838:81-148, Pls. 22-33.) Fische Rothen Meeres 1835-38 ...
https://ca.wikipedia.org/wiki/Tripter%C3%ADgids
CathepsinCathepsin
... A (serine protease) Cathepsin B (cysteine protease) Cathepsin C (cysteine protease) Cathepsin D (aspartyl protease) ... Cathepsin H (cysteine protease) Cathepsin K (cysteine protease) Cathepsin L1 (cysteine protease) Cathepsin L2 (or V) (cysteine ... Cathepsin S (cysteine protease) Cathepsin W (cysteine proteinase) Cathepsin Z (or X) (cysteine protease) Cathepsins are ... Cathepsin K has also been shown to play a role in arthritis. Mouse cathepsin L is homologous to human cathepsin V. Mouse ...
https://en.wikipedia.org/wiki/Cathepsin
Cathepsin TCathepsin T
... (EC 3.4.22.24) is an enzyme. This enzyme catalyses the following chemical reaction: Interconversion of the three ... Cathepsin+T at the US National Library of Medicine Medical Subject Headings (MeSH) Portal: Biology (EC 3.4.22). ... Cathepsin Gohda E, Pitot HC (May 1981). "Purification and characterization of a new thiol proteinase from rat kidney". ... Pitot HC, Gohda E (1987). "Cathepsin T". Methods in Enzymology. 142: 279-89. doi:10.1016/s0076-6879(87)42038-7. PMID 2885716. ...
https://en.wikipedia.org/wiki/Cathepsin_T
Cathepsin FCathepsin F
... is a protein that in humans is encoded by the CTSF gene. Cysteine cathepsins are a family of cysteine proteases ... The cathepsin F gene is ubiquitously expressed, and it maps to chromosome 11q13, close to the gene encoding cathepsin W. ... Wex T, Levy B, Wex H, Brömme D (1999). "Human cathepsins F and W: A new subgroup of cathepsins". Biochem. Biophys. Res. Commun ... Wex T, Wex H, Brömme D (2000). "The human cathepsin F gene--a fusion product between an ancestral cathepsin and cystatin gene ...
https://en.wikipedia.org/wiki/Cathepsin_F
Cathepsin LCathepsin L
... may refer to: Cathepsin L1, a human protease enzyme encoded by the CTSL gene and known for its role in viral entry ... Cathepsin L2, a human protease enzyme encoded by the CTSV gene and also known as cathepsin V This disambiguation page lists ... articles associated with the title Cathepsin L. If an internal link led you here, you may wish to change the link to point ...
https://en.wikipedia.org/wiki/Cathepsin_L
Cathepsin WCathepsin W
"Human cathepsins W and F form a new subgroup of cathepsins that is evolutionary separated from the cathepsin B- and L-like ... Wex T, Levy B, Wex H, Brömme D (1999). "Human cathepsins F and W: A new subgroup of cathepsins". Biochem. Biophys. Res. Commun ... The protein encoded by this gene, a member of the peptidase C1 family of cysteine cathepsins, is a cysteine protease cathepsin ... 2003). "Characterization of novel anti-cathepsin W antibodies and cellular distribution of cathepsin W in the gastrointestinal ...
https://en.wikipedia.org/wiki/Cathepsin_W
Cathepsin SCathepsin S
... cathepsin S can be replaced by cathepsin F. Secreted cathepsin S cleaves some extracellular matrix (ECM) proteins. Cathepsin S ... "Engineering the S2 subsite specificity of human cathepsin S to a cathepsin L- and cathepsin B-like specificity". The Journal of ... In vitro, cathepsin S retains some enzyme activity in the presence of 3M urea. Cathepsin S is produced as a zymogen and is ... Cathepsin S can function as an elastase over a broad pH range in alveolar macrophages. Cathepsin S is a lysosomal enzyme that ...
https://en.wikipedia.org/wiki/Cathepsin_S
Cathepsin XCathepsin X
... (EC 3.4.18.1, cathepsin B2, cysteine-type carboxypeptidase, cathepsin IV, cathepsin Z, acid carboxypeptidase, ... Shows weak endopeptidase activity Cathepsin X is a cysteine cathepsin, a lysosomal cysteine peptidase of family C1 (papain ... Otto K, Riesenkönig H (February 1975). "Improved purification of cathepsin B1 and cathepsin B2". Biochimica et Biophysica Acta ... "On the substrate specificity of cathepsins B1 and B2 including a new fluorogenic substrate for cathepsin B1". Life Sciences. 17 ...
https://en.wikipedia.org/wiki/Cathepsin_X
Cathepsin DCathepsin D
... can also be found in the extracellular space and it is one of the few cathepsins, that shows some activity at ... Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes. The main function of cathepsin D is to ... "Entrez Gene: CTSD cathepsin D". Barrett AJ (April 1970). "Cathepsin D. Purification of isoenzymes from human and chicken liver ... The optimum pH for cathepsin D in vitro is 4.5-5.0. Cathepsin-D is an aspartic protease that depends critically on protonation ...
https://en.wikipedia.org/wiki/Cathepsin_D
Cathepsin KCathepsin K
... is degraded by Cathepsin S, in a process referred to as Controlled Cathepsin Cannibalism. Cathepsin K expression is ... Cathepsin K has also been found to be over-expressed in glioblastoma. That the expression of cathepsin K is characteristic for ... Cathepsin K antibodies are marketed for research into expression of this enzyme by various cells. Merck had a cathepsin K ... Other cathepsin K inhibitors are in various stages of development. Medivir has a cathepsin K inhibitor, MIV-711 (L-006235), in ...
https://en.wikipedia.org/wiki/Cathepsin_K
Cathepsin ZCathepsin Z
... cathepsin C, cathepsin F, cathepsin H, cathepsin K, cathepsin L, cathepsin L2 or V, cathepsin O, cathepsin S, cathepsin Z, and ... Cathepsin Z, also called cathepsin X or cathepsin P, is a protein that in humans is encoded by the CTSZ gene. It is a member of ... As one of the 11 cathepsins, cathepsin Z contains distinctive features from others. Cathepsin Z has been reported involved in ... Cathepsin Z has an exposed integrin-binding Arg-Gly-Asp motif within the propeptide of the enzyme, through which cathepsin Z ...
https://en.wikipedia.org/wiki/Cathepsin_Z
Cathepsin L1Cathepsin L1
"Entrez Gene: CTSL1 cathepsin L1". Barrett AJ, Kirschke H (1981). "Cathepsin B, Cathepsin H, and cathepsin L". Methods in ... or by cathepsins (primarily cathepsin L) in endolysosomes. Hydroxychloroquine inhibits the action of cathepsin L in ... Cathepsin L1 is a protein that in humans is encoded by the CTSL1 gene. The protein is a cysteine cathepsin, a lysosomal ... Cathepsin L1 is a member of the Peptidase C1 (cathepsin) MEROPS family, which plays an important role in diverse processes ...
https://en.wikipedia.org/wiki/Cathepsin_L1
Cathepsin HCathepsin H
... is a protein that in humans is encoded by the CTSH gene. The protein encoded by this gene is a cysteine cathepsin, ... "Entrez Gene: CTSH cathepsin H". Sawicki G, Warwas M (1990). "Cathepsin H from human placenta". Acta Biochim. Pol. 36 (3-4): 343 ... 2003). "Expression of cathepsins B, H, K, L, and S during human fetal lung development". Dev. Dyn. 225 (1): 14-21. doi:10.1002/ ... 2001). "Expression of cathepsins B, H, K, L, and S and matrix metalloproteinases 9 and 13 during chondrocyte hypertrophy and ...
https://en.wikipedia.org/wiki/Cathepsin_H
Cathepsin GCathepsin G
... is one of those homologous protease that evolved from a common ancestor by gene duplication. Cathepsin G is a 255- ... An upregulation of cathepsin G was reported in studies of keratoconus. Cathepsin G has been found to interact with: SERPINB1 ... "Entrez Gene: CTSG cathepsin G". Shafer WM, Pohl J, Onunka VC, Bangalore N, Travis J (January 1991). "Human lysosomal cathepsin ... "Generation of the neutrophil-activating peptide-2 by cathepsin G and cathepsin G-treated human platelets". The American Journal ...
https://en.wikipedia.org/wiki/Cathepsin_G
Cathepsin CCathepsin C
... prepro-cathepsin C) comprising signal peptides of 24 residues, pro-regions of 205 (rat cathepsin C) or 206 (human cathepsin C) ... Cathepsin C appears to be a central coordinator for activation of many serine proteases in immune/inflammatory cells. Cathepsin ... identical to the mature amino acid sequences of papain and a number of other cathepsins including cathepsins, B, H, K, L, and S ... "Entrez Gene: CTSC cathepsin C". Paris A, Strukelj B, Pungercar J, Renko M, Dolenc I, Turk V (Aug 1995). "Molecular cloning and ...
https://en.wikipedia.org/wiki/Cathepsin_C
Cathepsin zymographyCathepsin zymography
Cathepsin K detection by zymography Zymographic techniques for detection of cathepsins K, L, S, and V Zymography for detection ... Cathepsin zymography is a technique for quantifying enzymatic activity of the cathepsin family of cysteine proteases. It is ... While the proform of cathepsins are generally stable, once activated, proteases such as cathepsin K are vulnerable to ... After the renaturing period, the gel is then incubated in assay buffer to allow the now active cathepsins to proteolyze the ...
https://en.wikipedia.org/wiki/Cathepsin_zymography
Cathepsin L2Cathepsin L2
... , (EC 3.4.22.43, also known as cathepsin V or cathepsin U), is a protein encoded in humans by the CTSV gene. The ... "Entrez Gene: CTSL2 cathepsin L2". Brömme D, Li Z, Barnes M, Mehler E (February 1999). "Human cathepsin V functional expression ... 2006). "Cystatin M/E is a high affinity inhibitor of cathepsin V and cathepsin L by a reactive site that is distinct from the ... 2007). "Inhibition of cathepsin L-like proteases by cathepsin V propeptide". Biol. Chem. 388 (5): 541-5. doi:10.1515/BC. ...
https://en.wikipedia.org/wiki/Cathepsin_L2
Cathepsin ACathepsin A
... is an enzyme that is classified both as a cathepsin and a carboxypeptidase. In humans, it is encoded by the CTSA ... Cathepsin+A at the US National Library of Medicine Medical Subject Headings (MeSH) Portal: Biology v t e (Genes on human ... "Entrez Gene: CTSA cathepsin A". Mitchell, Richard Sheppard; Kumar, Vinay; Robbins, Stanley L.; Abbas, Abul K.; Fausto, Nelson ( ... Cathepsin A has been shown to interact with NEU1. GRCh38: Ensembl release 89: ENSG00000064601 - Ensembl, May 2017 GRCm38: ...
https://en.wikipedia.org/wiki/Cathepsin_A
Cathepsin OCathepsin O
... is an enzyme that in humans is encoded by the CTSO gene. Cathepsin O is a cysteine cathepsin, a cysteine protease ... "Entrez Gene: cathepsin O". Shi GP, Chapman HA, Bhairi SM, et al. (1995). "Molecular cloning of human cathepsin O, a novel ... 1994). "Human cathepsin O. Molecular cloning from a breast carcinoma, production of the active enzyme in Escherichia coli, and ... "Genomic structure and chromosomal localization of the human cathepsin O gene (CTSO)". Genomics. 53 (2): 231-4. doi:10.1006/geno ...
https://en.wikipedia.org/wiki/Cathepsin_O
Cathepsin ECathepsin E
... cathepsin D-like acid proteinase, cathepsin E-like acid proteinase, cathepsin D-type proteinase) is an enzyme. Cathepsin E is a ... The structure of Cathepsin E is very similar to those of Cathepsin D and BACE1, and all 3 have almost identical active site ... Along with renin and Cathepsin D, Cathepsin E is one of the only few aspartic proteases known to be made in human tissues other ... A distinguishing factor of Cathepsin E in comparison with the structure of Cathepsin D and BACE1 can be seen at the formation ...
https://en.wikipedia.org/wiki/Cathepsin_E
Cathepsin BCathepsin B
In humans, cathepsin B is encoded by the CTSB gene. Cathepsin B is upregulated in certain cancers, in pre-malignant lesions, ... Cathepsin B belongs to a family of lysosomal cysteine proteases known as the cysteine cathepsins and plays an important role in ... Cathepsin B has been shown to interact with: CTSD CSTA, CSTB, and S100A10. Cathepsin B is inhibited by: Nitroxoline CA-074 ... Cathepsin B has been proposed as a potentially effective biomarker for a variety of cancers. Overexpression of cathepsin B is ...
https://en.wikipedia.org/wiki/Cathepsin_B
ChromatinChromatin
... , Histones & Cathepsin; PMAP The Proteolysis Map-animation Nature journal: recent chromatin publications and news ...
https://en.wikipedia.org/wiki/Chromatin
Polysulfated glycosaminoglycanPolysulfated glycosaminoglycan
... collagenases such as cathepsin B1; and hyaluronidase. PSGAG inhibits the synthesis of prostaglandin E2, which is released upon ...
https://en.wikipedia.org/wiki/Polysulfated_glycosaminoglycan
Carboxypeptidase CCarboxypeptidase C
Cathepsin A Breddam, K. (1986). "Serine carboxypeptidases. A review". Carlsberg Res. Commun. 51: 83-128. doi:10.1007/bf02907561 ... Miller JJ, Changaris DG, Levy RS (December 1992). "Purification, subunit structure and inhibitor profile of cathepsin A". ... Carboxypeptidase C (EC 3.4.16.5, carboxypeptidase Y, serine carboxypeptidase I, cathepsin A, lysosomal protective protein, ...
https://en.wikipedia.org/wiki/Carboxypeptidase_C
KeratinocyteKeratinocyte
Cathepsin E. TALE homeodomain transcription factors. Hydrocortisone. Since keratinocyte differentiation inhibits keratinocyte ... "The role of cathepsin E in terminal differentiation of keratinocytes". Biological Chemistry. 392 (6): 571-85. doi:10.1515/BC. ...
https://en.wikipedia.org/wiki/Keratinocyte
Batten diseaseBatten disease
Cathepsin D is involved in CLN10. DNA analysis can be used to help confirm the diagnosis of Batten disease. When the mutation ...
https://en.wikipedia.org/wiki/Batten_disease
MedivirMedivir
Miv-711 Cathepsin K inhibitor for osteoarthritis. Fast track (FDA) MALT1 "Swedish pharma firm Medivir partners Aragen Life ...
https://en.wikipedia.org/wiki/Medivir
Protease inhibitor (biology)Protease inhibitor (biology)
... these include cathepsin L, papain, and procaricain. It forms an alpha-helical domain that runs through the substrate-binding ...
https://en.wikipedia.org/wiki/Protease_inhibitor_(biology)
CUX1CUX1
"Cathepsins as transcriptional activators? Developmental Cell 2004, 6(5):610-1. Goulet B, and Nepveu A. "Complete and Limited ...
https://en.wikipedia.org/wiki/CUX1
HistolysainHistolysain
Lushbaugh WB, Hofbauer AF, Pittman FE (June 1985). "Entamoeba histolytica: purification of cathepsin B". Experimental ...
https://en.wikipedia.org/wiki/Histolysain
Cystatin BCystatin B
The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins L, H and B. The protein ... 1994). "Cathepsin B activity in human lung tumor cell lines: ultrastructural localization, pH sensitivity, and inhibitor status ... 1988). "Cathepsin D inactivates cysteine proteinase inhibitors, cystatins". Biochem. Biophys. Res. Commun. 154 (2): 765-72. doi ... Cystatin B has been shown to interact with Cathepsin B. GRCh38: Ensembl release 89: ENSG00000160213 - Ensembl, May 2017 GRCm38 ...
https://en.wikipedia.org/wiki/Cystatin_B
4P6E: Crystal Structure Of Human Cathepsin S Bound To A Non-covalent Inhibitor4P6E: Crystal Structure Of Human Cathepsin S Bound To A Non-covalent Inhibitor
CATHEPSIN SN-[(8r)-8-(Benzoylamino)-5,6,7,8-Tetrahydronaphthalen-2-Yl]-4-Methylpiperazine-1-CarboxamideSulfate Ion ... 4P6E: Crystal Structure Of Human Cathepsin S Bound To A Non-covalent Inhibitor. ...
https://www.ncbi.nlm.nih.gov/Structure/pdb/4P6E
Mouse Cathepsin F ELISA KitMouse Cathepsin F ELISA Kit
A Sandwich ELISA, Double Antibody ELISA kit for the detection of Mus musculus, Mouse, Cathepsin F, Ctsf, 3.4.22.41
https://www.gbiosciences.com/IT15382
Inhibiting Cathepsin G to Protect Against Photoaging and Infraaging | Cosmetics & ToiletriesInhibiting Cathepsin G to Protect Against Photoaging and Infra'aging | Cosmetics & Toiletries
Polygonum aviculare extract is a cathepsin G inhibitor, and is shown here to oppose photoaging and infraaging by improving ... Cathepsin G activity: The effect of Polygonum aviculare extracta on cathepsin G activity was evaluated using an enzymatic assay ... In addition, cathepsin G has been shown in vitro to degrade elastin into fragments that can be further processed by elastase.9 ... The cathepsin G inhibitor phosphonic acid served as a positive control. Results presented in Figure 2 show a neat inhibition of ...
https://www.cosmeticsandtoiletries.com/cosmetic-ingredients/actives/article/21835979/inhibiting-cathepsin-g-to-protect-against-photoaging-and-infraaging
Rat Cathepsin S (CTSS) ELISA kit | CSB-EL006204RA | CusabioRat Cathepsin S (CTSS) ELISA kit | CSB-EL006204RA | Cusabio
Rat Cathepsin S (CTSS) ELISA kit from Cusabio. Cat#: CSB-EL006204RA. US, UK & Europe Distribution. Online Order or Request ... Rat Cathepsin S (CTSS) ELISA kit , CSB-EL006204RA Cusabio Elisa Rat Cathepsin S (CTSS) ELISA kit , CSB-EL006204RA. (No reviews ... Recombinant Human Cathepsin S (CTSS) , CSB-EP006204HU , CusabioAlternative Name(s): Cathepsin S; CathepsinS; CATS_HUMAN; ... Human Cathepsin S (CTSS) ELISA Kit , CSB-E13722h , CusabioHuman Cathepsin S (CTSS) ELISA Kit is Available at Gentaur Genprice ...
https://joplink.net/rat-cathepsin-s-ctss-elisa-kit-csb-el006204ra/
Peripheral Role of Cathepsin S in Th1 Cell-Dependent Transition of Nerve Injury-Induced Acute Pain to a Chronic Pain State |...Peripheral Role of Cathepsin S in Th1 Cell-Dependent Transition of Nerve Injury-Induced Acute Pain to a Chronic Pain State |...
Peripheral Role of Cathepsin S in Th1 Cell-Dependent Transition of Nerve Injury-Induced Acute Pain to a Chronic Pain State. ... Peripheral Role of Cathepsin S in Th1 Cell-Dependent Transition of Nerve Injury-Induced Acute Pain to a Chronic Pain State ... Peripheral Role of Cathepsin S in Th1 Cell-Dependent Transition of Nerve Injury-Induced Acute Pain to a Chronic Pain State ... Peripheral Role of Cathepsin S in Th1 Cell-Dependent Transition of Nerve Injury-Induced Acute Pain to a Chronic Pain State ...
https://www.jneurosci.org/content/34/8/3013/tab-e-letters
Peptide synthesis by recombinant Fasciola hepatica cathepsin L1 - DORASPeptide synthesis by recombinant Fasciola hepatica cathepsin L1 - DORAS
Ruth, Deborah M., McMahon, Gillian and Ó Fágáin, Ciarán (2006) Peptide synthesis by recombinant Fasciola hepatica cathepsin L1. ... fasciola hepatica cathepsin L1; recombinant; enzymatic peptide synthesis; cysteine proteinase;. Subjects:. Biological Sciences ... Synthesis of the tripeptide Z-Phe-Arg-SerNH2 has been accomplished by a recombinant cysteine protease, cathepsin L1 from liver ...
https://doras.dcu.ie/78/
Cathepsins - Proteases - Proteins and Enzymes - ProductsCathepsins - Proteases - Proteins and Enzymes - Products
... but it is currently unclear how cathepsins mediate apoptosis. Cathepsins are lysosomal enzymes that are also used as sensitive ... The cathepsin assays are simple, straightforward, and can be adapted to 96-well plate assays. Assay conditions have been ... BioVisions newly developed Cathepsin Activity Assay kits are fluorescence-based assays that utilize the preferred substrate ... Cell lysates or other samples that contain cathepsins will cleave the synthetic substrate to release free AFC. The released ...
https://www.biovision.com/products/proteins-and-enzymes/proteases/cathepsins.html
Ward, C., Kuehn, D., Burden, R.E., et al. (2010) Antibody targeting of cathepsin S inhibits angiogenesis and synergistically...Ward, C., Kuehn, D., Burden, R.E., et al. (2010) Antibody targeting of cathepsin S inhibits angiogenesis and synergistically...
2010) Antibody targeting of cathepsin S inhibits angiogenesis and synergistically enhances anti-VEGF. PLoS One, 5, Article ID ... TITLE: Antibody research targeting Cathepsin S for cancer therapy AUTHORS: Hang Fai Kwok KEYWORDS: Cathepsin S; Tumor; ... ABSTRACT: Cathepsin S is a cysteine protease highly expressed in many type of cancers including colorectal, prostate, breast, ... Immunoexpression of Cathepsin D and S100A4 Protein and Their Molecular Subtyptes in Canine Mammary Carcinomas ...
https://scirp.org/reference/referencespapers.aspx?referenceid=786161
Investigating the role of cathepsin S in the pathogenesis of cystic fibrosis-like lung disease | European Respiratory SocietyInvestigating the role of cathepsin S in the pathogenesis of cystic fibrosis-like lung disease | European Respiratory Society
Investigating the role of cathepsin S in the pathogenesis of cystic fibrosis-like lung disease. Ryan Brown, Donna Small, ... Elevated levels of the cysteine protease cathepsin S (cat S) are found in cystic fibrosis (CF) lung secretions, however, the ... Investigating the role of cathepsin S in the pathogenesis of cystic fibrosis-like lung disease ... Investigating the role of cathepsin S in the pathogenesis of cystic fibrosis-like lung disease ...
https://erj.ersjournals.com/content/46/suppl_59/PA3903
Cathepsin G (human neutrophils), (purified) - BML-SE283 - Enzo Life SciencesCathepsin G (human neutrophils), (purified) - BML-SE283 - Enzo Life Sciences
Cathepsin G cleaves and activates IL-36γ and promotes the inflammation of psoriasis: J. Guo, et al.; Drug Des. Devel. Ther. 13 ... Development of a highly potent, selective, and cell-active Inhibitor of cysteine cathepsin L-A hybrid design approach: D. Dana ... Cell penetrable, clickable and tagless activity-based probe of human cathepsin L: D. Dana, et al.; Bioorg. Chem. 85, 505 (2019 ... Development of cell-active non-peptidyl inhibitors of cysteine cathepsins: D. Dana, et al.; Bioorg. Med. Chem. 21, 2975 (2013 ...
https://www.enzolifesciences.com/BML-SE283/cathepsin-g-human-neutrophils-purified/
Human Cathepsin D ELISA Kit Price PicoKine® | BosterBioHuman Cathepsin D ELISA Kit Price PicoKine® | BosterBio
Human Cathepsin D ELISA Kit PicoKine™ (96 Tests). Quantitate Human CTSD in cell culture supernatants, cell lysates, serum ... More Cathepsin D Products. *Mouse Cathepsin D ELISA Kit PicoKine® (EK0673). *Human Cathepsin D PicoKine® Quick ELISA Kit ( ... Human Cathepsin D ELISA Kit PicoKine®. Cathepsin D ELISA kit for Human. Human Cathepsin D ELISA Kit PicoKine™ (96 Tests). ... Background of Cathepsin D. Cathepsin D is a protein that in humans is encoded by the CTSD gene. This proteinase is a member of ...
https://www.bosterbio.com/human-cathepsin-d-picokine-trade-elisa-kit-ek0672-boster.html
Two-step mechanism of inhibition of cathepsin B by cystatin C, due to the inhibitor displacing the occluding loop of the enzyme...Two-step mechanism of inhibition of cathepsin B by cystatin C, due to the inhibitor displacing the occluding loop of the enzyme...
Cysteine proteinase, Cysteine proteinase inhibitor, Cathepsin, Cystatin, Kinetics. in FEBS Letters. volume. 422. issue. 1. ... Two-step mechanism of inhibition of cathepsin B by cystatin C, due to the inhibitor displacing the occluding loop of the enzyme ... Stopped-flow kinetics showed that the inhibition of the lysosomal cysteine proteinase, cathepsin B, by its endogenous inhibitor ... Stopped-flow kinetics showed that the inhibition of the lysosomal cysteine proteinase, cathepsin B, by its endogenous inhibitor ...
https://lup.lub.lu.se/search/publication/1113877
Expression of the elastolytic cathepsins S and K in human atheroma and regulation of their production in smooth muscle cellsExpression of the elastolytic cathepsins S and K in human atheroma and regulation of their production in smooth muscle cells
A selective inhibitor of cathepsin S blocked , 80% of this elastolytic activity. The presence of cathepsins K and S at sites of ... Expression of the elastolytic cathepsins S and K in human atheroma and regulation of their production in smooth muscle cells. ... Expression of the elastolytic cathepsins S and K in human atheroma and regulation of their production in smooth muscle cells. ... "Expression of the Elastolytic Cathepsins S and K in Human Atheroma and Regulation of Their Production in Smooth Muscle Cells." ...
https://dash.harvard.edu/handle/1/13506487?show=full
Cathepsin H, Human Liver | Athens Research & Technology
A more basic protein than Cathepsin B or L. Functions as both an aminopeptidase and endopeptidase. Cathepsin H, like cathepsin ... Gel Scan of Cathepsin H, Human Liver. This information is representative of the product ART prepares, but is not lot specific. ... "Cathepsin H functions as an aminopeptidase in secretory vesicles for production of enkephalin and galanin peptide ...
https://www.athensresearch.com/products/all/cathepsin-h-human-liver
Disruption of the Cathepsin K gene reduces atherosclerosis progression and induces plaque fibrosis but accelerates macrophage...
BACKGROUND-: Cathepsin K (catK), a lysosomal cysteine protease, was identified in a gene-profiling experiment that compared ... abstract = "BACKGROUND-: Cathepsin K (catK), a lysosomal cysteine protease, was identified in a gene-profiling experiment that ... keywords = "Atherosclerosis, Cathepsins, Lipids, Pathology, Proteases",. author = "E. Lutgens and Lutgens, {S. P.M.} and Faber ... N2 - BACKGROUND-: Cathepsin K (catK), a lysosomal cysteine protease, was identified in a gene-profiling experiment that ...
https://mayoclinic.pure.elsevier.com/en/publications/disruption-of-the-cathepsin-k-gene-reduces-atherosclerosis-progre
Cancer Markers - Cathepsin D - scrippslabs.comCancer Markers - Cathepsin D - scrippslabs.com
Cathepsin D. Cathepsin D is an estrogen-regulated, lysosomal acidic protease associated with tissue breakdown. Elevated levels ... Over-expression of Cathepsin D is also linked to tumorigenesis in prostate cancer and to aggressive forms of colorectal cancer ... In addition, Cathepsin D is associated with amyloid formation in Alzheimers plaques as is possibly linked to lung tissue ... Scripps Laboratories is a world-leading producer and supplier of purified human Cathepsin D. Products are prepared on-site and ...
https://scrippslabs.com/cathepsin-d-2/
Differential expression of Cathepsin E in transthyretin amyloidosis: from neuropathology to the immune system | Journal of...Differential expression of Cathepsin E in transthyretin amyloidosis: from neuropathology to the immune system | Journal of...
Cathepsin E (CtsE) is an important intermediate for antigen presentation and chemotaxis, but its role in the pathogenesis of ... Cathepsin E (CtsE) is an important intermediate for antigen presentation and chemotaxis, but its role in the pathogenesis of ... Cathepsin E (CtsE) is an aspartic protease mainly located at the endosomal compartment but also found in the endoplasmic ... Expression of Cathepsin E is downregulated in injured nerves from V30M animals. We have previously performed a transcriptomic ...
https://jneuroinflammation.biomedcentral.com/articles/10.1186/s12974-017-0891-9
The lysosomal endopeptidases Cathepsin D and L are selective and effective proteases for the middle-down characterization of...The lysosomal endopeptidases Cathepsin D and L are selective and effective proteases for the middle-down characterization of...
Cathepsin D, but not Cathepsin L, also cleaved directly below the Ab hinge, releasing the F(ab)2. When constrained by the ... The Cathepsin L and Cathepsin D clipping motifs were related to sequences of neutral amino acids and the tertiary structure of ... ENZYMES: Cathepsin L-EC 3.4.22.15, Cathepsin D-EC 3.4.23.5. show less ... The lysosomal endopeptidases Cathepsin D and L are selective and effective proteases for the middle-down characterization of ...
https://dspace.library.uu.nl/handle/1874/417445
Matrix-metalloproteinase-9 is cleaved and activated by Cathepsin K | BMC Research Notes | Full TextMatrix-metalloproteinase-9 is cleaved and activated by Cathepsin K | BMC Research Notes | Full Text
... treatment of recombinant proMMP-9 with recombinant cathepsin K (CTSK) at pH 5 yielded a fragment that corresponded to the ... Drake FH, Dodds RA, James IE, Connor JR, Debouck C, Richardson S et al (1996) Cathepsin K, but not cathepsins B, L, or S, is ... Lysosomal cysteine cathepsin (LCC) is a subgroup of the family of cathepsin proteases that requires an acidic environment for ... Activators of MMP-9 include MMP-2 [14, 15], MMP-3 [14, 16], MMP-7 [17], MMP-10 [18], MMP-13 [19], cathepsin G [20] and ...
https://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-015-1284-8
Cathepsin K (CTSK) Antibody | Abbexa LtdCathepsin K (CTSK) Antibody | Abbexa Ltd
Cathepsin K Antibody is a Mouse Monoclonal against Cathepsin K. ... Anti-Cathepsin O, Anti-Cathepsin O antibody, Cathepsin O ... Anti-Cathepsin X, Anti-Cathepsin X antibody, Cathepsin X antibody, Antibody against Cathepsin X ... Cathepsin K Antibody is a Mouse Monoclonal against Cathepsin K. Target. Cathepsin K (CTSK). ... CTS-K, CTS02, CTSO, CTSO1, CTSO2, PKND, PYCD, Pycnodysostosis, Cathepsin O, Cathepsin X, Anti-CTS-K, Anti-CTS-K antibody, CTS-K ...
https://www.abbexa.com/cathepsin-k-antibody-6
InnoZyme™ Cathepsin B Activity Assay Kit, Fluorogenic | CBA001InnoZyme™ Cathepsin B Activity Assay Kit, Fluorogenic | CBA001
Cathepsin B Activity Assay Kit, Fluorogenic - Find MSDS or SDS, a COA, data sheets and more information. ... Table 2: Cathepsin B activity in cell lysates. Cathepsin B activity in five human cell line lysates as measured with Cathepsin ... Cathepsin B Inhibitor, Reduction Reagent, Cathepsin B Substrate, and Calibration Standard at -20°C. Control Cathepsin B(aliquot ... Cathepsin B Inhibitor, Reduction Reagent, Cathepsin B Substrate, and Calibration Standard at -20°C. Control Cathepsin B(aliquot ...
https://www.emdmillipore.com/PR/en/product/InnoZyme-Cathepsin-B-Activity-Assay-Kit-Fluorogenic,EMD_BIO-CBA001
Cathepsin S-mediated autophagic flux in tumor-associated macrophages accelerate tumor development by promoting M2 polarization ...Cathepsin S-mediated autophagic flux in tumor-associated macrophages accelerate tumor development by promoting M2 polarization ...
Cathepsin S (Cat S) expression was analyzed in human colon carcinoma and normal colon tissues. In vivo effects were evaluated ... Cathepsin S (Cat S), unlike the ubiquitous cathepsin B (Cat B) and cathepsin L (Cat L), exhibits a restricted tissue expression ... cathepsins are now recognized that cysteine proteases play pivotal roles in cancer progression[20]. Of the cysteine cathepsins ... Cathepsin S (Cat S) expression was analyzed in human colon carcinoma and normal colon tissues. In vivo effects were evaluated ...
https://molecular-cancer.biomedcentral.com/articles/10.1186/1476-4598-13-43
Cathepsin K: boon or bale for atherosclerotic plaque stability?Cathepsin K: boon or bale for atherosclerotic plaque stability?
... , Cardiovascular Research, December 2008, European Society of ...
https://www.growkudos.com/publications/10.1093%25252Fcvr%25252Fcvn343/reader
Cathepsin S dominates autoantigen processing in human thymic dendritic cellsCathepsin S dominates autoantigen processing in human thymic dendritic cells
... Author: Stoeckle, Christina; Quecke, Paula; ... Cathepsin S dominates autoantigen processing in human thymic dendritic cells. DSpace Repository. Login ...
https://publikationen.uni-tuebingen.de/xmlui/handle/10900/50952
Cathepsin | 组织蛋白酶 | 抑制剂 | MCECathepsin | 组织蛋白酶 | 抑制剂 | MCE
There are about 15 classes of cathepsins in humans (Cathepsin A, B, C, D, E, F, G, H, K, L, O, S, V, W, and Z). ... Cathepsins are vital for digestion, coagulation, immune response, adipogenesis, hormone liberation, peptide synthesis, among a ... Cathepsins are proteases with serine, cysteine, or aspartic acid residues as the nucleophiles. ... Cathepsin X-IN-1 Inhibitor 98.81% Cathepsin X-IN-1 (compound 25) 是一种有效的 组织蛋白酶 X 抑制剂，IC50 为 7.13 µM。Cathepsin X-IN-1 降低 PC-3 细胞迁 ...
https://www.medchemexpress.cn/Targets/Cathepsin.html
Cathepsin S: investigating an old player in lung disease pathogenesis, comorbidities, and potential therapeutics | Respiratory...Cathepsin S: investigating an old player in lung disease pathogenesis, comorbidities, and potential therapeutics | Respiratory...
... a lysosomal protease and a member of the cysteine cathepsin protease family, is linked to the pathogenesis of multiple diseases ... Dysregulated expression and activity of cathepsin S (CTSS), ... Plasma Cathepsin S and Cathepsin S/cystatin C ratios are ... CTSS is one of 11 cysteine cathepsin proteases, which is the largest cathepsin subclass. Cathepsins B, C, F, H, L, O, and X are ... Cathepsins in human obesity: changes in energy balance predominantly affect cathepsin s in adipose tissue and in circulation. J ...
https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-020-01381-5
Cathepsin H › PeptaNovaCathepsin H › PeptaNova
SKU: 3113-v Category: Cathepsin and Thiol Protease Substrates Tags: Cathepsin H, substrate ...
https://peptanova.de/product-tag/cathepsin-h/
Inhibition of cathepsin B activity attenuates extracellular matrix degradation and inflammatory breast cancer invasion | Breast...Inhibition of cathepsin B activity attenuates extracellular matrix degradation and inflammatory breast cancer invasion | Breast...
A functional role for cathepsin B was confirmed by the ability of CA074, a cell impermeable and highly selective cathepsin B ... Here we explored a role for active cathepsin B on the cell surface in the invasiveness of IBC. We examined expression of the ... Our study is the first to show that the proteolytic activity of cathepsin B and its co-expression with caveolin-1 contributes ... A statistically significant co-expression of cathepsin B and caveolin-1 was found in IBC patient biopsies, thus validating our ...
https://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3058
November | 2015 | Cathepsin K
Cathepsin K. Cathepsin K is a cysteine protease expressed predominantly in osteoclasts. Search. Main menu. Skip to primary ...
https://cathepsink.com/2015/11
Cathepsin D - MRM ProteomicsCathepsin D - MRM Proteomics
MRM Proteomics Inc. was established in 2010 as a spin-out company to commercialize the cutting-edge proteomics technologies, tools and know-how developed at the University of Victoria-Genome BC Proteomics Centre.. ...
https://mrmproteomics.com/product/cathepsin-d/
ProteasesInhibitorInhibitorsProteaseEnzymesPresence of cathepsinsCtsEProteinsFluorescenceAntibodiesAntibodyInhibitionPeptideTumorGeneAssayELISA KitXenopusExpressionRecombinantSubstrateMacrophagesSequencePathogenesisActivityHomoDegradationActiveDegrade elastinContrastInflammatory breastSignificantlyImmune system
Proteases9
  • There is growing recognition that alternative proteolytic enzymes such as the lysosomal cathepsin proteases may initiate or propagate proapoptotic signals, but it is currently unclear how cathepsins mediate apoptosis. (biovision.com)
  • Here, we explore the proteases Cathepsins L and D for forming protein fragments from three IgG1s, one IgG2, and one bispecific, knob-and-hole IgG1. (uu.nl)
  • Lysosomal cysteine cathepsin (LCC) is a subgroup of the family of cathepsin proteases that requires an acidic environment for optimal activation, and is found mainly in the acidic lysosomes where they participate in protein turnover and degradation of internalized ECM [ 25 ]. (biomedcentral.com)
  • CTSS is one of 11 cysteine cathepsin proteases, which is the largest cathepsin subclass. (biomedcentral.com)
  • Serine and cysteine cathepsin (Cts) proteases are an important class of intracellular and pericellular enzymes mediating multiple aspects of tumor development. (elsevier.com)
  • As well as activity in lysosomal protein degradation, cathepsin C also plays a key role in the activation of granule serine proteases in cytotoxic T cells, natural killer cells (granzymes A and B), mast cells (chymase and tryptase) and neutrophils (cathepsin G, neutrophil elastase, proteinase 3). (guidetoimmunopharmacology.org)
  • Cathepsins B and B-like proteases are identified in various species [ 3 ]. (ijbs.com)
  • Cathepsins B-like and L-like cysteine proteases are found in Caenorhabditis elegans [ 4 , 5 ]. (ijbs.com)
  • Moreover, several cathepsins and cathepsin-like proteases are revealed through functional and structural analyses in fishes, amphibians, reptiles, and birds in addition to mammals [ 11 ]. (ijbs.com)
Inhibitor6
  • 6, 7 Further, in one animal model of photoaging, a cathepsin G inhibitor prevented UVB-induced ECM degradation, suggesting activation of the enzyme by UVB as well. (cosmeticsandtoiletries.com)
  • Once activated, cathepsin G degrades fibronectin (FN) into fragments that induce and up-regulate the expression and activity of matrix metalloproteinase (MMP-1 and MMP-2) while simultaneously inhibiting the expression of tissue inhibitor of metalloproteinase-1 (TIMP-1)-the natural inhibitor of MMPs. (cosmeticsandtoiletries.com)
  • Stopped-flow kinetics showed that the inhibition of the lysosomal cysteine proteinase, cathepsin B, by its endogenous inhibitor, cystatin C, occurs by a two-step mechanism, in which an initial, weak interaction is followed by a conformational change. (lu.se)
  • article{d5c1ff8e-0690-4d5e-85b5-097b38cc0bdd, abstract = {{Stopped-flow kinetics showed that the inhibition of the lysosomal cysteine proteinase, cathepsin B, by its endogenous inhibitor, cystatin C, occurs by a two-step mechanism, in which an initial, weak interaction is followed by a conformational change. (lu.se)
  • A functional role for cathepsin B was confirmed by the ability of CA074, a cell impermeable and highly selective cathepsin B inhibitor, to significantly reduce pericellular proteolysis and invasion by SUM149 cells. (biomedcentral.com)
  • 100 muM for cathepsin B). This compound could act as a new lead for the further development of improved inhibitors within this inhibitor type. (canada.ca)
Inhibitors9
  • Active cathepsins, cathepsin inhibitors and cathepsin antibodies are also available. (biovision.com)
  • The Calbiochem ® Cathepsin B Activity Assay Kit, Fluorogenic is designed to measure cathepsin B activity in tissues extracts and cell lysates, and for screening cathepsin B inhibitors. (emdmillipore.com)
  • Exploration of the P1 SAR of aldehyde cathepsin K inhibitors. (expasy.org)
  • By screening a combinatorial pentapeptide amide collection in an inhibition assay, we systematically evaluated the potential of 19 proteinogenic amino acids and seven nonproteinogenic amino acids to serve as building blocks for inhibitors of human cathepsin L. Particularly efficient were aromatic, bulky, hydrophobic amino-acid residues, especially leucine, and positively charged residues, especially arginine. (uni-bielefeld.de)
  • This random approach for the design of inhibitors was introduced to compensate for the inaccuracy induced by shifted docking of combinatorial compound collections at the active center of cathepsin L. Thereby, we obtained structurally defined pentapeptide amides which inhibited human cathepsin L at nanomolar concentrations. (uni-bielefeld.de)
  • Among the most potent novel inhibitors, one peptide, RKLLW-NH2, shares the amphiphilic character of the nonamer fragment VMNGLQNRK of the autoinhibitory, substrate-like, but reverse-binding prosegment of human cathepsin L which blocks the active center of the enzyme. (uni-bielefeld.de)
  • Highly potent inhibitors of human cathepsin L identified by screening combinatorial pentapeptide amide collections", EUROPEAN JOURNAL OF BIOCHEMISTRY , vol. 267, 2000, pp. 5085-5092. (uni-bielefeld.de)
  • In a search for selective cathepsin L inhibitors as anticancer agents, a series of 2-cyanoprrolidine peptidomimetics, carrying a nitrile group as warhead, were designed. (canada.ca)
  • Inflammasome activation was confirmed using inhibitors of cathepsin B and Caspase-1. (cdc.gov)
Protease15
  • Synthesis of the tripeptide Z-Phe-Arg-SerNH2 has been accomplished by a recombinant cysteine protease, cathepsin L1 from liver fluke (Fasciola hepatica), using Z-Phe-Arg-OMe as acyl acceptor and SerNH2 as nucleophile in 0.1 M ammonium acetate pH 9.0-12.5% v/v acetonitrile at 37 °C. LC-MS detection indicated tripeptide formation after 10 min, continuing up to 5.5 h. (dcu.ie)
  • ABSTRACT: Cathepsin S is a cysteine protease highly expressed in many type of cancers including colorectal, prostate, breast, and glioblastoma's. (scirp.org)
  • Elevated levels of the cysteine protease cathepsin S (cat S) are found in cystic fibrosis (CF) lung secretions, however, the role of cat S in CF lung disease is unclear. (ersjournals.com)
  • Cathepsin G, a serine protease found in polymorphonuclear neutrophils (PMNs), functions in inflammation. (enzolifesciences.com)
  • BACKGROUND-: Cathepsin K (catK), a lysosomal cysteine protease, was identified in a gene-profiling experiment that compared human early plaques, advanced stable plaques, and advanced atherosclerotic plaques containing a thrombus, where it was highly upregulated in advanced stable plaques. (elsevier.com)
  • Cathepsin D is an estrogen-regulated, lysosomal acidic protease associated with tissue breakdown. (scrippslabs.com)
  • Cathepsins are protease enzymes, categorized into multiple families. (medchemexpress.cn)
  • Cathepsins can be serine protease, cysteine protease, or aspartyl protease. (medchemexpress.cn)
  • Dysregulated expression and activity of cathepsin S (CTSS), a lysosomal protease and a member of the cysteine cathepsin protease family, is linked to the pathogenesis of multiple diseases, including a number of conditions affecting the lungs. (biomedcentral.com)
  • In this review, we will focus on one cysteine protease in particular, cathepsin S (CTSS), and outline the research supporting its growing importance in pulmonary diseases and the potential of targeting of CTSS as a therapeutic option. (biomedcentral.com)
  • We examined expression of the cysteine protease cathepsin B and the serine protease urokinase plasminogen activator (uPA), its receptor uPAR and caveolin-1 in two IBC cell lines: SUM149 and SUM190. (biomedcentral.com)
  • The Magic Red Cathepsin K Kit uses a quick and easy method to analyze intracellular cathepsin K protease activity in whole living cells. (bio-rad-antibodies.com)
  • Cathepsin Magic Red Kits measure cathepsin K protease activity by detecting active cathepsins in whole, living cells. (bio-rad-antibodies.com)
  • Cathepsin C (CatC) is a lysosomal cysteine protease that is constitutively expressed at high levels in lung, kidney, liver and spleen. (guidetoimmunopharmacology.org)
  • Cathepsin L superfamily is a multifunctional cysteine protease enzyme and widely distributed in most animals. (ijbs.com)
Enzymes5
  • Cathepsins are lysosomal enzymes that are also used as sensitive markers in various toxicological investigations. (biovision.com)
  • Normal arteries contained little or no cathepsin K or S. In contrast, macrophages in atheroma contained abundant immunoreactive cathepsins K and S. Intimal smooth muscle cells (SMC), especially cells appearing to traverse the internal elastic laminae, also contained these enzymes. (harvard.edu)
  • The presence of cathepsins K and S at sites of vascular matrix remodeling and the ability of SMC and macrophages to use these enzymes to degrade elastin supports a role for elastolytic cathepsins in vessel wall remodeling and identifies novel therapeutic targets in regulating plaque stability. (harvard.edu)
  • ENZYMES: Cathepsin L-EC 3.4.22.15, Cathepsin D-EC 3.4.23.5. (uu.nl)
  • As multifunctional enzymes, cysteine cathepsins widely exist particularly in lysosomes. (ijbs.com)
Presence of cathepsins1
  • Instead, their methodology is based on a cell-permeable and non-cytotoxic reagent which is cleaved in the presence of cathepsins to produce a fluorescent product. (bio-rad-antibodies.com)
CtsE1
  • Cathepsin E (CtsE) is an important intermediate for antigen presentation and chemotaxis, but its role in the pathogenesis of FAP disease remains unknown. (biomedcentral.com)
Proteins3
  • Cathepsin H, like cathepsin L and B, is involved in the catabolism of proteins in the lysosomal system. (athensresearch.com)
  • Rodents contain 10 cysteine cathepsins and carry additional genes that express other cathepsins and cathepsin-like proteins [ 10 ]. (ijbs.com)
  • Western blotting showed increased Cox-2, Cyclin E, KLF4 and c-myc proteins and decreased expression of Cathepsin D. In addition, the KLF4 protein was higher in the chemically-induced cell strains compared to the spontaneously-occurring cell strains while COX-2 was higher in the spontaneously-occurring cell strains. (cdc.gov)
Fluorescence2
  • BioVision's newly developed Cathepsin Activity Assay kits are fluorescence-based assays that utilize the preferred substrate sequence for each cathepsin, labeled with AFC (amino-4-trifluoromethyl coumarin). (biovision.com)
  • The CB-NP could accumulate in tumor tissues, enter into tumor cells, and generate fluorescent signals in cytosol in response to cathepsin B. The results of non-invasive fluorescence imaging in a tumor-bearing mouse model demonstrated the potential of CB-NP for tumor diagnosis in clinical fields. (elsevier.com)
Antibodies2
  • IMSEAR at SEARO: Conformational studies of cathepsin B: interaction with specific antibodies. (who.int)
  • Bansal R, Singh S, Kidwai JR. Conformational studies of cathepsin B: interaction with specific antibodies. (who.int)
Antibody4
  • 2010) Antibody targeting of cathepsin S inhibits angiogenesis and synergistically enhances anti-VEGF. (scirp.org)
  • In recent years, antibody research specifically targeting Cathepsin S to block/inhibit tumorigenic effects were generated some positive preclinical data. (scirp.org)
  • This mini-review provides an overview of therapeutic antibody targeting Cathepsin S strategies in the last half decade, focusing on the rationale of cell-surface Cathepsin S targeted and their potential clinical application. (scirp.org)
  • Cathepsin K Antibody is a Mouse Monoclonal against Cathepsin K. (abbexa.com)
Inhibition1
  • The presence of this loop, which allows the enzyme to function as an exopeptidase, thus complicates the inhibition mechanism, rendering cathepsin B much less susceptible than other cysteine. (lu.se)
Peptide4
  • Cathepsin H functions as an aminopeptidase in secretory vesicles for production of enkephalin and galanin peptide neurotransmitters. (athensresearch.com)
  • The Magic Red reagent contains a cathepsin K target sequence peptide (LR) 2 linked to a red (Cresyl Violet) fluorescent probe. (bio-rad-antibodies.com)
  • We developed a cathepsin B-sensitive nanoprobe (CB-NP) with a cathepsin B substrate peptide probe and tumor-targeting glycol chitosan nanoparticles. (elsevier.com)
  • Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes. (bioss.com.cn)
Tumor1
  • Expression array and real time PCR analysis demonstrated increased expression of the cell cycle inhibitory factor p16 and the apoptotic factor Cathepsin D in all of the tumor cell strains. (cdc.gov)
Gene4
  • Cathepsin D is a protein that in humans is encoded by the CTSD gene. (bosterbio.com)
  • Positive selection was the specific cause of differentiation of cathepsin L family genes, confirming that gene function variation after expansion events was related to interactions with the environment and adaptability. (ijbs.com)
  • Cathepsin C gene variants in aggressive periodontitis. (cdc.gov)
  • Identification of novel mutation in cathepsin C gene causing Papillon-Lefèvre Syndrome in Mexican patients. (cdc.gov)
Assay1
  • The effect of Polygonum aviculare extract a on cathepsin G activity was evaluated using an enzymatic assay. (cosmeticsandtoiletries.com)
ELISA Kit4
  • Rat Cathepsin S (CTSS) ELISA kit is Available at Gentaur Genprice with the fastest delivery. (joplink.net)
  • CusabioHuman Cathepsin S (CTSS) ELISA Kit is Available at Gentaur Genprice with the fastest delivery.Online Order Payment is possible or send. (joplink.net)
  • CusabioRat Cathepsin L1 (CTSL1) ELISA kit is Available at Gentaur Genprice with the fastest delivery.Online Order Payment is possible or send. (joplink.net)
  • Human Cathepsin D ELISA Kit PicoKine™ (96 Tests). (bosterbio.com)
Xenopus1
  • Cathepsin L in zebrafish, cathepsins S and K in xenopus, and cathepsin L in mice and rats underwent evident tandem-repeat events. (ijbs.com)
Expression9
  • This study examined the expression of the potent elastases cathepsins S and K in human atheroma. (harvard.edu)
  • Over-expression of Cathepsin D is also linked to tumorigenesis in prostate cancer and to aggressive forms of colorectal cancer and lung adenocarcinoma. (scrippslabs.com)
  • Cathepsin S (Cat S) expression was analyzed in human colon carcinoma and normal colon tissues. (biomedcentral.com)
  • IBC patient biopsies were examined for expression of cathepsin B and caveolin-1. (biomedcentral.com)
  • A statistically significant co-expression of cathepsin B and caveolin-1 was found in IBC patient biopsies, thus validating our in vitro data. (biomedcentral.com)
  • Our study is the first to show that the proteolytic activity of cathepsin B and its co-expression with caveolin-1 contributes to the aggressiveness of IBC. (biomedcentral.com)
  • High Expression of Cathepsin E is associated with Tissues but Not Blood of Patients with Barrett's Esophagus and Adenocarcinoma. (cusabio.com)
  • In this work , we reveal the relationship between the expression of cathepsins and radioresistance in GBM. (bvsalud.org)
  • 18. Hie M, Shimono M, Fujii K, Tsukamoto I. Increased cathepsin K and tartrate-resistant acid phosphatase expression in bone of streptozotocin-induced diabetic rats. (bvsalud.org)
Recombinant1
  • Also, treatment of recombinant proMMP-9 with recombinant cathepsin K (CTSK) at pH 5 yielded a fragment that corresponded to the molecular weight of active MMP-9, and showed MMP-9 activity. (biomedcentral.com)
Substrate1
  • Cell lysates or other samples that contain cathepsins will cleave the synthetic substrate to release free AFC. (biovision.com)
Macrophages1
  • Decreased activity of cathepsin E produced by decidual macrophages might be responsible for the induction of miscarriages in some recurrent miscarriage patients. (cusabio.com)
Sequence2
  • A DNA sequence encoding the Homo sapiens (Human) Cathepsin F, was expressed in the hosts and tags indicated. (enquirebio.com)
  • See the reference protein sequence for cathepsin E precursor (NP_001120469.1). (beds.ac.uk)
Pathogenesis1
  • Cathepsin E, mitochondrial fission, and caspase activation/apoptosis are linked in the pathogenesis of pulmonary emphysema. (cusabio.com)
Activity3
  • Fifty plants initially were screened for activity against the cathepsin G enzyme to find the best botanical extract to inhibit its activity (data not shown). (cosmeticsandtoiletries.com)
  • Cultured human SMC displayed no immunoreactive cathepsins K and S and exhibited little or no elastolytic activity when incubated with insoluble elastin. (harvard.edu)
  • A comparative structure model of splice variant 2 was computed based on its alignment to the known structure of cathepsin E intermediate (Protein Data Bank code 1TZS) and used to rationalize its conformational properties and loss of activity. (cusabio.com)
Homo1
  • All 11 cysteine cathepsins are detected in Homo sapiens (human) through a bioinformatic study on the human genome [ 9 ]. (ijbs.com)
Degradation2
  • Cathepsin G has recently emerged as an important mediator of proteolytic ECM degradation in photoaging. (cosmeticsandtoiletries.com)
  • Downregulation of caveolin-1, the structural protein of caveolae, reduces the cell surface association of cathepsin B and decreases degradation of type IV collagen and invasion by the colon cancer cells, consistent with a functional role for caveolae-associated cathepsin B in invasion [ 12 ]. (biomedcentral.com)
Active3
  • SMC stimulated with the atheroma-associated cytokines IL-1beta or IFN-gamma secreted active cathepsin S and degraded substantial insoluble elastin (15-20 microg/10(6) cells/24 h). (harvard.edu)
  • Here we explored a role for active cathepsin B on the cell surface in the invasiveness of IBC. (biomedcentral.com)
  • We observed that uPA, uPAR and enzymatically active cathepsin B were colocalized in caveolae fractions isolated from SUM149 cells. (biomedcentral.com)
Degrade elastin1
  • In addition, cathepsin G has been shown in vitro to degrade elastin into fragments that can be further processed by elastase. (cosmeticsandtoiletries.com)
Contrast1
  • Cysteine peptidases of Eudiplozoon nipponicum: a broad repertoire of structurally assorted cathepsins L in contrast to the scarcity of cathepsins B in an invasive species of haematophagous monogenean of common carp. (uni-bielefeld.de)
Inflammatory breast1
  • Cathepsin B: a potential prognostic marker for inflammatory breast cancer. (bvsalud.org)
Significantly1
  • Measurements of cell-associated enzyme activities showed that lactate dehydrogenase, acid phosphatase, and cathepsin D were significantly increased. (aai.org)
Immune system1
  • Emerging roles of cathepsin E in immune system cells and skin keratinocytes, and in host defense against cancer cells. (cusabio.com)
MedlinePlus: Genes: C
MedlinePlus: Genes: C (medlineplus.gov)
What Breast Medical Oncologists Need From Pathologists: Overview, Tumor Size, Histologic Grade
What Breast Medical Oncologists Need From Pathologists: Overview, Tumor Size, Histologic Grade (medscape.com)
CLN10 disease: MedlinePlus Genetics
CLN10 disease: MedlinePlus Genetics (medlineplus.gov)
Ciglitazone - Ontology Report - Rat Genome Database
Ciglitazone - Ontology Report - Rat Genome Database (rgd.mcw.edu)
1q6k.1 | SWISS-MODEL Template Library
1q6k.1 | SWISS-MODEL Template Library (swissmodel.expasy.org)
Skeletal Dysplasia Clinical Presentation: History, Physical, Causes
Skeletal Dysplasia Clinical Presentation: History, Physical, Causes (emedicine.medscape.com)
Results for 'Proteolytic enzymes' | Abcam: antibodies, proteins, kits...
Results for 'Proteolytic enzymes' | Abcam: antibodies, proteins, kits... (abcam.com)
Heterogeneity in old fibroblasts is linked to variability in reprogramming and wound healing | Nature
Heterogeneity in old fibroblasts is linked to variability in reprogramming and wound healing | Nature (nature.com)
Proteomes | Free Full-Text | Differential Proteome Analysis of Extracellular Vesicles from Breast Cancer Cell Lines by...
Proteomes | Free Full-Text | Differential Proteome Analysis of Extracellular Vesicles from Breast Cancer Cell Lines by... (mdpi.com)
Frontiers | Causal Inference of Genetic Variants and Genes in Amyotrophic Lateral Sclerosis
Frontiers | Causal Inference of Genetic Variants and Genes in Amyotrophic Lateral Sclerosis (frontiersin.org)
Polyglutamine-expanded androgen receptor interferes with TFEB to elicit autophagy defects in SBMA | Nature Neuroscience
Polyglutamine-expanded androgen receptor interferes with TFEB to elicit autophagy defects in SBMA | Nature Neuroscience (nature.com)
Killing activity of neutrophils is mediated through activation of proteases by K+ flux | Nature
Killing activity of neutrophils is mediated through activation of proteases by K+ flux | Nature (nature.com)
Neuroscience Elisa | Gentaur Elisa Kits | US - UK & Europe Supply
Neuroscience Elisa | Gentaur Elisa Kits | US - UK & Europe Supply (caslab.com)
Osteoarthritis Treatment & Management: Approach Considerations, Pharmacologic Treatment, Lifestyle Modification, Physical...
Osteoarthritis Treatment & Management: Approach Considerations, Pharmacologic Treatment, Lifestyle Modification, Physical... (medscape.com)
Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative...
Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative... (actaneurocomms.biomedcentral.com)
Neutrophils and Emerging Targets for Treatment in COPD
Neutrophils and Emerging Targets for Treatment in COPD (medscape.com)
Hypersensitivity Pneumonitis Workup: Laboratory Studies, Imaging Studies, Other Tests
Hypersensitivity Pneumonitis Workup: Laboratory Studies, Imaging Studies, Other Tests (medscape.com)
Radiotherapy toxicity | Nature Reviews Disease Primers
Radiotherapy toxicity | Nature Reviews Disease Primers (nature.com)
Recombinant Human coronavirus OC43 Spike glycoprotein(S) ,partial | CSB-EP336163HIY | Cusabio
Recombinant Human coronavirus OC43 Spike glycoprotein(S) ,partial | CSB-EP336163HIY | Cusabio (proteomecommons.org)
MeSH Coming Attractions. NLM Technical Bulletin. Sep-Oct 1998
MeSH Coming Attractions. NLM Technical Bulletin. Sep-Oct 1998 (nlm.nih.gov)
Protein Conformation and Dynamics | NHLBI, NIH
Protein Conformation and Dynamics | NHLBI, NIH (nhlbi.nih.gov)
HE4 as a Biomarker for Ovarian and Endometrial Cancer Management
HE4 as a Biomarker for Ovarian and Endometrial Cancer Management (medscape.com)