A papain-like cysteine protease that has specificity for amino terminal dipeptides. The enzyme plays a role in the activation of several pro-inflammatory serine proteases by removal of their aminoterminal inhibitory dipeptides. Genetic mutations that cause loss of cathepsin C activity in humans are associated with PAPILLON-LEFEVRE DISEASE.
A group of lysosomal proteinases or endopeptidases found in aqueous extracts of a variety of animal tissues. They function optimally within an acidic pH range. The cathepsins occur as a variety of enzyme subtypes including SERINE PROTEASES; ASPARTIC PROTEINASES; and CYSTEINE PROTEASES.
Rare, autosomal recessive disorder occurring between the first and fifth years of life. It is characterized by palmoplantar keratoderma with periodontitis followed by the premature shedding of both deciduous and permanent teeth. Mutations in the gene for CATHEPSIN C have been associated with this disease.
A lysosomal cysteine proteinase with a specificity similar to that of PAPAIN. The enzyme is present in a variety of tissues and is important in many physiological and pathological processes. In pathology, cathepsin B has been found to be involved in DEMYELINATION; EMPHYSEMA; RHEUMATOID ARTHRITIS, and NEOPLASM INVASIVENESS.
A ubiquitously-expressed cysteine protease that plays an enzymatic role in POST-TRANSLATIONAL PROTEIN PROCESSING of proteins within SECRETORY GRANULES.
An intracellular proteinase found in a variety of tissue. It has specificity similar to but narrower than that of pepsin A. The enzyme is involved in catabolism of cartilage and connective tissue. EC 3.4.23.5. (Formerly EC 3.4.4.23).
A subclass of exopeptidases that includes enzymes which cleave either two or three AMINO ACIDS from the end of a peptide chain.
A cysteine protease that is highly expressed in OSTEOCLASTS and plays an essential role in BONE RESORPTION as a potent EXTRACELLULAR MATRIX-degrading enzyme.
A serine protease found in the azurophil granules of NEUTROPHILS. It has an enzyme specificity similar to that of chymotrypsin C.
An ubiquitously-expressed lysosomal cysteine protease that is involved in protein processing. The enzyme has both endopeptidase and aminopeptidase activities.
An aspartic endopeptidase that is similar in structure to CATHEPSIN D. It is found primarily in the cells of the immune system where it may play a role in processing of CELL SURFACE ANTIGENS.
A homologous group of endogenous CYSTEINE PROTEINASE INHIBITORS. The cystatins inhibit most CYSTEINE ENDOPEPTIDASES such as PAPAIN, and other peptidases which have a sulfhydryl group at the active site.
A lysosomal papain-related cysteine proteinase that is expressed in a broad variety of cell types.
ENDOPEPTIDASES which have a cysteine involved in the catalytic process. This group of enzymes is inactivated by CYSTEINE PROTEINASE INHIBITORS such as CYSTATINS and SULFHYDRYL REAGENTS.
A form of congenital ichthyosis inherited as an autosomal dominant trait and characterized by ERYTHRODERMA and severe hyperkeratosis. It is manifested at birth by blisters followed by the appearance of thickened, horny, verruciform scales over the entire body, but accentuated in flexural areas. Mutations in the genes that encode KERATIN-1 and KERATIN-10 have been associated with this disorder.
A class of morphologically heterogeneous cytoplasmic particles in animal and plant tissues characterized by their content of hydrolytic enzymes and the structure-linked latency of these enzymes. The intracellular functions of lysosomes depend on their lytic potential. The single unit membrane of the lysosome acts as a barrier between the enzymes enclosed in the lysosome and the external substrate. The activity of the enzymes contained in lysosomes is limited or nil unless the vesicle in which they are enclosed is ruptured. Such rupture is supposed to be under metabolic (hormonal) control. (From Rieger et al., Glossary of Genetics: Classical and Molecular, 5th ed)
A ubiquitously-expressed cysteine peptidase that exhibits carboxypeptidase activity. It is highly expressed in a variety of immune cell types and may play a role in inflammatory processes and immune responses.
Compounds which inhibit or antagonize biosynthesis or actions of proteases (ENDOPEPTIDASES).
Peptides composed of two amino acid units.
Any member of the group of ENDOPEPTIDASES containing at the active site a serine residue involved in catalysis.
A subclass of PEPTIDE HYDROLASES that catalyze the internal cleavage of PEPTIDES or PROTEINS.
Physiologically inactive substances that can be converted to active enzymes.
A cysteine endopeptidase found in NATURAL KILLER CELLS and CYTOTOXIC T-LYMPHOCYTES. It may have a specific function in the mechanism or regulation of cytolytic activity of immune cells.
An enzyme that catalyzes the hydrolysis of proteins, including elastin. It cleaves preferentially bonds at the carboxyl side of Ala and Val, with greater specificity for Ala. EC 3.4.21.37.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
Immunized T-lymphocytes which can directly destroy appropriate target cells. These cytotoxic lymphocytes may be generated in vitro in mixed lymphocyte cultures (MLC), in vivo during a graft-versus-host (GVH) reaction, or after immunization with an allograft, tumor cell or virally transformed or chemically modified target cell. The lytic phenomenon is sometimes referred to as cell-mediated lympholysis (CML). These CD8-positive cells are distinct from NATURAL KILLER CELLS and NATURAL KILLER T-CELLS. There are two effector phenotypes: TC1 and TC2.
An activating NK cell lectin-like receptor subfamily that regulates immune responses to INFECTION and NEOPLASMS. Members of this subfamily generally occur as homodimers.
Antibodies produced by a single clone of cells.
Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).
The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.
Condensed areas of cellular material that may be bounded by a membrane.
Substances used to destroy or inhibit the action of rats, mice, or other rodents.
The reduction or regulation of the population of noxious, destructive, or dangerous rodents through chemical, biological, or other means.
Diseases of rodents of the order RODENTIA. This term includes diseases of Sciuridae (squirrels), Geomyidae (gophers), Heteromyidae (pouched mice), Castoridae (beavers), Cricetidae (rats and mice), Muridae (Old World rats and mice), Erethizontidae (porcupines), and Caviidae (guinea pigs).
The use of community resources, individual case work, or group work to promote the adaptive capacities of individuals in relation to their social and economic environments. It includes social service agencies.
The science and technology dealing with the procurement, breeding, care, health, and selection of animals used in biomedical research and testing.
Commercially prepared reagent sets, with accessory devices, containing all of the major components and literature necessary to perform one or more designated diagnostic tests or procedures. They may be for laboratory or personal use.
The protection of animals in laboratories or other specific environments by promoting their health through better nutrition, housing, and care.
A cytochrome oxidase inhibitor which is a nitridizing agent and an inhibitor of terminal oxidation. (From Merck Index, 12th ed)
Acute and chronic (see also BRAIN INJURIES, CHRONIC) injuries to the brain, including the cerebral hemispheres, CEREBELLUM, and BRAIN STEM. Clinical manifestations depend on the nature of injury. Diffuse trauma to the brain is frequently associated with DIFFUSE AXONAL INJURY or COMA, POST-TRAUMATIC. Localized injuries may be associated with NEUROBEHAVIORAL MANIFESTATIONS; HEMIPARESIS, or other focal neurologic deficits.
Individual's rights to obtain and use information collected or generated by others.
A publication issued at stated, more or less regular, intervals.
A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.
The evaluation by experts of the quality and pertinence of research or research proposals of other experts in the same field. Peer review is used by editors in deciding which submissions warrant publication, by granting agencies to determine which proposals should be funded, and by academic institutions in tenure decisions.
"The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.
A species of nematode that is widely used in biological, biochemical, and genetic studies.
Proteins from the nematode species CAENORHABDITIS ELEGANS. The proteins from this species are the subject of scientific interest in the area of multicellular organism MORPHOGENESIS.
The co-inheritance of two or more non-allelic GENES due to their being located more or less closely on the same CHROMOSOME.

Increased collagenase and dipeptidyl peptidase I activity in leucocytes from healthy elderly people. (1/128)

The incidence of infectious diseases increases with ageing. The enzymatic activity of leucocytes may have a relevant role in the morbidity and mortality due to infections in the elderly. In this study we have compared the activity of enzymes involved in the inflammatory response in leucocytes from young and elderly women. A total of 35 healthy females was studied, 20 volunteers aged 78-98 years (mean 89.1 years) and 15 young controls aged 19-34 years (mean 26 years). All of them were in good clinical condition, without any acute or chronic disease. Intracellular enzyme activity was analysed by flow cytometry in leucocytes from young and elderly women. The enzyme substrates employed were for oxidative burst, L-aminopeptidase, collagenase, cathepsin B, C, D and, G and dipeptidyl peptidase I. The intracellular enzyme activity assessed by flow cytometry in leucocytes from young and elderly women was similar, as far as oxidative burst, L-aminopeptidase, cathepsin B, C, D and G are concerned. An increased collagenase activity was detected in granulocytes from elders. The mean fluorescence channels for this enzyme corresponded to 86 +/- 23 and 60 +/- 15 in cells from elders and controls, respectively (P = 0.01224). An increased dipeptidyl peptidase I activity was detected in lymphocytes from elderly women. The corresponding values for this enzyme in elders and the young were 65.9 +/- 43.3 and 17.3 +/- 5, respectively (P = 0. 0036). The proper functional activity of intracellular enzymes involved in inflammatory responses is likely to be determinant for successful ageing.  (+info)

Dipeptidyl peptidase I is required for the processing and activation of granzymes A and B in vivo. (2/128)

Dipeptidyl peptidase I (DPPI) is a lysosomal cysteine protease that has been implicated in the processing of granzymes, which are neutral serine proteases exclusively expressed in the granules of activated cytotoxic lymphocytes. In this report, we show that cytotoxic lymphocytes derived from DPPI-/- mice contain normal amounts of granzymes A and B, but these molecules retain their prodipeptide domains and are inactive. Cytotoxic assays with DPPI-/- effector cells reveal severe defects in the induction of target cell apoptosis (as measured by [(125)I]UdR release) at both early and late time points; this defect is comparable to that detected in perforin-/- or granzyme A-/- x B-/- cytotoxic lymphocytes. DPPI therefore plays an essential role in the in vivo processing and activation of granzymes A and B, which are required for cytotoxic lymphocyte granule-mediated apoptosis.  (+info)

Location of the binding site for chloride ion activation of cathepsin C. (3/128)

Cathepsin C, a tetrameric lysosomal dipeptidyl-peptide hydrolase, is activated by chloride ion. The activation is shown here to be specific and pH-dependent, dissociation constants for chloride being lower at low pH. Bound chloride decreases the Km for the hydrolysis of chromophore labelled substrates without any significant change in Vmax, confirming its involvement in substrate binding. Determination of the kinetic parameters of chloride activation, using unlabelled substrates, has enabled its site of action to be located. The lower Km for the hydrolysis of simple amide substrates in the presence of Cl- shows that the S sites are involved. Possible involvement of the S' sites is excluded by the finding that the Km for the nucleophile in the transferase reaction is unaffected by chloride. The rates of inhibition by E-64 and iodoacetate are both chloride-dependent and, from the structure of the papain-E-64 complex, it is concluded that chloride binds close to the S2 site. The binding of guanidinium ion, a positively charged inhibitor, to the S site is dependent on chloride. Based on these results, a model is proposed to explain the chloride activation of cathepsin C. The possible physiological role of chloride in the regulation of proteolysis in the lysosome is discussed.  (+info)

Mutations of the cathepsin C gene are responsible for Papillon-Lefevre syndrome. (4/128)

Papillon-Lefevre syndrome (PLS) is an autosomal recessive disorder characterised by palmoplantar hyperkeratosis and severe early onset periodontitis that results in the premature loss of the primary and secondary dentitions. A major gene locus for PLS has been mapped to a 2.8 cM interval on chromosome 11q14. Correlation of physical and genetic maps of this interval indicate it includes at least 40 ESTs and six known genes including the lysosomal protease cathepsin C gene (CTSC). The CTSC message is expressed at high levels in a variety of immune cells including polymorphonuclear leucocytes, macrophages, and their precursors. By RT-PCR, we found CTSC is also expressed in epithelial regions commonly affected by PLS, including the palms, soles, knees, and oral keratinised gingiva. The 4.7 kb CTSC gene consists of two exons. Sequence analysis of CTSC from subjects affected with PLS from five consanguineous Turkish families identified four different mutations. An exon 1 nonsense mutation (856C-->T) introduces a premature stop codon at amino acid 286. Three exon 2 mutations were identified, including a single nucleotide deletion (2692delA) of codon 349 introducing a frameshift and premature termination codon, a 2 bp deletion (2673-2674delCT) that results in introduction of a stop codon at amino acid 343, and a G-->A substitution in codon 429 (2931G-->A) introducing a premature termination codon. All PLS patients were homozygous for cathepsin C mutations inherited from a common ancestor. Parents and sibs heterozygous for cathepsin C mutations do not show either the palmoplantar hyperkeratosis or severe early onset periodontitis characteristic of PLS. A more complete understanding of the functional physiology of cathepsin C carries significant implications for understanding normal and abnormal skin development and periodontal disease susceptibility.  (+info)

Haim-Munk syndrome and Papillon-Lefevre syndrome are allelic mutations in cathepsin C. (5/128)

Of the many palmoplantar keratoderma (PPK) conditions, only Papillon-Lefevre syndrome (PLS) and Haim-Munk syndrome (HMS) are associated with premature periodontal destruction. Although both PLS and HMS share the cardinal features of PPK and severe periodontitis, a number of additional findings are reported in HMS including arachnodactyly, acro-osteolysis, atrophic changes of the nails, and a radiographic deformity of the fingers. While PLS cases have been identified throughout the world, HMS has only been described among descendants of a religious isolate originally from Cochin, India. Parental consanguinity is a characteristic of many cases of both conditions. Although autosomal recessive transmission of PLS is evident, a more "complex" autosomal recessive pattern of inheritance with phenotypic influences from a closely linked modifying locus has been hypothesised for HMS. Recently, mutations of the cathepsin C gene have been identified as the underlying genetic defect in PLS. To determine if a cathepsin C mutation is also responsible for HMS, we sequenced the gene in affected and unaffected subjects from the Cochin isolate in which both the PLS and HMS phenotypes appear. Here we report identification of a mutation of cathepsin C (exon 6, 2127A--> G) that changes a highly conserved amino acid in the cathepsin C peptide. This mutation segregates with HMS in four nuclear families. Additionally, the existence of a shared common haplotype for genetic loci flanking the cathepsin C gene suggests that affected subjects descended from the Cochin isolate are homozygous for a mutation inherited "identical by descent" from a common ancestor. This finding supports simple autosomal recessive inheritance for HMS in these families. We also report a mutation of the same exon 6 CTSC codon (2126C-->T) in a Turkish family with classical PLS. These findings provide evidence that PLS and HMS are allelic variants of cathepsin C gene mutations.  (+info)

Localisation of a gene for prepubertal periodontitis to chromosome 11q14 and identification of a cathepsin C gene mutation. (6/128)

Prepubertal periodontitis (PPP) is a rare and rapidly progressive disease of young children that results in destruction of the periodontal support of the primary dentition. The condition may occur as part of a recognised syndrome or may occur as an isolated finding. Both autosomal dominant and recessive forms of Mendelian transmission have been reported for PPP. We report a consanguineous Jordanian family with four members affected by PPP in two nuclear sibships. The parents of the affected subjects are first cousins. We have localised a gene of major effect for PPP in this kindred (Zmax=3.55 for D11S901 at theta=0.00) to a 14 cM genetic interval on chromosome 11q14 flanked by D11S916 and D11S1367. This PPP candidate interval overlaps the region of chromosome 11q14 that contains the cathepsin C gene responsible for Papillon-Lefevre and Haim-Munk syndromes. Sequence analysis of the cathepsin C gene from PPP affected subjects from this Jordanian family indicated that all were homozygous for a missense mutation (1040A-->G) that changes a tyrosine to a cysteine. All four parents were heterozygous carriers of this Tyr347Cys cathepsin C mutation. None of the family members who were heterozygous carriers for this mutation showed any clinical findings of PPP. None of the 50 controls tested were found to have this Tyr347Cys mutation. This is the first reported gene mutation for non-syndromic periodontitis and shows that non-syndromic PPP is an allelic variant of the type IV palmoplantar ectodermal dysplasias.  (+info)

Arginine-based structures are specific inhibitors of cathepsin C. Application of peptide combinatorial libraries. (7/128)

Novel synthetic peptide inhibitors of lysosomal cysteine proteinase cathepsin C have been designed through the use of soluble peptide combinatorial libraries. The uncovered structural inhibitory module consists of the N-terminal cluster of L-arginine residues. Its modification with D-amino acids or arginine derivatives did not increase the inhibition strength. Inhibitory potency of oligoarginines improves with the elongation of peptide chain reaching a maximum for octa-L-arginine. The oligoarginines specifically interact with the cathepsin C active site as shown by competitive-type inhibition kinetics (Ki approximately 10-5 M) and intrinsic fluorescence measurements. The inhibitory interaction of oligoarginines is established through the specific spatial contact of a net of guanidino groups in the arginine side-chains, as indicated by comparison with inhibitory action of low molecular mass guanidine derivatives (Ki approximately 10-3 M). Nonarginine polyionic compounds cannot mimic the inhibitory effect of oligoarginines. The arginine-based peptide inhibitors were selective towards cathepsin C among other cysteine proteinases tested.  (+info)

Programming for cytotoxic effector function occurs concomitantly with CD4 extinction during CD8(+) T cell differentiation in the thymus. (8/128)

CD4(+) T cells are generally specialized to function as helper cells and CD8(+) T cells are generally specialized to function as cytotoxic effector cells. To explain how such concordance is achieved between co-receptor expression and immune function, we considered two possibilities. In one case, immature CD4(+)CD8(+) thymocyte precursors might first down-regulate expression of one co-receptor molecule, with the remaining co-receptor molecule subsequently activating the appropriate helper or cytotoxic functional program. Alternatively, we considered that the same intrathymic signals that selectively extinguished expression of one or the other co-receptor molecule might simultaneously initiate the appropriate helper or cytotoxic functional program. In the present study, we attempted to distinguish between these alternatives by examining thymocyte precursors of CD8(+) T cells for expression of Cathepsin C and Cathepsin W, molecules important for cytotoxic effector function. We report in developing thymocytes that Cathepsin C and Cathepsin W are expressed coordinately with extinction of CD4 co-receptor expression. We conclude that CD4 extinction and initiation of the cytotoxic functional program occurs simultaneously during differentiation of CD8(+) T cells in the thymus.  (+info)

Cathepsin C (CTSC) also known as dipeptidyl peptidase I (DPP-I) is a lysosomal exo-cysteine protease belonging to the peptidase C1 family. In humans, it is encoded by the CTSC gene. Cathepsin C appears to be a central coordinator for activation of many serine proteases in immune/inflammatory cells. Cathepsin C catalyses excision of dipeptides from the N-terminus of protein and peptide substrates, except if (i) the amino group of the N-terminus is blocked, (ii) the site of cleavage is on either side of a proline residue, (iii) the N-terminal residue is lysine or arginine, or (iv) the structure of the peptide or protein prevents further digestion from the N-terminus. The cDNAs encoding rat, human, murine, bovine, dog and two Schistosome cathepsin Cs have been cloned and sequenced and show that the enzyme is highly conserved. The human and rat cathepsin C cDNAs encode precursors (prepro-cathepsin C) comprising signal peptides of 24 residues, pro-regions of 205 (rat cathepsin C) or 206 (human ...
Background: PLS is a rare autosomal recessive disorder characterized by early onset periodontopathia and palmar plantar keratosis. PLS is caused by mutations in the cathepsin C (CTSC) gene. Dipeptidyl-peptidase I encoded by the CTSC gene removes dipeptides from the aminoterminus of protein substrates and mainly plays an immune and inflammatory role. Several mutations have been reported in this gene in patients from several ethnic groups. We report here mutation analysis of the CTSC gene in three Indian families with PLS. Methods: Peripheral blood samples were obtained from individuals belonging to three Indian families with PLS for genomic DNA isolation. Exon-specific intronic primers were used to amplify DNA samples from individuals. PCR products were subsequently sequenced to detect mutations.PCR-SCCP and ASOH analyses were used to determine if mutations were present in normal control individuals. Results: All patients from three families had a classic PLS phenotype, which included ...
Neutrophils are among the first cells implicated in acute inflammation. Leaving the blood circulation, they quickly migrate through the interstitial space of tissues and liberate oxidants and other an
Buy anti-CTSC antibody, Rabbit anti-Bovine Cathepsin C Polyclonal Antibody-AAQ08887.1 (MBS573038) product datasheet at MyBioSource, Primary Antibodies. Application: Immunoprecipitation (IP)
Dadkhah E, Moghaddasian M, Arab H, Bustani Farkoush H, Kazemi Noughabi M, Abbaszadegan MR. Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever Syndrome. European Human Genetics Conference 2012.Nurnberg, Germany, 2012.. Abbaszadegan MR, Forghanifard MM. Impact of cancer testis antigens crosstalk with self renewal cell signaling pathways in esophageal squamous cell carcinoma. European Human Genetics Conference 2012.Nurnberg, Germany. June 23-26-2012. (Poster presentation).. ...
Dadkhah E, Moghaddasian M, Arab H, Bustani Farkoush H, Kazemi Noughabi M, Abbaszadegan MR. Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever Syndrome. European Human Genetics Conference 2012.Nurnberg, Germany, 2012.. Abbaszadegan MR, Forghanifard MM. Impact of cancer testis antigens crosstalk with self renewal cell signaling pathways in esophageal squamous cell carcinoma. European Human Genetics Conference 2012.Nurnberg, Germany. June 23-26-2012. (Poster presentation).. ...
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
The mechanism of toxicity for cytolytic lymphocytes of Leu-Leu-OMe and related dipeptide derivatives was examined. Selective inhibition of dipeptidyl peptidase I (DPPI), a lysosomal thiol protease highly enriched in cytotoxic lymphocytes, prevented all natural killer (NK) toxic effects of such agents. However, many DPPI substrates were found to possess no NK toxic properties. For some such agents, this lack of NK toxicity appeared to be related to the lack of uptake by lymphocytes. In this regard, Leu-Leu-OMe was found to be incorporated by lymphocytes and monocytes via a saturable facilitated transport mechanism with characteristics distinct from previously characterized mammalian dipeptide transport processes. This novel transport process was found to be specific for dipeptides composed of selective L-stereoisomer amino acids and enhanced by hydrophobic ester or amide additions to the COOH terminus of dipeptides. Maximal rates of Leu-Leu-OMe uptake by T8 and NK cell-enriched peripheral blood ...
The dipeptide glycyl-l-phenylalanine 2-naphthylamide (GPN) is widely used to perturb lysosomes because its cleavage by the lysosomal enzyme cathepsin C is proposed to rupture lysosomal membranes. We show that GPN evokes a sustained increase in lysosomal pH (pHly), and transient increases in cytosolic pH (pHcyt) and Ca2+ concentration ([Ca2+]c). None of these effects require cathepsin C, nor are they accompanied by rupture of lysosomes, but they are mimicked by structurally unrelated weak bases. GPN-evoked increases in [Ca2+]c require Ca2+ within the endoplasmic reticulum (ER), but they are not mediated by ER Ca2+ channels amplifying Ca2+ release from lysosomes. GPN increases [Ca2+]c by increasing pHcyt, which then directly stimulates Ca2+ release from the ER. We conclude that physiologically relevant increases in pHcyt stimulate Ca2+ release from the ER in a manner that is independent of IP3 and ryanodine receptors, and that GPN does not selectively target lysosomes. ...
Plasmid DPAP1-COMP-blac-flag-his from Dr. Gavin Wrights lab contains the insert cathepsin C, homolog,dipeptidyl aminopeptidase 1 (DPAP1). This plasmid is available through Addgene.
Heike Wulff. Seed grants like the CTSC award are very important because they allow us to generate preliminary data for larger NIH grants, which are typically not awarded without existing data showing that the project is feasible, said Heike Wulff, professor of pharmacology and one of this years awardees. Our CTSC grant will allow us to test whether a novel therapeutic principle, the activation of a particular neuronal potassium channel, can indeed reduce neuronal excitability and thus prevent epileptic seizures.. The CTSC awarded seven UC Davis investigators for investigations in three broad categories: highly innovative research, new approaches to neurodevelopmental disorders and mini-biorepositories from clinical research projects. The recipients are working closely with CTSC leadership for additional resources to support their collaborative research projects.. Highly innovative research. ...
Yveline Hamon, Monika Łęgowska, Patricia Fergelot, Sandrine Dallet-Choisy, Louise Newell, Lise Vanderlynden, Ali Kord Valeshabad, Karina Acrich, Hadi Kord, Tsamakis Charalampos, Fanny Morice-Picard, Ian Surplice, Jerome Zoidakis, Karen David, Antonia Vlahou, Shivanna Ragunatha, Nikoletta Nagy, Katalin Farkas, Márta Széll, Cyril Goizet, Beate Schacher, Maurizio Battino, Abdullah Al Farraj Aldosari, Xinwen Wang, Yang Liu, Sylvain Marchand-Adam, Adam Lesner, Elodie Kara, Sevil Korkmaz-Icöz, Celia Moss, Peter Eickholz, Alain Taieb, Salih Kavukcu, Dieter E. Jenne, Francis Gauthier, Brice Korkmaz, Analysis of urinary cathepsin C for diagnosing Papillon-Lefèvre syndrome, The FEBS Journal, 2016, Vol. 283, iss. 3, 498-509, IF: ...
We welcome the opportunity to assist you during this challenging time. Clinical Trial Nurse Navigators and Information Specialists will continue to operate on normal business hours. Finding a clinical trial can be overwhelming. Patients are often left to search on their own, leaving them with more questions than answers. Fortunately, The Leukemia & Lymphoma Society now
CP001994.PE2 Location/Qualifiers FT CDS complement(1457..2011) FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Mmah_0002 FT /product=peptidase S26B, signal peptidase FT /note=InterPro IPR001733; KEGG: hypothetical protein; FT K03100 signal peptidase I; SPTR: Q12VA0 Peptidase S26B, FT signal peptidase; TIGRFAM: peptidase S26B, signal FT peptidase; PFAM: Peptidase S24-like; TIGRFAM: signal FT peptidase I, archaeal type FT /db_xref=EnsemblGenomes-Gn:Mmah_0002 FT /db_xref=EnsemblGenomes-Tr:ADE35540 FT /db_xref=GOA:D5E8N1 FT /db_xref=InterPro:IPR001733 FT /db_xref=InterPro:IPR015927 FT /db_xref=InterPro:IPR036286 FT /db_xref=UniProtKB/TrEMBL:D5E8N1 FT /protein_id=ADE35540.1 FT /translation=MEIGEIIHTFKNSDNFWVGIARDALSVLAILAVIGILSQLFFGMW FT TPMVAVESGSMEPHMYRGDIIFIEDLDRTRIETLRDAPEDYISFEKKGDVILYRPYGQK FT GVTPVIHRAMYFVEEGEQMWEGGPDAPHEGYITKGDNKKTNSYYDQQGQISYLAPVKEE FT WIIGVARYKVPYIGHIRLLLS MEIGEIIHTF KNSDNFWVGI ARDALSVLAI LAVIGILSQL FFGMWTPMVA VESGSMEPHM 60 YRGDIIFIED LDRTRIETLR ...
Cumpara acum Agrafe pt. birou colorate, 28mm, 40 buc/cutie, RIO Zebra la cel mai mic pret. Confirmarea comenzii in maxim 15 minute.
Papillon-Lefevre syndrome. Coloured transmission electron micrograph (TEM) of a cell affected by Papillon-Lefevre syndrome, a rare inherited condition. Plaques of the protein keratin (blue) are seen within the cell. The disease causes hyperkeratosis (thickening of the skin) and severe periodontitis, an inflammation of the tissue that surrounds and supports the teeth. The inflammation results in bone and tooth loss. Magnification: x16,600 when printed at 10 centimetres wide. - Stock Image C020/8722
Papillon-Lefevre Disease: Rare, autosomal recessive disorder occurring between the first and fifth years of life. It is characterized by palmoplantar keratoderma with periodontitis followed by the premature shedding of both deciduous and permanent teeth. Mutations in the gene for CATHEPSIN C have been associated with this disease.
TY - JOUR. T1 - Mechanism of L-leucyl-L-leucine methyl ester-mediated killing of cytotoxic lymphocytes. T2 - Dependence on a lysosomal thiol protease, dipeptidyl peptidase I, that is enriched in these cells. AU - Thiele, Dwain L. AU - Lipsky, Peter E.. PY - 1990. Y1 - 1990. N2 - Exposure of murine or human lymphocytes to L-leucyl-L-leucine methyl ester (Leu-Leu-OMe) results in selective killing of cytotoxic lymphocytes, whereas helper T cells and B cells remain functionally intact. Cytolytic lymphocytes incubated in the presence of toxic concentrations of Leu-Leu-OMe were found to contain membranolytic metabolites of the structure (Leu-Leu)n-OMe, where n ≥ 3. The sensitivity of cytotoxic lymphocytes to Leu-Leu-OMe was found to be dependent upon production of these metabolites by a lysosomal thiol protease, dipeptidyl peptidase I, which is present at far higher levels in cytotoxic lymphocytes than in cells without cytolytic potential or not of bone marrow origin. Thus, this granule enzyme is ...
Conuco es un índice que trabaja únicamente revistas y publicaciones electrónicas creadas en Puerto Rico o por puertorriqueños fuera de Puerto Rico. Es un índice mixto que recoge tanto material académico como material popular e informativo. Así en Conuco podrá encontrar tanto un artículo erudito como una noticia sobre un incidente criminal.
The Papillon-Lefèvre syndrome or keratosis palmoplantaris associated to periodontopathy was first described by Papillon-Lefèvre, in 1924. It is an autosomal recessive genetic disease, with alteration in the gene CTSC, located in chromosome 11q14.1-q14.4, more precisely in the protein called cathepsin C (Hart et al., 2000; Shafer et al., 1987; Neville et al., 2001; Tommasi, 2002; Allende & Moreno, 2003; Hewitt et al., 2004; Selvaraju et al., 2003 ). It affects children and young adults of both sexes with no distinction. It is a very rare disease, with a prevalence of one in one million individuals. Its main oral clinical characteristics include periodontopathies, premature loss of deciduous teeth, at the age of 4-5 years and of the permanent teeth at approximately 14 years (Allegra & Gennari, 2000; Regezi & Sciubba, 2000; Tommasi, 2002; Siragusa et al., 2000). According to Shafer et al. (1987), only the permanent dentition is affected in some cases.. Patients also present halitosis, intense ...
People make mistakes and poor choices; Vision Zero says those mistakes dont have to cost lives. Working together, we can eliminate deaths and serious injuries on our streets. The CTSC focused on Vision Zero for their 2016-2018 work plan, committing to making Santa Cruz County safer for all road users. Click here to read our 2017 report, The Impact of Traffic Violence On Santa Cruz County, explore interactive maps showing our high-injury corridors and other crash data, and view our Vision Zero workplan.. Our Mission. The mission of the Community Traffic Safety Coalition is to reduce traffic-related injuries while promoting the use of alternative modes of transportation. The primary focus is on bicycle and pedestrian safety issues. The CTSC educates all road users in safety practices to decrease the risk and severity of collisions, and advocates for improved conditions to make all methods of transportation safer.. About the Community Traffic Safety Coalition. The CTSC is a creative and ...
Congratulations to our KL2 Scholars-Nicole Kucine, MD, and Danielle Novetsky Friedman, MD-on presenting their theses before the Masters Examining Committee in April. Nicole, a WCMC Assistant Professor of Pediatrics, presented on her CTSC KL2 research, Evaluation of Myeloproliferative Neoplasms in Pediatric Patients. Danielle, an MSK Instructor of Pediatrics, presented on her CTSC KL2 research, Chronic Conditions in Adult Survivors of Retinoblastoma. Wed also like to thank their mentors (Drs. Ross Levine, James Bussel, Kevin Oeffinger, Erika Abramson, and Chaya Moskowitz) and our Associate Program Directors (Drs. Yuan-Shan Zhu and Dean Bajorin) for attending and showing tremendous support for their mentees.. CTSC Research in Progress Luncheon ...
Upon stimulation, polymorphonuclear leucocytes (PMNs) release potent serine proteases, i.e. elastase, cathepsin C and proteinase 3, which contribute to the degradation of tissue and plasma components. Here, we describe the development of a plasma test to assess PMN-mediated fibrinogenolysis as a biochemical marker for actual PMN-derived proteolysis in vivo, useful for monitoring therapeutic efficacy, i.e. of elastase inhibitors. We generated a monoclonal antibody (MAb), designated 1-1/B3, with a high affinity for elastase-degraded fibrinogen (EDF). The epitope for 1-1/B3 becomes exposed in a time-dependent manner during digestion of fibrinogen with purified PMN-derived serine proteases and with isolated PMNs in vitro. However, 1-1/B3 does not react with plasma fibrinogen or with fibrin(ogen) degradation products generated by plasmin or by other active proteases that may occur locally, i.e. metalloproteases and lysosomal cathepsins. On the basis of MAb 1-1/B3, we developed a plasma test for the ...
Cumpara acum Mine pentru creion 2mm, HB, 12 buc/etui, STAEDTLER Mars carbon la cel mai mic pret. Confirmarea comenzii in maxim 15 minute.
From NCBI Gene:. This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. A portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. [provided by RefSeq, Nov 2015]. From UniProt: ...
Shop Probable dipeptidyl-peptidase ELISA Kit, Recombinant Protein and Probable dipeptidyl-peptidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Clinical trial has received WCMC IRB and CTSC approval with enrollment of initial 6 subjects at WCMC. An additional 38 subjects enrolled 29 treated at participating sub-sites. Reports submitted to WCMC DSMB in December 2014 with approval to proceed without modifications.
This page contains information about of L-Alanine- -Naphthylamide Hydrobromide | Purchase L-Alanine- -Naphthylamide Hydrobromide online.
Welcome! For price inquiries, please feel free to contact us through the form on the left side. We will get back to you as soon as possible.. ...
Glutamine supplementation has been advocated for patients requiring parenteral nutritional support. However, the direct effect of glutamine on neoplastic cells is poorly understood. We therefore investigated the effects of glutamine on the proliferation, differentiation, and cell-matrix interactions of two human colon carcinoma cell lines (Caco-2 and SW620) adapted to glutamine-free media. Doubling times were calculated by logarithmic transformation of serial cell counts. Alkaline phosphatase, cathepsin C (dipeptidyl peptidase), lactase, and isomaltase expression (markers of differentiation) were assayed by digestion of synthetic substrates. Adhesion to matrix proteins was assessed by colorimetric quantitation of toluidine blue staining of adherent cells. Surface expression of Caco-2 receptors for matrix proteins (integrins) was studied by biotinylation and immunoprecipitation with specific antibodies. Glutamine (1-10 mm) dose-dependently stimulated Caco-2 proliferation on all matrices studied ...
The UC Davis Clinical and Translational Science Center (CTSC) and the wide array of services that have supported innovative biomedical research and led to the development of new treatments for diseases during the past 10 years will continue, thanks to a $27.8 million grant from the National Center for Accelerating Translational Science and the ongoing support from the School of Medicine.
Apoptose er programmert celledød for å fjerne uønskede celler og er en felles egenskap for alle flercellede organismer. Caspase-3 er involvert i intracellulære signalkaskader ved apoptose. En ubalanse i regulering av apoptose kan føre til kreftutvikling. Apoptose spiller en viktig rolle i flere andre sykdommer som immunologisk, iskemiske, og nevrodegenerative sykdommer. For å undersøke betydningen av proteasen legumain og proteaseinhibitoren cystatin E/M for caspase-3 aktivitet, ble det brukt HEK293 (normale kontroll celler), M38L (overutrykker legumain) og M4C (overutrykker cystatin E/M) celler. Cellene ble stimulert med dødsstimulerende stoffer som staurosporin og Leu-Leu-OMe. Staurosporin er kjent for å være en kinasehemmer. Leu-Leu-OMe øker lysosomal membranpermeabilitet. Proteaser som er involvert i apoptose vil dermed frigjøres fra lysosomer til cytosol. Legumain som befinner seg i lysosomene, kan frigjøres til cytosol og dermed påvirke aktiviteten av caspase-3 eller andre ...
Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. In humans, it is coded by the CTSB gene. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene.
glycyl-aspartyl-aspartyl-aspartyl-aspartyl-lysine-2-naphthylamide: synthetic substrate linked via amide bond to fluorophore 2-naphthylamine
Methanol 3.5L - (pls whatsapp us to check availability),Price: RM36.00,End time 12/7/2019 9:15 AM MYT,Category: Chemical / B2B & Industrial Products
Complexes of gold( I) have long been used to treat rheumatoid arthritis although the precise biological targets of gold are not well understood. One intriguing therapeutic target of Au( I) is the cathepsin family of lysosomal cysteine proteases. Here, we present the inhibition of cathepsin B by a known Au( I)-based drug and a series of derivatives. The complexes investigated were reversible, competitive inhibitors with IC50 values ranging from 0.3 to 250 mu M, depending on the substituents around the Au( I). ...
Dipeptidyl-peptidase 3 is an enzyme that in humans is encoded by the DPP3 gene. This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternate transcriptional splice variants have been characterized. GRCh38: Ensembl release 89: ENSG00000254986 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000063904 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Fukasawa KM, Fukasawa K, Harada M (Jun 2000). Assignment of the dipeptidyl peptidase III gene (DPP3) to human chromosome 11 band q12→q13.1 by in situ hybridization. Cytogenet Cell Genet. 88 (1-2): 99-100. doi:10.1159/000015498. PMID 10773679. Entrez Gene: DPP3 dipeptidyl-peptidase ...
YSCH2B1 J01327 M25040 M25041 V01307 607bp ds-DNA PLN 23-AUG-1994 Yeast (S.cerevisiae) histone H2B-1 gene. histone; histone H2B. YSCH2B2 J01328 V01308 589bp ds-DNA PLN 23-AUG-1994 Yeast (S.cerevisiae) histone H2B-2 gene. histone; histone H2B. YSCLTG3 D16304 1779bp ds-DNA PLN 24-AUG-1994 Yeast LTG3 gene. . YSCSTEYCI L21944 3136bp ds-DNA PLN 23-AUG-1994 Saccharomyces cerevisiae dipeptidyl aminopeptidase (STE13 or YCI1) gene, complete cds. dipeptidyl aminopeptidase ...
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
This is a list of all employees at the Department of Biomedical Sciences. The list is sorted in alphabetical order in accordance to the employees first name.
CD26 antibody [M-A261] (dipeptidyl peptidase 4) for FACS, IHC-Fr, IP. Anti-CD26 mAb (GTX74879) is tested in Human samples. 100% Ab-Assurance.
Human CTSB full-length ORF (NP_001899.1, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. (H00001508-P02) - Products - Abnova
Rüppell W. P. E. S., 1835-1838. Neue Wirbelthiere zu der Fauna von Abyssinien gehörig. Fische des Rothen Meeres. Frankfurt-am-Main. 1-148, Pls. 1-33. (1835:1-28, Pls. 1-7; 1836:29-52, Pls. 8-14; 1837:53-80, Pls. 15-21; 1838:81-148, Pls. 22-33.) Fische Rothen Meeres 1835-38 ...
TY - JOUR. T1 - Increased muscle proteolysis after local trauma mainly reflects macrophage-associated lysosomal proteolysis. AU - Farges, M C AU - Balcerzak, Denis Pierre. AU - Fisher, B D AU - Attaix, D AU - Bechet, D AU - Ferrara, M AU - Baracos, V E PY - 2002/2. Y1 - 2002/2. N2 - Rat gastrocnemius showed increased protein degradation (+75-115%) at 48 h after traumatic injury. Injured muscle showed increased cathepsin B activity (+327%) and mRNA encoding cathepsin B (+670%), cathepsin L (+298%), cathepsin H (+159%), and cathepsin C (+268%). In in situ hybridization, cathepsin B mRNA localized to the mononuclear cell infiltrate in injured muscle, and only background levels of hybridization were observed either over muscle cells in injured tissue or in uninjured muscle. Immunogold/electron microscopy showed specific staining for cathepsin B only in lysosome-like structures in cells of the mononuclear cell infiltrate in injured muscle. Muscle cells were uniformly negative in the ...
The Center for Sudden Unexpected Death in Epilepsy (SUDEP) Research seeks novel pilot projects in human SUDEP Research that will address the goal of understanding its pathophysiology.. In collaboration with the Center for SUDEP Research (CSR), the Clinical and Translational Science Collaborative (CTSC) will grant funding for this the one-year CSR-themed pilot grant award.. One $25,000 grant will be awarded. In addition, $10,000 is available for the use of one CTSC Core per pilot grant award when used in support of the primary grant.. The primary investigator is required to be a full-time CWRU faculty member with a primary appointment at Case Western Reserve University, University Hospitals Case Medical Center or the Louis Stokes VA Medical Center.. The application must be received by Friday, April 28, at 11:59 p.m. to be considered for review. Any applications received after this deadline will not be reviewed.. Learn more about the requirements and application process at ...
The presence of DPPII (dipeptidyl peptidase II; E.C. 3.4.14.2) has been demonstrated in various mammalian tissues. However, a profound molecular and catalytic characterization, including substrate selectivity, kinetics and pH-dependence, has not been conducted. In the present study, DPPII was purified from human seminal plasma to apparent homogeneity with a high yield (40%) purification scheme, including an inhibitor-based affinity chromatographic step. The inhibitor lysyl-piperidide (Ki~0.9 μM at pH 5.5) was chosen, as it provided a favourable affinity/recovery ratio. The human enzyme appeared as a 120 kDa homodimer. Mass spectrometric analysis after tryptic digestion together with a kinetic comparison indicate strongly its identity with QPP (quiescent cell proline dipeptidase), also called dipeptidyl peptidase 7. pH profiles of both kcat and kcat/Km clearly demonstrated that DPPII/QPP possesses an acidic and not a neutral optimum as was reported for QPP. Kinetic parameters of the human ...
Purpose: The olfm1 gene encodes a secreted glycoprotein highly conserved in vertebrates. There are two olfm1 genes in zebrafish, olfm1a and olfm1b. Both of these genes are expressed in the brain and retina starting from 16 h post fertilization to adults. We generated a null mutant of both olfm1a and olfm1b genes and analyzed its retinal structure and visual function.. Methods: Olfm1a and olfm1b mutant alleles with nonsense point mutations were obtained from the Wellcome Trust Sanger Institute. Olfm1a and olfm1b null mutants were bred to generate double null mutant (olfm1a/b null). Spontaneous movement, optokinetic and optomotor responses, behavioral responses to light increments and decrements and electroretinogram (ERG) to increased (ON) and decreased (OFF) illumination were compared between olfm1a/b null and wild-type larvae 7 days post fertilization (dpf). The retinal morphology was examined by immunostaining of frozen sections. Total RNA was isolated from 3 and 7 dpf larvae for RNA ...
Korpos et al. (1) claim that limited information exists on the nature of the ECM [extracellular matrix] of the pancreas and, in particular, on the composition of peri-islet capsule, and that they provide the the first comprehensive analysis of the [ECM] composition of peri-islet capsules.. We dispute the strength of these claims. In mice we originally reported in 2008 that a basement membrane (BM) exists around islets, and eight unique components were identified (type IV collagens α1, α2, laminin α2, β1, γ1, nidogen 1, nidogen 2, perlecan) as well as two composite components (laminin Engelbreth-Holm-Swarm, collagen IV) (2). It was also shown that type IV collagens α3, α4, α5, α6 were not present (2). Korpos et al. (1) were able to find a further three unique components (laminin α4, β2, agrin) and one composite component (laminin 322).. In 2008 in humans (3,4), at least four unique components (laminin α1, α5, β1, γ1) were identified and in their Supplementary Figure 1 staining ...
CTSB - CTSB (GFP-tagged) - Human cathepsin B (CTSB), transcript variant 5 available for purchase from OriGene - Your Gene Company.
PARIS, FRANCE, and HENNIGSDORF/BERLIN, GERMANY / ACCESSWIRE / August 31, 2019 / Diagnostics company SphingoTec GmbH (sphingotec, Hennigsdorf near Berlin,
Japans largest platform for academic e-journals: J-STAGE is a full text database for reviewed academic papers published by Japanese societies
ok i have a free swebits account up for grabs, it only has a few mb up and down. post here ratio proof i will keep this open for a bit then pick some1. PLS PLS PLS NO PMS OR YOU ARE OUT :D :D
... , Histones & Cathepsin; PMAP The Proteolysis Map-animation [ Recent chromatin publications and news] Protocol for in ...
... collagenases such as cathepsin B1; and hyaluronidase. PSGAG inhibits the synthesis of prostaglandin E2, which is released upon ...
Cathepsin A Breddam, K. (1986). "Serine carboxypeptidases. A review". Carlsberg Res. Commun. 51: 83-128. doi:10.1007/bf02907561 ... Miller, J.J.; Changaris, D.G.; Levy, R.S. (1992). "Purification, subunit structure and inhibitor profile of cathepsin-A". J. ... Carboxypeptidase C (EC 3.4.16.5, carboxypeptidase Y, serine carboxypeptidase I, cathepsin A, lysosomal protective protein, ...
Cathepsin E. TALE homeodomain transcription factors. Hydrocortisone. Since keratinocyte differentiation inhibits keratinocyte ... "The role of cathepsin E in terminal differentiation of keratinocytes". Biological Chemistry. 392 (6): 571-85. doi:10.1515/BC. ...
Cathepsin D is involved in CLN10. DNA analysis can be used to help confirm the diagnosis of Batten disease. When the mutation ...
Lushbaugh, W.B.; Hofbauer, A.F.; Pittman, F.E. (1985). "Entamoeba histolytica: purification of cathepsin B". Exp. Parasitol. 59 ...
Mediation by cathepsin G has been suggested. The treatment of RAS usually involves administering dexamethasone IV, with the ...
... these include cathepsin L, papain, and procaricain. It forms an alpha-helical domain that runs through the substrate-binding ...
McDonald, J.K.; Zeitman, B.B.; Reilly, T.J.; Ellis, S. (1969). "New observations on the substrate specificity of cathepsin C ( ... Planta, R.J.; Gorter, J.; Gruber, M. (1964). "The catalytic properties of cathepsin C". Biochim. Biophys. Acta. 89: 511-519. ... Metrione, R.M.; Neves, A.G.; Fruton, J.S. (1966). "Purification and properties of dipeptidyl transferase (cathepsin C)". ... Dipeptidyl peptidase I (EC 3.4.14.1, cathepsin C, dipeptidyl aminopeptidase I, dipeptidyl transferase, dipeptide arylamidase I ...
The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein ... 1994). "Cathepsin B activity in human lung tumor cell lines: ultrastructural localization, pH sensitivity, and inhibitor status ... 1988). "Cathepsin D inactivates cysteine proteinase inhibitors, cystatins". Biochem. Biophys. Res. Commun. 154 (2): 765-72. doi ... Cystatin B has been shown to interact with Cathepsin B. GRCh38: Ensembl release 89: ENSG00000160213 - Ensembl, May 2017 GRCm38 ...
These cysteine proteases include calpain, caspase, and cathepsin. These three proteins are examples of detectable signs of ...
It is an inhibitor of cathepsin K, an enzyme involved in bone resorption. It is being developed by Merck & Co. The phase III ... Le Gall, C. L.; Bonnelye, E.; Clézardin, P. (2008). "Cathepsin K inhibitors as treatment of bone metastasis". Current Opinion ... February 2008). "The discovery of odanacatib (MK-0822), a selective inhibitor of cathepsin K". Bioorg. Med. Chem. Lett. 18 (3 ...
A plant aspartic proteinase resembling mammalian cathepsin D". Eur. J. Biochem. 202 (3): 1021-1027. doi:10.1111/j.1432- ...
2000). "Secreted cathepsin L generates endostatin from collagen XVIII". EMBO J. 19 (6): 1187-94. doi:10.1093/emboj/19.6.1187. ... 2000). "Secreted cathepsin L generates endostatin from collagen XVIII". EMBO J. 19 (6): 1187-94. doi:10.1093/emboj/19.6.1187. ... by proteases such as cathepsins. Collagen is a component of epithelial and endothelial basement membranes. Endostatin, as a ...
Cathepsin A is also required for normal elastin biosynthesis. GRCh38: Ensembl release 89: ENSG00000170266 - Ensembl, May 2017 ... The elastin receptor complex includes S-Gal, neuraminidase and Cathepsin A. When elastin-derived peptides bind to the S-Gal ... cathepsin) A is required for proper elastic fiber formation and inactivation of endothelin-1". Circulation. 117 (15): 1973-81. ...
add NAE ref]. She pursued these interests by studying androsterone and monopalmitin at Armour, and cathepsin C at Yale. Jones ... Under the direction of Joseph S. Fruton, Jones' dissertation research involved the catalytic properties of cathepsin C, a type ... Her doctorate was entitled: Transamidation reactions catalyzed by cathepsin C. Jones completed her studies in three years ... Transamidation Reactions Catalyzed by Cathepsin C. Yale University, 1952. Kresge, Nicole; Simoni, Robert D.; Hill, Robert L. ( ...
1982). "Action of rat liver cathepsin L on glucagon". Acta Biol. Med. Ger. 40 (9): 1139-43. PMID 7340337. Kaushal GP, Walker PD ...
... cathepsin G and proteinase 3" Bioorg. Med. Chem. 1995, 3, 187-193. ([5]) Schapira, C. B.; Perillo, I. A.; Lamdan, S. "3-Oxo-1,2 ... cathepsin G and proteinase 3. Phthalimide derivatives were seen to be inactive, while saccharin derivatives were seen to be ...
2000). "Secreted cathepsin L generates endostatin from collagen XVIII". EMBO J. 19 (6): 1187-94. doi:10.1093/emboj/19.6.1187. ...
Deficiency of Cathepsin K, a cysteine protease in osteoclasts, is known to cause this condition. Cathepsin K became a much ... Motyckova, G; Fisher, DE (2002). "Pycnodysostosis: role and regulation of cathepsin K deficiency in osteoclast function and ... is a lysosomal storage disease of the bone caused by a mutation in the gene that codes the enzyme cathepsin K. Pycnodysostosis ... a lysosomal storage disease caused by cathepsin K deficiency". Science. 273 (5279): 1236-1238. doi:10.1126/science.273.5279. ...
1990). "Generation of human endothelin by cathepsin E". FEBS Lett. 273 (1-2): 99-102. doi:10.1016/0014-5793(90)81060-2. PMID ...
Several other cathepsins are expressed in osteoclasts including cathepsins B, C, D, E, G, and L. The function of these cysteine ... Of these hydrolytic enzymes, cathepsin K is of most importance. Cathepsin K is a collagenolytic, papain-like, cysteine protease ... characterised by a lack of functional cathepsin K expression. Knockout studies of cathepsin K in mice lead to an osteopetrotic ... Cathepsin K has an optimal enzymatic activity in acidic conditions. It is synthesized as a proenzyme with a molecular weight of ...
Cathepsin B and L play a crucial role in arthritic cartilage degeneration. The inhibitor of cathepsin isolated from this fungus ... The fungal metabolite, aurantiamide acetate, has been isolated from Aspergillus penicillioides, as a cathepsin inhibitor. ... a Selective Cathepsin Inhibitor, Produced by Aspergillus penicillioides". Bioscience, Biotechnology, and Biochemistry. 65 (5): ...
... cathepsin G". Blood. 93 (6): 2089-97. PMID 10068683. Tan J, Prakash MD, Kaiserman D, Bird PI (July 2013). "Absence of SERPINB6A ... antitrypsin to inhibit cathepsin proteases". Biochemistry. 41 (15): 4998-5004. doi:10.1021/bi0159985. PMID 11939796. Schick C, ... "Squamous cell carcinoma antigen 2 is a novel serpin that inhibits the chymotrypsin-like proteinases cathepsin G and mast cell ... "DNA accelerates the inhibition of human cathepsin V by serpins". The Journal of Biological Chemistry. 282 (51): 36980-6. doi: ...
2000). "Cathepsin G activates protease-activated receptor-4 in human platelets". J. Biol. Chem. 275 (10): 6819-23. doi:10.1074/ ...
In humans, the group of cathepsin cysteine proteases or cysteine cathepsins comprises 11 family members, cathepsins B, C, F, H ... Examination of cathepsin activity by using chemical probes and in vivo imaging techniques demonstrated an increase in cathepsin ... Cathepsins also can be secreted by cells, associate with the cell surface, and degrade the ECM. A study of all 11 members of ... Cathepsin L is active at neutral pH by associating with a p41 splice variant of the MHC class II-associated invariant chain ...
Yamashima T (2013). "Reconsider Alzheimer's disease by the 'calpain-cathepsin hypothesis'--a perspective review". PROGRESS IN ... which clearly distinguished it from the cathepsin family of proteases. The calcium-dependent activity, intracellular ...
... also prevents tumor progression, partially by inhibiting cathepsin B activity. In particular, ulinastatin is ... It inactivates many serine proteases, including trypsin, chymotrypsin, kallikrein, plasmin, granulocyte elastase, cathepsin, ...
BACE1, BACE2 Cathepsin D Cathepsin E Chymosin (or "rennin") Napsin-A Nepenthesin Pepsin Presenilin Renin BACE1; BACE2; CTSD; ... Eukaryotic aspartic proteases include pepsins, cathepsins, and renins. They have a two-domain structure, arising from ancestral ...
"Entrez Gene: GZMH granzyme H (cathepsin G-like 2, protein h-CCPX)". Waterhouse NJ, Trapani JA (2007). "H is for helper: ...
Human recombinant pro-dipeptidyl peptidase I (cathepsin C) can be activated by cathepsins L and S but not by autocatalytic ... The results suggest that cathepsin L could be an important activator of DPPI in vivo and that cathepsin D and possibly the ... The enzymes, except cathepsin C, are endopeptidases (reviewed in Kirschke et al., 1995), although cathepsin B was found also to ... Mutations of the cathepsin C gene are responsible for Papillon-Lefèvre syndrome. Hart, T.C., Hart, P.S., Bowden, D.W., Michalec ...
Rabbit anti-Bovine Cathepsin C Polyclonal Antibody-AAQ08887.1 (MBS573038) product datasheet at MyBioSource, Primary Antibodies ... Cathepsin C; Cathepsin J; Dipeptidyl peptidase I; DPP-I; DPPI; Dipeptidyl transferaseCleaved into the following 3 chains: ... 1. Cathepsin C gene 5-untranslated region mutation in papillon-lefevre syndrome in 4 unrelated families in Slovenia ... Activates serine proteases such as elastase, cathepsin G and granzymes A and B. Can also activate neuraminidase and factor XIII ...
PLS is caused by mutations in the cathepsin C (CTSC) gene. Dipeptidyl-peptidase I encoded by the CTSC gene removes dipeptides ... Mutation analysis of the cathepsin C gene in Indian families with Papillon-Lefèvre syndrome ... Mutation analysis of the cathepsin C gene in Indian families with Papillon-Lefèvre syndrome. In: BMC Medical Genetics, 4 (5). ...
Gavin Wrights lab contains the insert cathepsin C, homolog,dipeptidyl aminopeptidase 1 (DPAP1). This plasmid is available ... cathepsin C, homolog,dipeptidyl aminopeptidase 1 (DPAP1) * Alt name. PF3D7_1116700 * Species ...
Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever ...
Analysis of urinary cathepsin C for diagnosing Papillon-Lefèvre syndrome, The FEBS Journal, 2016, Vol. 283, iss. 3, 498-509, IF ... Neutrophilic cathepsin C is maturated by a multi-step proteolytic process and secreted by activated cells during inflammatory ... Development of the first internally-quenched fluorescent substrates of human cathepsin C: the application in the enzyme ... Lactoferrin is an allosteric enhancer of the proteolytic activity of cathepsin G, PLoS One, [dokument elektroniczny], 2016, Vol ...
Cathepsin: Cathepsins ( Ancient Greek kata- "down" and hepsein "boil"; abbreviated CTS ) are proteases ( enzymes that degrades ... Cathepsins have a vital role in mammalian cellular turnover, e.g. bone resorption. They degrade polypeptides and are ... There are, however, exceptions such as cathepsin K, which works extracellularly after secretion by osteoclasts in bone ...
Cathepsin A (serine protease) Cathepsin B (cysteine protease) Cathepsin C (cysteine protease) Cathepsin D (aspartyl protease) ... Cathepsin H (cysteine protease) Cathepsin K (cysteine protease) Cathepsin L1 (cysteine protease) Cathepsin L2 (or V) (cysteine ... Cathepsin S (cysteine protease) Cathepsin W (cysteine proteinase) Cathepsin Z (or X) (cysteine protease) Cathepsins have been ... Cathepsin K has also been shown to play a role in arthritis. Mouse cathepsin L is homologous to human cathepsin V. Mouse ...
Cathepsin Cathepsin T at the US National Library of Medicine Medical Subject Headings (MeSH) Molecular and Cellular Biology ... Cathepsin T (EC 3.4.22.24) is an enzyme. This enzyme catalyses the following chemical reaction Interconversion of the three ... Pitot, H.C.; Gohda, E. (1987). "Cathepsin T". Methods Enzymol. 142: 279-289. doi:10.1016/s0076-6879(87)42038-7. PMID 2885716. ...
"Human cathepsins W and F form a new subgroup of cathepsins that is evolutionary separated from the cathepsin B- and L-like ... Wex T, Levy B, Wex H, Brömme D (1999). "Human cathepsins F and W: A new subgroup of cathepsins". Biochem. Biophys. Res. Commun ... 2003). "Characterization of novel anti-cathepsin W antibodies and cellular distribution of cathepsin W in the gastrointestinal ... Cathepsin W is a protein that in humans is encoded by the CTSW gene.[5][6][7] ...
"Entrez Gene: CTSD cathepsin D".. *^ Barrett AJ (April 1970). "Cathepsin D. Purification of isoenzymes from human and chicken ... Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes.[7] The main function of cathepsin D is ... The optimum pH for cathepsin D in vitro is 4.5-5.0.[13] Cathepsin-D is an aspartic protease that depends critically on ... Cathepsin D is a protein that in humans is encoded by the CTSD gene.[5][6] This gene encodes a lysosomal aspartyl protease ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
If you know of any papers that use this antibody, please contact us at antibodies [at] alzforum [dot] org for consideration in the References section.. ...
cathepsin K. Names. cathepsin O. cathepsin O1. cathepsin O2. cathepsin X. NP_000387.1. *EC 3.4.22.38 ... Metabolic mapping showed that cathepsin B, but not cathepsin K is active in GSC niches. Title: Cysteine cathepsins B, X and K ... cathepsin K in the development of chronic subdural hematoma Title: Role of cathepsin K in the development of chronic subdural ... Cathepsin K degradation of sclerostin is affected by hypoxia. Title: The regulation of sclerostin by cathepsin K in periodontal ...
Cathepsin B. A. 266. Homo sapiens. Mutation(s): 3 Gene Names: CTSB, CPSB. EC: 3.4.22.1. ... Cathepsin B is a papain-like cysteine protease showing both endo- and exopeptidase activity, the latter due to a unique ... Cathepsin B is a papain-like cysteine protease showing both endo- and exopeptidase activity, the latter due to a unique ... The chagasin-cathepsin B complex provides a structural framework for modeling and design of inhibitors for cruzipain, the ...
Incubation with the cathepsin L specific inhibitor, Z-FY-DMK, blocked cathepsin L signals, confirming the cathepsin L bands in ... Z-FY-DMK cathepsin L inhibitor does not inhibit all cathepsin activity of murine endometriotic lesions. Incubation with Z-FY- ... DMK, a selective inhibitor of cathepsin L, inhibited many of the cathepsin active bands but did not block all active cathepsin ... E-64 blocks all cathepsin proteolytic activity in murine endometriotic lesions. Incubation with the broad cathepsin inhibitor, ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
V. Zavanik-Bergant, A. Sekirnik, R. Golouh, V. Turk, and J. Kos, "Immunochemical localisation of cathepsin S, cathepsin L and ... Both stimulants caused a significant cathepsin S upregulation. A significantly elevated cathepsin S expression in gingival ... Role of Cathepsin S in Periodontal Inflammation and Infection. S. Memmert,1,2 A. Damanaki,1 A. V. B. Nogueira,3 S. Eick,4 M. ... "Antimicrobial peptide LL-37 is both a substrate of cathepsins S and K and a selective inhibitor of cathepsin L," Biochemistry, ...
Cathepsin K degrades both collagen and elastin, and is one of the most powerful proteases. Cathepsin S degrades elastin, and ... "We saw that the cathepsin K was going away much faster when there was cathepsin S present than when it was by itself," said ... "We kept increasing the amount of cathepsin S until the collagen was not affected at all because all of the cathepsin K was ... Barrys modeling suggested that effects observed could occur if cathepsin S were degrading cathepsin K instead of attacking the ...
The cathepsin S protease is implicated in generation of chronic pain by releasing a cytokine. ... The cathepsin S protease is implicated in generation of chronic pain by releasing a cytokine. ...
Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry. Graham Simmons, Dhaval N. Gosalia, ... Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry. Graham Simmons, Dhaval N. Gosalia, ... Cathepsin-L-specific inhibitor blocks infection. (A) MDL28170 inhibits CTSL activity with an IC50 of 2.5 nM. A 1,000-compound ... Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry Message Subject (Your Name) has sent you ...
A direct immunohistochemical method of high specificity is presented for the demonstration of sites of cathepsin B1. Antisera ... Snellman, O.: Cathepsin B, the lysosomal thiol proteinase of calf liver. Biochem. J. 114, 673-678 (1969)Google Scholar ... Otto, K.: Cathepsins B1 and B2. In: Tissue proteinases, ed. by A. J. Barrett and J. T. Dingle, p. 1-28. North-Holland ... V. Cathepsin B as a potential effector of LNA hydrolysis. Histochemie 12, 240-243 (1968)Google Scholar ...
Cathepsin S is a cysteine protease highly expressed in many type of cancers including colorectal, prostate, breast, and ... This mini-review provides an overview of therapeutic antibody targeting Cathepsin S strategies in the last half decade, ... In recent years, antibody research specifically targeting Cathepsin S to block/inhibit tumorigenic effects were generated some ... focusing on the rationale of cell-surface Cathepsin S targeted and their potential clinical application. ...
Rabbit polyclonal Cathepsin E antibody. Validated in WB, IHC, ICC/IF and tested in Mouse, Rat, Human. Cited in 3 publication(s ... Anti-Cathepsin E antibody (ab36996) at 1/1000 dilution + Murine reticulocyte lysate at 10 µg. Predicted band size: 42 kDa. ... High Expression of Cathepsin E in Tissues but Not Blood of Patients with Barretts Esophagus and Adenocarcinoma.. Ann Surg ... Cathepsin E is expressed abundantly in the stomach, Clara cells and alveolar macrophages of the lung, brain microglia, spleen, ...
Rabbit polyclonal Cathepsin D antibody validated for WB, ELISA, IHC, ICC/IF and tested in Human. Referenced in 1 publication ... This antibody reacts with human liver cathepsin D, and does not react with cathepsins B, H and L. ... IHC image of Cathepsin D staining in Human Lung formalin fixed paraffin embedded tissue section, performed on a Leica Bond™ ... Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cathepsin D antibody (ab19555) ...
... administration of rat recombinant cathepsin B and rat recombinant cathepsin L at the same or higher doses than rrCatS had no ... Inhibition of spinal microglial cathepsin S for the reversal of neuropathic pain. Anna K. Clark, Ping K. Yip, John Grist, Clive ... cathepsin S;. rrCatS,. rat recombinant CatS;. LHVS,. morpholinurea-leucine-homophenylalanine-vinyl phenyl sulfone;. PNL,. ... Here, we report that in peripheral nerve-injured rats, the lysosomal cysteine protease cathepsin S (CatS) is critical for the ...
Protease activity Apolipoprotein A-I Aortic valve stenosis Cathepsin S C. Gebhard and F. Maafi contributed equally to this work ... Hooshdaran B, Kolpakov MA, Guo X, Miller SA, Wang T, Tilley DG, Rafiq K, Sabri A (2017) Dual inhibition of cathepsin G and ... Lindstedt L, Lee M, Oorni K, Bromme D, Kovanen PT (2003) Cathepsins F and S block HDL3-induced cholesterol efflux from ... Targeting circulating cathepsin S may lead to new therapies for human aortic valve disease. ...
Cathepsin B. Cathepsin B, EC 3.4.22.1 (APP secretase, APPS) (Cathepsin B1) [Cleaved into: Cathepsin B light chain; Cathepsin B ... Cathepsin BImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href="/ ... tr,E9PL32,E9PL32_HUMAN Cathepsin B (Fragment) OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=2 ...
Cathepsin GAdd BLAST. ›26. Proteomic databases. PaxDb, a database of protein abundance averages across all three domains of ... sp,P17977,CATG_RAT Cathepsin G (Fragment) OS=Rattus norvegicus GN=Ctsg PE=1 SV=1 IIGGREARPNSHPYMAFLLIQSPEGL ...
MAGIC RED® CATHEPSIN B KIT. A fluorogenic test kit for Cathepsin B. (Patent# 6,235,493-May 22, 2001). Ref.: 1. Van Noorden, C.J ... MAGIC RED® CATHEPSIN K KIT. A fluorogenic test kit for Cathepsin K. (Patent# 6,235,493-May 22, 2001). Ref.: 1. Van Noorden, C.J ... MAGIC RED® CATHEPSIN L KIT. A fluorogenic test kit for Cathepsin L. (Patent# 6,235,493-May 22, 2001). Ref.: 1. Van Noorden, C.J ...
Cathepsin K Polyclonal Antibody from Invitrogen for Western Blot, Immunohistochemistry (Paraffin) and Flow Cytometry ... Protein Aliases: Cathepsin K; Cathepsin O; cathepsin O1; Cathepsin O2; Cathepsin X; CTSK; CTSO; CTSO2 ... Cite Cathepsin K Polyclonal Antibody. The following antibody was used in this experiment: Cathepsin K Polyclonal Antibody from ...
Although a lysosomal, cathepsin B-dependent (Ctsb-dependent) pathway of apoptosis has been described, the contribution of this ...
C.-S. Hsieh, P. DeRoos, K. Honey, C. Beers, and A. Y. Rudensky, "A role for cathepsin L and cathepsin S in peptide generation ... J. Ärnlv, "Cathepsin S as a biomarker: where are we now and what are the future challenges?" Biomarkers in Medicine, vol. 6, no ... Inhibition of Cathepsin S Produces Neuroprotective Effects after Traumatic Brain Injury in Mice. Jianguo Xu,1 Handong Wang,1 Ke ... D. M. Small, R. E. Burden, and C. J. Scott, "The emerging relevance of the cysteine protease cathepsin S in disease," Clinical ...
Cathepsin D purified from a mutant strain has a lower activity per unit mass of pure enzyme. These data suggest that cad-1 is a ... Identification of a putative structural gene for cathepsin D in Caenorhabditis elegans.. L A Jacobson, L Jen-Jacobson, J M ... Identification of a putative structural gene for cathepsin D in Caenorhabditis elegans.. L A Jacobson, L Jen-Jacobson, J M ... Identification of a putative structural gene for cathepsin D in Caenorhabditis elegans.. L A Jacobson, L Jen-Jacobson, J M ...
CATHEPSIN L-HUMAN LIVER. Cathepsin L is unstable at neutral pH, but is relatively stable in the range 4.5 to 5.5.. ...
Distribution of cathepsin L in human umbilical cord tissues.. [Tomasz Gogiel, Małgorzata Wolańska, Zofia Galewska, Piotr ... The active cathepsin L activity (without activation by pepsin digestion), its percentage in the total activity (after pepsin ... Cathepsin L activity and anti-papain inhibitory effect of cysteine protease inhibitors were quantified in extracts of separated ... Cathepsin L is a potent cysteine protease engaged in degradation of extracellular matrix proteins, including collagens. We ...
  • Activates serine proteases such as elastase, cathepsin G and granzymes A and B. Can also activate neuraminidase and factor XIII. (mybiosource.com)
  • To clarify the mode by which natural protein inhibitors manage to overcome this obstacle, we have analyzed the structure and function of cathepsin B in complexes with the Trypanosoma cruzi inhibitor, chagasin. (rcsb.org)
  • Incubation with the broad cathepsin inhibitor, E-64, completely abolished cathepsin activity detected by zymography identifying the active bands as cysteine cathepsins (A). Cathepsin protein levels in lesions were compared to eutopic uterine tissue by Western blot (B, n = 6). (nih.gov)
  • The requirement for cathepsin L proteolysis identifies a previously uncharacterized class of inhibitor for SARS-CoV infection. (pnas.org)
  • Using mass spectrometry analysis of cells treated with a pan cathepsin inhibitor, we observed an increased abundance of proteins involved in central carbon metabolism. (mcponline.org)
  • View detailed cathepsin H Inhibitor specifications, including cathepsin H Inhibitor CAS number, molecular weight, molecular formula and chemical structure, by clicking on the product name. (scbt.com)
  • Serine protease inhibitor serpinB1 protects neutrophils by inhibition of their own azurophil granule protease cathepsin G. (bloodjournal.org)
  • The anionic cathepsin B inhibitor ( l -3- trans -propylcarbamoyloxirane-2-carbony)- l -isoleucyl- l -proline (CA-074), at a concentration of 1 μ m , caused a nearly quantitative inhibition of extracellular cathepsin B but had no effect on Matrigel invasion. (aacrjournals.org)
  • The membrane-permeant cathepsin B inhibitor, CA-074 methyl ester, and the higher concentration of CA-074 that inhibited intracellular cathepsin B both significantly reduced Matrigel invasion. (aacrjournals.org)
  • Our data demonstrate that cathepsin-L released from ex vivo rat hearts after ischaemia, and the cathepsin-L inhibitor CAA0225 improves cardiac function during ischaemia-reperfusion ex vivo . (bmj.com)
  • A cell-permeable inhibitor of calpain I, calpain II, cathepsin B, and cathepsin L. (promocell.com)
  • A cell-permeable inhibitor of calpain 1, calpain 2 which also inhibits cathepsin B, and cathepsin L. (promocell.com)
  • There were many hurdles in the drug discovery of cathepsin K inhibitors such as species differences not only in bone metabolism but also in amino acid sequences in the critical site of the target enzyme, discrepancies between PK/PD due to unique tissue distribution of the inhibitor affecting both efficacy and side effects originated from a characteristic intracellular or tissue distribution of some classes of compounds. (eurekaselect.com)
  • The cathepsin K inhibitor drug discovery was initiated based on a strong and osteoclast-specific expression of this enzyme. (eurekaselect.com)
  • This antibody is specific for Cathepsin E. (abcam.com)
  • This antibody reacts with human liver cathepsin D, and does not react with cathepsins B, H and L. (abcam.com)
  • The following antibody was used in this experiment: Cathepsin K Polyclonal Antibody from Thermo Fisher Scientific, catalog # PA5-14270, RRID AB_2087668. (thermofisher.com)
  • This antibody reacts with the zymogen as well as the activated form of cathepsin D. It stains fibroblasts and macrophages strongly but stains the myoepithelial cells of breast weakly. (novusbio.com)
  • Cathepsin D Polyclonal antibody specifically detects Cathepsin D in Human, Mouse, Rat samples. (fishersci.com)
  • Cathepsin 6 Monoclonal antibody specifically detects Cathepsin 6 in Mouse samples. (fishersci.com)
  • Cathepsin B seems to cause amyloid plaque, the root of Alzheimer's symptoms, when there are wild-type beta-secretase present in the system Overexpression of the encoded protein, which is a member of the peptidase C1 family, has been associated with esophageal adenocarcinoma and other tumors. (wikipedia.org)
  • Osteoclasts are the bone resorbing cells of the body, and they secrete cathepsin K in order to break down collagen, the major component of the non-mineral protein matrix of the bone. (wikipedia.org)
  • Cathepsin W is a protein that in humans is encoded by the CTSW gene . (wikipedia.org)
  • Cathepsin D is a protein that in humans is encoded by the CTSD gene . (wikipedia.org)
  • Cathepsin S was upregulated most strongly and thus further studied in vitro at gene and protein levels. (hindawi.com)
  • Barry's modeling suggested that effects observed could occur if cathepsin S were degrading cathepsin K instead of attacking the elastin - a protein essential in arteries and the cardiovascular system. (innovations-report.com)
  • H. Phipps-Yonas, V. Semik, and K. T. Hastings, "GILT expression in B cells diminishes cathepsin S steady-state protein expression and activity," European Journal of Immunology , vol. 43, no. 1, pp. 65-74, 2013. (hindawi.com)
  • Zusätzlich bieten wir Ihnen Cathepsin A Proteine (28) und Cathepsin A Kits (27) und viele weitere Produktgruppen zu diesem Protein an. (antikoerper-online.de)
  • Galactosialidosis is a rare lysosomal storage disease caused by a combined deficiency of GM1 beta-galactosidase (beta-gal) and neuraminidase secondary to a defect of a lysosomal enzyme protective protein/cathepsin A (PPCA) and mutation in CTSA gene. (antikoerper-online.de)
  • Additionally we are shipping Cathepsin D Antibodies (347) and Cathepsin D Proteins (55) and many more products for this protein. (antibodies-online.com)
  • Cathepsin H is a disulfide-linked heavy and light chain dimer which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. (scbt.com)
  • After 4 days of diabetes, cathepsin B and L activities were decreased by 15-45% when correlated with the levels of glomerular protein or DNA. (diabetesjournals.org)
  • Cathepsin D is an estrogen-regulated protein associated with tissue breakdown. (genetex.com)
  • Partially purified Cathepsin B protein was inhibited by a variety of peptide inhibitors but evidence of inhibition by several pathogen-derived inhibitors that are secreted during infection was inconclusive. (bl.uk)
  • Mechanistic studies indicated that the absence of CatL reduced lesion chemokine monocyte chemotactic protein-1 content, macrophage and T-cell in vitro transmigration, and angiogenesis, and altered the expression and activities of matrix metalloproteinases and other cysteinyl cathepsins in inflammatory cells, vascular cells, and AAA lesions. (harvard.edu)
  • Over-expression of cathepsin D stimulates tumorigenicity and metastasis as well as initiation of tumor apoptosis. (wikipedia.org)
  • [21] [22] Knock-out of CTSD gene would cause intestinal necrosis and hemorrhage and increase apoptosis in thymus , indicating that cathepsin D is required in certain epithelial cells for tissue remodeling and renewal. (wikipedia.org)
  • Although a lysosomal, cathepsin B-dependent (Ctsb-dependent) pathway of apoptosis has been described, the contribution of this pathway to tissue damage remains unclear. (jci.org)
  • Schwartz-Roberts, Shajahan, Cook, Wärri, Abu-Asab, Clarke: GX15-070 (obatoclax) induces apoptosis and inhibits cathepsin D- and L-mediated autophagosomal lysis in antiestrogen-resistant breast cancer cells. (antibodies-online.com)
  • This suggests that cathepsin D exerts its apoptosis-stimulating effect upstream of caspase-3-like activation. (diva-portal.org)
  • In vitro studies revealed that CatK contributed importantly to CD4 + T-cell proliferation, SMC apoptosis, and other cysteinyl cathepsin and matrix metalloproteinase expression and activities in SMCs and endothelial cells but played negligible roles in microvessel growth and monocyte migration. (ahajournals.org)
  • Five cyclic peptides show inhibitory activity towards human cathepsins L, B, H, and K. Zymography is a type of gel electrophoresis that uses a polyacrylamide gel co-polymerized with a substrate in order to detect enzyme activity. (wikipedia.org)
  • Cathepsin T (EC 3.4.22.24) is an enzyme. (wikipedia.org)
  • The researchers used a variety of tests to determine the amount of each enzyme, including fluorogenic substrate analysis, Western blotting and multiplex cathepsin zymography - a sensitive technique developed in the Platt laboratory. (innovations-report.com)
  • Beyond demonstrating for the first time that cathepsins can attack one another, the research also shows the complexity of the body's enzyme system - and may suggest why drugs designed to inhibit cathepsins haven't worked as intended. (innovations-report.com)
  • Cathepsin D purified from a mutant strain has a lower activity per unit mass of pure enzyme. (genetics.org)
  • The active cathepsin L activity (without activation by pepsin digestion), its percentage in the total activity (after pepsin activation), and the expression of the mature single-chain enzyme were the lowest in the umbilical cord arteries and the highest in Wharton's jelly. (sigmaaldrich.com)
  • As cathepsin D activity is increased by cigarette smoke, the enzyme may contribute to lung tissue damage in smokers. (genetex.com)
  • We offer various assays to detect and quantify cathepsin, calpain and granzyme B activity and screen for respective enzyme inhibitors. (promocell.com)
  • Cathepsin D was released from lysosomes to the cytosol upon exposure to naphthazarin, and the enzyme activity decreased simultaneously. (diva-portal.org)
  • Later, cathepsin D reappeared in granules of increased size, and enzyme activity was restored. (diva-portal.org)
  • Lysosomal serine carboxypeptidase Cathepsin A (CTSA) is a multifunctional enzyme with distinct protective and catalytic function. (frontiersin.org)
  • Herein, we describe the preparation of a fused silica capillary, cathepsin D (CatD)-immobilized enzyme reactor (IMER) using in a multidimensional High Performance Liquid Chromatography-based method (2D-HPLC) and zonal affinity chromatography as an alternative in the search for new ligands. (ovid.com)
  • The prodrug demonstrates enzyme-responsive drug release features, and over 95% GEM was released from the carrier with the Cathepsin B within 3 h. (rsc.org)
  • The presence of a cathepsin B-like enzyme in rabbit ear cartilage was established by the use of the synthetic substrates benzoyl- l -arginine amide and benzoyl- dl -arginine 2-naphthylamide. (biochemj.org)
  • The enzymic properties of cathepsin B in cartilage have been compared with an endogenous enzyme that liberates chondromucopeptide by degrading the cartilage matrix autocatalytically at pH5. (biochemj.org)
  • It was catalytically active, as demonstrated by active-site-directed radioiodination, and hydrolysed three cathepsin B substrates, two with Km values similar to those of lysosomal cathepsin B. In addition, the rates of inactivation of the sputum and lysosomal forms of the enzyme by L-3-carboxy-2,3-transepoxypropionyl-leucylamido(4-guanidino) butane (Compound E-64) were very similar. (portlandpress.com)
  • However, the sputum enzyme differed from lysosomal cathepsin B in the following respects. (portlandpress.com)
  • Inhibition by chicken cystatin was much weaker for sputum cathepsin B than for the lysosomal enzyme. (portlandpress.com)
  • The data suggest that the higher levels of cathepsin D activity observed in the freshly isolated RPE from the area centralis result from modulators of enzyme activity which are not present in culture. (arvojournals.org)
  • This review sought to evaluate recent findings in this field, highlighting how among cathepsins, the inhibition of cathepsin S in particular, could play a significant role in diminishing the effects of CVD, especially for patients with CKD. (frontiersin.org)
  • Spi2A defects were ameliorated by cathepsin-B/L inhibition, and by genetic co-deletion of lysosomal cathepsin B. Pharmacological inhibition of cathepsin B/L enhanced EPO-induced red cell formation in normal mice. (rupress.org)
  • Osteocytes express genes required in osteoclasts for bone resorption, including cathepsin K (Ctsk), and lactation elevates their expression. (jci.org)
  • A composite docking approach for the identification and characterization of ectosteric inhibitors of cathepsin K. Law S, et al . (nih.gov)
  • The availability of a purified preparation of salmon muscle cathepsins should stimulate interest and research in the characterization of these enzymes and lead to better means for the control of catheptic activity in fish muscle. (oregonstate.edu)
  • Cysteine cathepsins belong to the papain-like family C1 of clan CA cysteine peptidases. (nih.gov)
  • Moreover, cysteine cathepsins are active in pericellular environments as soluble enzymes or bound to cell surface receptors at the plasma membrane, and possibly even within secretory vesicles, the cytosol, mitochondria, and within the nuclei of eukaryotic cells. (nih.gov)
  • Proteolytic actions performed by cysteine cathepsins are essential in the maintenance of homeostasis and depend heavily upon their correct sorting and trafficking within cells. (nih.gov)
  • This review focuses upon the transport pathways directing cysteine cathepsins to their points of action and thus emphasizes the broader role and functionality of cysteine cathepsins in a number of specific cellular locales. (nih.gov)
  • Arampatzidou M, Rehders M, Dauth S, Yu DMT, Tedelind S, Brix K. Imaging of protease functions-current guide to spotting cysteine cathepsins in classical and novel scenes of action in mammalian epithelial cells and tissues. (springer.com)
  • It is widely held that invasion is facilitated by a membrane or secreted form of cathepsin B that acts outside the cell to degrade ECM components at or adjacent to the surface of the invading cell. (aacrjournals.org)
  • These cells were tested in an in vitro Matrigel invasion assay with membrane-permeant and impermeant inhibitors of cathepsin B. The results, which provided direct proof for the participation of cathepsin B in matrix penetration, also yielded the unexpected finding that an intracellular form of cathepsin B was required for Matrigel invasion. (aacrjournals.org)
  • Sputum cathepsin B had greater stability at pH 7.5 and a higher apparent Mr, even after deglycosylation, than lysosomal cathepsin B. We conclude that the form of cathepsin B found in sputum is probably a truncated form of human procathepsin B, with some differences in properties that could be of physiological importance. (portlandpress.com)
  • Elevated levels of cathepsin H correlates with malignant progression of prostate tumors. (scbt.com)
  • Levels of cathepsin D have been positively correlated with recurring breast cancers of both node negative and node positive types. (genetex.com)
  • There are, however, exceptions such as cathepsin K, which works extracellularly after secretion by osteoclasts in bone resorption. (genenames.org)
  • Impaired osteoclastic bone resorption leads to osteopetrosis in cathepsin-K-deficient mice. (semanticscholar.org)
  • Cathepsin K associates with lymph node metastasis and poor prognosis in oral squamous cell carcinoma. (nih.gov)
  • Elevated Cathepsin K potentiates metastasis of epithelial ovarian cancer. (nih.gov)
  • Cathepsins are involved in disease processes as varied as cancer metastasis, atherosclerosis, cardiovascular disease, osteoporosis and arthritis. (innovations-report.com)
  • Involvement of cathepsins in the invasion, metastasis and proliferation of cancer cells. (wikidoc.org)
  • Cathepsin B is among the candidate proteinases believed to participate in invasion and metastasis. (aacrjournals.org)
  • Besides caspases, cathepsins have recently been shown to be associated with cell death regulation [6-12] and various other physiological and pathological processes, such as maturation of the MHC class II complex, bone remodelling, keratinocyte differentiation, tumour progression and metastasis, rheumatoid arthritis and osteoarthritis, as well as atherosclerosis [13, 14] (table 1). (smw.ch)
  • Cathepsins are intracellular proteinases that hydrolyze the peptide bonds of proteins. (oregonstate.edu)
  • Surprisingly, at a concentration of 10 μ m , CA-074 slowly permeated the cells, causing an 80-95% inhibition of intracellular cathepsin B after 12 h, the duration of the invasion assay. (aacrjournals.org)
  • Here, we describe how intracellular sigma peptide modulation of RPTPσ induces enhanced protease Cathepsin B activity. (jneurosci.org)
  • Here, we report that in peripheral nerve-injured rats, the lysosomal cysteine protease cathepsin S (CatS) is critical for the maintenance of neuropathic pain and spinal microglia activation. (pnas.org)
  • We have recently found that after peripheral nerve injury, the mRNA for the lysosomal cysteine protease cathepsin S (CatS) was up-regulated in the DRG because of CatS expression in infiltrating macrophages ( 5 ). (pnas.org)
  • The lysosomal cysteine protease, cathepsin S, is increased in Alzheimer's disease and Down syndrome brain: an immunocytochemical study," American Journal of Pathology , vol. 146, no. 4, pp. 848-860, 1995. (hindawi.com)
  • Mutants of Caenorhabditis elegans having about 10% of wild-type activity of the aspartyl protease cathepsin D have been isolated by screening. (genetics.org)
  • Recent work shows that the cysteine protease cathepsin S (Cat S) is required for the terminal step in CLIP formation in B cells and most dendritic cells (DCs), and in vitro can mediate all steps of digestion of class II-Ii complexes ( 20 , 21 , 22 , 23 , 24 , 25 ). (jimmunol.org)
  • The protease cathepsin D is one such target involved in several diseases such as tumors, degenerative processes, and vital processes of parasites causing schistosomiasis. (ovid.com)
  • Here, we have found that one important mechanism by which peptide modulation of the receptor enhances axon outgrowth is through secretion of a protease, Cathepsin B, which enables digestion of CSPGs. (jneurosci.org)
  • Cathepsin L-deficient mice were shown to have less adipose tissue, lower serum glucose and insulin levels, more insulin receptor subunits, more glucose transporter (GLUT4) and more fibronectin than wild type controls. (wikipedia.org)
  • To test this, we used an immunocompetent endometriosis mouse model and found that endometriotic lesions exhibited a greater than 5-fold increase in active cathepsins compared to tissue from peritoneal wall or eutopic endometrium, with cathepsins L and K specifically implicated. (nih.gov)
  • Human endometriosis lesions also exhibited greater cathepsin activity than adjacent peritoneum tissue, supporting the mouse results. (nih.gov)
  • Platt's long-term research has focused on cathepsins, including the development of sensitive tools and assays to quantify their activity in cells and tissue, as well as potential diagnostic applications for breast, lung and cervical cancer. (innovations-report.com)
  • Keilová, H.: On the specificity and inhibition of cathepsins D and B. In: Tissue proteinases, ed. by A. J. Barrett and J. T. Dingle, p. 45-65. (springer.com)
  • IHC image of Cathepsin D staining in Human Lung formalin fixed paraffin embedded tissue section, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. (abcam.com)
  • Weight loss reduces adipose tissue cathepsin S and its circulating levels in morbidly obese women," Journal of Clinical Endocrinology and Metabolism , vol. 91, no. 3, pp. 1042-1047, 2006. (hindawi.com)
  • Arkona C, Wiederanders B. Expression, subcellular distribution and plasma membrane binding of cathepsin B and gelatinases in bone metastatic tissue. (springer.com)
  • Cathepsin F staining of paraffin-embedded human heart tissue sections. (neuromics.com)
  • The activity profiles of four cathepsins in the kidney and liver tissue were analysed and correlated with blood cytokines level in the presence and absence of antifungal compounds (amphotericin B, a standard drug and 2-(3,4-dimethyl-2,5-dihydro-1H-pyrrole-2-yl)-1-methylethyl pentanoate, isolated in our laboratory from natural source) treatment. (ijpsonline.com)
  • Aortic tissue extract cathepsin activities were significantly higher in AAA patients than in those with aortic occlusion diseases, but cystatin C levels were regulated inversely. (ahajournals.org)
  • Cathepsin zymography separates different cathepsins based on their migration through a polyacrylamide gel co-polymerized with a gelatin substrate. (wikipedia.org)
  • The gel is then put into an activation buffer of a specific pH and left to incubate overnight at 37 °C. This activation step allows the cathepsins to degrade the gelatin substrate. (wikipedia.org)
  • BioVision's newly developed Cathepsin Activity Assay kits are fluorescence-based assays that utilize the preferred substrate sequence for each cathepsin, labeled with AFC (amino-4-trifluoromethyl coumarin). (biovision.com)
  • Cell lysates or other samples that contain cathepsins will cleave the synthetic substrate to release free AFC. (biovision.com)
  • Cathepsin F has the substrate specificity similar to that of cathepsins L and S. (neuromics.com)
  • Genomic structure, chromosomal localization, and expression of human cathepsin W". Biochem Biophys Res Commun . (wikipedia.org)
  • Transient expression of human cathepsin B in a poorly metastatic B16F1 murine melanoma variant produced a 3-5-fold increase in cathepsin B activity and a comparable increase in invasiveness. (aacrjournals.org)
  • CTSZ, which has been also known as cathepsin X and cathepsin P, exhibits carboxy-monopeptidase and carboxy-dipeptidase activities. (prospecbio.com)
  • The purpose of the research reported herein was to develop procedures for the purification of the cathepsin from salmon muscle. (oregonstate.edu)
  • It was decided to attempt the purification of the cathepsin optimally active at pH 3.7. (oregonstate.edu)
  • The purification was accomplished by extracting the salmon muscle cathepsin with two parts 0.2 N KC1. (oregonstate.edu)
  • The purification of cathepsin D from pig uterus by two-step affinity chromatography on concanavalin A- and pepstatin-Sepharose was described previously [Afting & Becker (1981) Biochem. (biochemj.org)
  • Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes . (wikipedia.org)
  • The catalytic sites of cathepsin D include two critical aspartic residues ( amino acid 33 and 231) located on the 14 kDa and 34kDa chains. (wikipedia.org)
  • [13] Cathepsin-D is an aspartic protease that depends critically on protonation of its active site Asp residue. (wikipedia.org)
  • In particular, no defects in granulopoiesis or PMN homeostasis have been reported in mice deficient in cathepsin G ( CG −/− ), 15 neutrophil elastase ( NE −/− ), 16 , 17 or dipeptidylpeptidase I ( DPPI −/− ), which lack active NSPs. (bloodjournal.org)
  • Neutrophil cathepsin G increases calcium flux and inositol polyphosphate production in cultured endothelial cells. (jimmunol.org)
  • Exposure of endothelial cells (ENDO) to human neutrophil cathepsin G (CG) increases albumin flux across the endothelial monolayer. (jimmunol.org)
  • Identification of a human neutrophil angiotension II-generating protease as cathepsin G. J Clin Invest. (umassmed.edu)
  • The cathepsin A activity in lysates of metastatic lesions of malignant melanoma is significantly higher than in primary focus lysates. (wikipedia.org)
  • Gingival biopsies from periodontitis patients showed a significantly higher cathepsin S expression than those from healthy gingiva. (hindawi.com)
  • Analysis of freshly isolated RPE cells from 30 eyes indicated that cells from the area centralis have significantly higher cathepsin D activity than cells from the more peripheral retina. (arvojournals.org)
  • Cathepsin D (an aspartyl protease) appears to cleave a variety of substrates such as fibronectin and laminin. (wikipedia.org)
  • E-64 blocks all cathepsin proteolytic activity in murine endometriotic lesions. (nih.gov)
  • We further demonstrate that incorporating a cathepsin B-cleavable linker between the BIM BH3 peptide and the hydrophobic tail within individual amphiphiles results in increased binding to recombinant BCL-2 proteins while also allowing for increased cellular uptake and mitochondrial localization leading to faster and more potent dose-dependent cytotoxicity and caspase activation in malignant cells. (bloodjournal.org)
  • However, we here report an unexpected finding that cysteine protease genes of the family cathepsin B are massively amplified in the lineage of aphids, and that many of the protease genes exhibit gut-specific over-expression. (inria.fr)
  • Phylogenetic analyses of all the cathepsin B genes in aphids revealed that genic expansion has continuously proceeded with basal, intermediary and recent duplications. (inria.fr)
  • Cathepsin B has also been implicated in the progression of various human tumors including ovarian cancer. (wikipedia.org)
  • Mouse cathepsin L is homologous to human cathepsin V. Mouse cathepsin L has been shown to play a role in adipogenesis and glucose intolerance in mice. (wikipedia.org)
  • "Cloning and sequence analysis of cDNA for human cathepsin D" . Proceedings of the National Academy of Sciences of the United States of America . (wikipedia.org)
  • Barrett, A. J.: Human cathepsin B1. (springer.com)
  • Targeting circulating cathepsin S may lead to new therapies for human aortic valve disease. (springer.com)
  • Distribution of cathepsin L in human umbilical cord tissues. (sigmaaldrich.com)
  • Cathepsin D has been reported to be involved in malignant tumour progression and with prognosis of various human cancers. (novusbio.com)
  • Stable antisense cathepsin B-expressing clones of the highly metastatic human melanoma A375M and prostate carcinoma PC3M cell lines produced 40-50% less cathepsin B than control cells and were proportionately less invasive. (aacrjournals.org)
  • Novel, Nonpeptidic Cyanamides as Potent and Reversible Inhibitors of Human Cathepsins K and L, J. Med. (patentgenius.com)
  • Baici A, Müntener K, Willimann A, Zwicky R. Regulation of human cathepsin B by alternative mRNA splicing: homeostasis, fatal errors and cell death. (springer.com)
  • Expression of the elastolytic cathepsins S and K in human atheroma and regulation of their production in smooth muscle cells. (semanticscholar.org)
  • It was immunologically related to lysosomal cathepsin B from human liver and was similar in many, but not all, other aspects. (portlandpress.com)
  • Since we first showed increased expression of cathepsins S, L, and K in human AAA lesions, 6 other studies have found similar expression patterns. (ahajournals.org)
  • Cathepsin B is a lysosomal cysteine proteinase whose expression and trafficking are frequently altered in cancer, and plasma membrane and secreted forms are thought to contribute to the invasive and metastatic properties of malignant tumors. (aacrjournals.org)
  • AAA lesions from CatK-deficient mice showed reduced elastinolytic cathepsin activities compared with those from wild-type control mice. (ahajournals.org)
  • In this study, we used cathepsin K (CatK)-deficient mice and aorta elastase perfusion-induced experimental AAA to test whether this elastase contributes directly to AAA formation. (ahajournals.org)
  • CTSC / Cathepsin C / JP, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. (lsbio.com)
  • Cathepsin-Z (CTSZ) is a lysosomal cysteine proteinase and member of the peptidase C1 family. (prospecbio.com)
  • Cathepsin K is a recently identified lysosomal cysteine proteinase. (semanticscholar.org)
  • Essential role for cathepsin S in MHC class II-associated invariant chain processing and peptide loading," Immunity , vol. 4, no. 4, pp. 357-366, 1996. (hindawi.com)
  • In this review we cover specific roles of cathepsins in innate and adaptive immunity, as well as their implication in the pathogenesis of several diseases. (smw.ch)
  • It is of note to mention that this review is not meant to comprehensively cover the present literature on viruses encountering cathepsins but rather illustrates, on some representative examples, the possible roles of cathepsins in replication of viruses and in the course of disease. (springer.com)
  • Cathepsins are proteolytic enzymes with a broad spectrum of substrates. (springer.com)
  • 2017. https://www.tabers.com/tabersonline/view/Tabers-Dictionary/730869/all/cathepsins. (tabers.com)