A papain-like cysteine protease that has specificity for amino terminal dipeptides. The enzyme plays a role in the activation of several pro-inflammatory serine proteases by removal of their aminoterminal inhibitory dipeptides. Genetic mutations that cause loss of cathepsin C activity in humans are associated with PAPILLON-LEFEVRE DISEASE.
A group of lysosomal proteinases or endopeptidases found in aqueous extracts of a variety of animal tissues. They function optimally within an acidic pH range. The cathepsins occur as a variety of enzyme subtypes including SERINE PROTEASES; ASPARTIC PROTEINASES; and CYSTEINE PROTEASES.
Rare, autosomal recessive disorder occurring between the first and fifth years of life. It is characterized by palmoplantar keratoderma with periodontitis followed by the premature shedding of both deciduous and permanent teeth. Mutations in the gene for CATHEPSIN C have been associated with this disease.
A lysosomal cysteine proteinase with a specificity similar to that of PAPAIN. The enzyme is present in a variety of tissues and is important in many physiological and pathological processes. In pathology, cathepsin B has been found to be involved in DEMYELINATION; EMPHYSEMA; RHEUMATOID ARTHRITIS, and NEOPLASM INVASIVENESS.
A ubiquitously-expressed cysteine protease that plays an enzymatic role in POST-TRANSLATIONAL PROTEIN PROCESSING of proteins within SECRETORY GRANULES.
An intracellular proteinase found in a variety of tissue. It has specificity similar to but narrower than that of pepsin A. The enzyme is involved in catabolism of cartilage and connective tissue. EC 3.4.23.5. (Formerly EC 3.4.4.23).
A subclass of exopeptidases that includes enzymes which cleave either two or three AMINO ACIDS from the end of a peptide chain.
A cysteine protease that is highly expressed in OSTEOCLASTS and plays an essential role in BONE RESORPTION as a potent EXTRACELLULAR MATRIX-degrading enzyme.
A serine protease found in the azurophil granules of NEUTROPHILS. It has an enzyme specificity similar to that of chymotrypsin C.
An ubiquitously-expressed lysosomal cysteine protease that is involved in protein processing. The enzyme has both endopeptidase and aminopeptidase activities.
An aspartic endopeptidase that is similar in structure to CATHEPSIN D. It is found primarily in the cells of the immune system where it may play a role in processing of CELL SURFACE ANTIGENS.
A homologous group of endogenous CYSTEINE PROTEINASE INHIBITORS. The cystatins inhibit most CYSTEINE ENDOPEPTIDASES such as PAPAIN, and other peptidases which have a sulfhydryl group at the active site.
A lysosomal papain-related cysteine proteinase that is expressed in a broad variety of cell types.
ENDOPEPTIDASES which have a cysteine involved in the catalytic process. This group of enzymes is inactivated by CYSTEINE PROTEINASE INHIBITORS such as CYSTATINS and SULFHYDRYL REAGENTS.
A form of congenital ichthyosis inherited as an autosomal dominant trait and characterized by ERYTHRODERMA and severe hyperkeratosis. It is manifested at birth by blisters followed by the appearance of thickened, horny, verruciform scales over the entire body, but accentuated in flexural areas. Mutations in the genes that encode KERATIN-1 and KERATIN-10 have been associated with this disorder.
A class of morphologically heterogeneous cytoplasmic particles in animal and plant tissues characterized by their content of hydrolytic enzymes and the structure-linked latency of these enzymes. The intracellular functions of lysosomes depend on their lytic potential. The single unit membrane of the lysosome acts as a barrier between the enzymes enclosed in the lysosome and the external substrate. The activity of the enzymes contained in lysosomes is limited or nil unless the vesicle in which they are enclosed is ruptured. Such rupture is supposed to be under metabolic (hormonal) control. (From Rieger et al., Glossary of Genetics: Classical and Molecular, 5th ed)
A ubiquitously-expressed cysteine peptidase that exhibits carboxypeptidase activity. It is highly expressed in a variety of immune cell types and may play a role in inflammatory processes and immune responses.
Compounds which inhibit or antagonize biosynthesis or actions of proteases (ENDOPEPTIDASES).
Peptides composed of two amino acid units.
Any member of the group of ENDOPEPTIDASES containing at the active site a serine residue involved in catalysis.
A subclass of PEPTIDE HYDROLASES that catalyze the internal cleavage of PEPTIDES or PROTEINS.
Physiologically inactive substances that can be converted to active enzymes.
A cysteine endopeptidase found in NATURAL KILLER CELLS and CYTOTOXIC T-LYMPHOCYTES. It may have a specific function in the mechanism or regulation of cytolytic activity of immune cells.
An enzyme that catalyzes the hydrolysis of proteins, including elastin. It cleaves preferentially bonds at the carboxyl side of Ala and Val, with greater specificity for Ala. EC 3.4.21.37.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
Immunized T-lymphocytes which can directly destroy appropriate target cells. These cytotoxic lymphocytes may be generated in vitro in mixed lymphocyte cultures (MLC), in vivo during a graft-versus-host (GVH) reaction, or after immunization with an allograft, tumor cell or virally transformed or chemically modified target cell. The lytic phenomenon is sometimes referred to as cell-mediated lympholysis (CML). These CD8-positive cells are distinct from NATURAL KILLER CELLS and NATURAL KILLER T-CELLS. There are two effector phenotypes: TC1 and TC2.
This discipline concerns the study of SEXUALITY, and the application of sexual knowledge such as sexual attitudes, psychology, and SEXUAL BEHAVIOR. Scope of application generally includes educational (SEX EDUCATION), clinical (SEX COUNSELING), and other settings.
NATIONAL LIBRARY OF MEDICINE service for health professionals and consumers. It links extensive information from the National Institutes of Health and other reviewed sources of information on specific diseases and conditions.
An enzyme that catalyzes the hydrolysis of alpha-2,3, alpha-2,6-, and alpha-2,8-glycosidic linkages (at a decreasing rate, respectively) of terminal sialic residues in oligosaccharides, glycoproteins, glycolipids, colominic acid, and synthetic substrate. (From Enzyme Nomenclature, 1992)
The age, developmental stage, or period of life at which a disease or the initial symptoms or manifestations of a disease appear in an individual.
An activating NK cell lectin-like receptor subfamily that regulates immune responses to INFECTION and NEOPLASMS. Members of this subfamily generally occur as homodimers.
Antibodies produced by a single clone of cells.
Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).
The property of antibodies which enables them to react with some ANTIGENIC DETERMINANTS and not with others. Specificity is dependent on chemical composition, physical forces, and molecular structure at the binding site.
Condensed areas of cellular material that may be bounded by a membrane.
Substances used to destroy or inhibit the action of rats, mice, or other rodents.
The reduction or regulation of the population of noxious, destructive, or dangerous rodents through chemical, biological, or other means.
Diseases of rodents of the order RODENTIA. This term includes diseases of Sciuridae (squirrels), Geomyidae (gophers), Heteromyidae (pouched mice), Castoridae (beavers), Cricetidae (rats and mice), Muridae (Old World rats and mice), Erethizontidae (porcupines), and Caviidae (guinea pigs).
The use of community resources, individual case work, or group work to promote the adaptive capacities of individuals in relation to their social and economic environments. It includes social service agencies.
The science and technology dealing with the procurement, breeding, care, health, and selection of animals used in biomedical research and testing.
Commercially prepared reagent sets, with accessory devices, containing all of the major components and literature necessary to perform one or more designated diagnostic tests or procedures. They may be for laboratory or personal use.
The protection of animals in laboratories or other specific environments by promoting their health through better nutrition, housing, and care.
A cytochrome oxidase inhibitor which is a nitridizing agent and an inhibitor of terminal oxidation. (From Merck Index, 12th ed)
The flexible rope-like structure that connects a developing FETUS to the PLACENTA in mammals. The cord contains blood vessels which carry oxygen and nutrients from the mother to the fetus and waste products away from the fetus.
Blood of the fetus. Exchange of nutrients and waste between the fetal and maternal blood occurs via the PLACENTA. The cord blood is blood contained in the umbilical vessels (UMBILICAL CORD) at the time of delivery.
A cylindrical column of tissue that lies within the vertebral canal. It is composed of WHITE MATTER and GRAY MATTER.
Transplantation of STEM CELLS collected from the fetal blood remaining in the UMBILICAL CORD and the PLACENTA after delivery. Included are the HEMATOPOIETIC STEM CELLS.

Increased collagenase and dipeptidyl peptidase I activity in leucocytes from healthy elderly people. (1/128)

The incidence of infectious diseases increases with ageing. The enzymatic activity of leucocytes may have a relevant role in the morbidity and mortality due to infections in the elderly. In this study we have compared the activity of enzymes involved in the inflammatory response in leucocytes from young and elderly women. A total of 35 healthy females was studied, 20 volunteers aged 78-98 years (mean 89.1 years) and 15 young controls aged 19-34 years (mean 26 years). All of them were in good clinical condition, without any acute or chronic disease. Intracellular enzyme activity was analysed by flow cytometry in leucocytes from young and elderly women. The enzyme substrates employed were for oxidative burst, L-aminopeptidase, collagenase, cathepsin B, C, D and, G and dipeptidyl peptidase I. The intracellular enzyme activity assessed by flow cytometry in leucocytes from young and elderly women was similar, as far as oxidative burst, L-aminopeptidase, cathepsin B, C, D and G are concerned. An increased collagenase activity was detected in granulocytes from elders. The mean fluorescence channels for this enzyme corresponded to 86 +/- 23 and 60 +/- 15 in cells from elders and controls, respectively (P = 0.01224). An increased dipeptidyl peptidase I activity was detected in lymphocytes from elderly women. The corresponding values for this enzyme in elders and the young were 65.9 +/- 43.3 and 17.3 +/- 5, respectively (P = 0. 0036). The proper functional activity of intracellular enzymes involved in inflammatory responses is likely to be determinant for successful ageing.  (+info)

Dipeptidyl peptidase I is required for the processing and activation of granzymes A and B in vivo. (2/128)

Dipeptidyl peptidase I (DPPI) is a lysosomal cysteine protease that has been implicated in the processing of granzymes, which are neutral serine proteases exclusively expressed in the granules of activated cytotoxic lymphocytes. In this report, we show that cytotoxic lymphocytes derived from DPPI-/- mice contain normal amounts of granzymes A and B, but these molecules retain their prodipeptide domains and are inactive. Cytotoxic assays with DPPI-/- effector cells reveal severe defects in the induction of target cell apoptosis (as measured by [(125)I]UdR release) at both early and late time points; this defect is comparable to that detected in perforin-/- or granzyme A-/- x B-/- cytotoxic lymphocytes. DPPI therefore plays an essential role in the in vivo processing and activation of granzymes A and B, which are required for cytotoxic lymphocyte granule-mediated apoptosis.  (+info)

Location of the binding site for chloride ion activation of cathepsin C. (3/128)

Cathepsin C, a tetrameric lysosomal dipeptidyl-peptide hydrolase, is activated by chloride ion. The activation is shown here to be specific and pH-dependent, dissociation constants for chloride being lower at low pH. Bound chloride decreases the Km for the hydrolysis of chromophore labelled substrates without any significant change in Vmax, confirming its involvement in substrate binding. Determination of the kinetic parameters of chloride activation, using unlabelled substrates, has enabled its site of action to be located. The lower Km for the hydrolysis of simple amide substrates in the presence of Cl- shows that the S sites are involved. Possible involvement of the S' sites is excluded by the finding that the Km for the nucleophile in the transferase reaction is unaffected by chloride. The rates of inhibition by E-64 and iodoacetate are both chloride-dependent and, from the structure of the papain-E-64 complex, it is concluded that chloride binds close to the S2 site. The binding of guanidinium ion, a positively charged inhibitor, to the S site is dependent on chloride. Based on these results, a model is proposed to explain the chloride activation of cathepsin C. The possible physiological role of chloride in the regulation of proteolysis in the lysosome is discussed.  (+info)

Mutations of the cathepsin C gene are responsible for Papillon-Lefevre syndrome. (4/128)

Papillon-Lefevre syndrome (PLS) is an autosomal recessive disorder characterised by palmoplantar hyperkeratosis and severe early onset periodontitis that results in the premature loss of the primary and secondary dentitions. A major gene locus for PLS has been mapped to a 2.8 cM interval on chromosome 11q14. Correlation of physical and genetic maps of this interval indicate it includes at least 40 ESTs and six known genes including the lysosomal protease cathepsin C gene (CTSC). The CTSC message is expressed at high levels in a variety of immune cells including polymorphonuclear leucocytes, macrophages, and their precursors. By RT-PCR, we found CTSC is also expressed in epithelial regions commonly affected by PLS, including the palms, soles, knees, and oral keratinised gingiva. The 4.7 kb CTSC gene consists of two exons. Sequence analysis of CTSC from subjects affected with PLS from five consanguineous Turkish families identified four different mutations. An exon 1 nonsense mutation (856C-->T) introduces a premature stop codon at amino acid 286. Three exon 2 mutations were identified, including a single nucleotide deletion (2692delA) of codon 349 introducing a frameshift and premature termination codon, a 2 bp deletion (2673-2674delCT) that results in introduction of a stop codon at amino acid 343, and a G-->A substitution in codon 429 (2931G-->A) introducing a premature termination codon. All PLS patients were homozygous for cathepsin C mutations inherited from a common ancestor. Parents and sibs heterozygous for cathepsin C mutations do not show either the palmoplantar hyperkeratosis or severe early onset periodontitis characteristic of PLS. A more complete understanding of the functional physiology of cathepsin C carries significant implications for understanding normal and abnormal skin development and periodontal disease susceptibility.  (+info)

Haim-Munk syndrome and Papillon-Lefevre syndrome are allelic mutations in cathepsin C. (5/128)

Of the many palmoplantar keratoderma (PPK) conditions, only Papillon-Lefevre syndrome (PLS) and Haim-Munk syndrome (HMS) are associated with premature periodontal destruction. Although both PLS and HMS share the cardinal features of PPK and severe periodontitis, a number of additional findings are reported in HMS including arachnodactyly, acro-osteolysis, atrophic changes of the nails, and a radiographic deformity of the fingers. While PLS cases have been identified throughout the world, HMS has only been described among descendants of a religious isolate originally from Cochin, India. Parental consanguinity is a characteristic of many cases of both conditions. Although autosomal recessive transmission of PLS is evident, a more "complex" autosomal recessive pattern of inheritance with phenotypic influences from a closely linked modifying locus has been hypothesised for HMS. Recently, mutations of the cathepsin C gene have been identified as the underlying genetic defect in PLS. To determine if a cathepsin C mutation is also responsible for HMS, we sequenced the gene in affected and unaffected subjects from the Cochin isolate in which both the PLS and HMS phenotypes appear. Here we report identification of a mutation of cathepsin C (exon 6, 2127A--> G) that changes a highly conserved amino acid in the cathepsin C peptide. This mutation segregates with HMS in four nuclear families. Additionally, the existence of a shared common haplotype for genetic loci flanking the cathepsin C gene suggests that affected subjects descended from the Cochin isolate are homozygous for a mutation inherited "identical by descent" from a common ancestor. This finding supports simple autosomal recessive inheritance for HMS in these families. We also report a mutation of the same exon 6 CTSC codon (2126C-->T) in a Turkish family with classical PLS. These findings provide evidence that PLS and HMS are allelic variants of cathepsin C gene mutations.  (+info)

Localisation of a gene for prepubertal periodontitis to chromosome 11q14 and identification of a cathepsin C gene mutation. (6/128)

Prepubertal periodontitis (PPP) is a rare and rapidly progressive disease of young children that results in destruction of the periodontal support of the primary dentition. The condition may occur as part of a recognised syndrome or may occur as an isolated finding. Both autosomal dominant and recessive forms of Mendelian transmission have been reported for PPP. We report a consanguineous Jordanian family with four members affected by PPP in two nuclear sibships. The parents of the affected subjects are first cousins. We have localised a gene of major effect for PPP in this kindred (Zmax=3.55 for D11S901 at theta=0.00) to a 14 cM genetic interval on chromosome 11q14 flanked by D11S916 and D11S1367. This PPP candidate interval overlaps the region of chromosome 11q14 that contains the cathepsin C gene responsible for Papillon-Lefevre and Haim-Munk syndromes. Sequence analysis of the cathepsin C gene from PPP affected subjects from this Jordanian family indicated that all were homozygous for a missense mutation (1040A-->G) that changes a tyrosine to a cysteine. All four parents were heterozygous carriers of this Tyr347Cys cathepsin C mutation. None of the family members who were heterozygous carriers for this mutation showed any clinical findings of PPP. None of the 50 controls tested were found to have this Tyr347Cys mutation. This is the first reported gene mutation for non-syndromic periodontitis and shows that non-syndromic PPP is an allelic variant of the type IV palmoplantar ectodermal dysplasias.  (+info)

Arginine-based structures are specific inhibitors of cathepsin C. Application of peptide combinatorial libraries. (7/128)

Novel synthetic peptide inhibitors of lysosomal cysteine proteinase cathepsin C have been designed through the use of soluble peptide combinatorial libraries. The uncovered structural inhibitory module consists of the N-terminal cluster of L-arginine residues. Its modification with D-amino acids or arginine derivatives did not increase the inhibition strength. Inhibitory potency of oligoarginines improves with the elongation of peptide chain reaching a maximum for octa-L-arginine. The oligoarginines specifically interact with the cathepsin C active site as shown by competitive-type inhibition kinetics (Ki approximately 10-5 M) and intrinsic fluorescence measurements. The inhibitory interaction of oligoarginines is established through the specific spatial contact of a net of guanidino groups in the arginine side-chains, as indicated by comparison with inhibitory action of low molecular mass guanidine derivatives (Ki approximately 10-3 M). Nonarginine polyionic compounds cannot mimic the inhibitory effect of oligoarginines. The arginine-based peptide inhibitors were selective towards cathepsin C among other cysteine proteinases tested.  (+info)

Programming for cytotoxic effector function occurs concomitantly with CD4 extinction during CD8(+) T cell differentiation in the thymus. (8/128)

CD4(+) T cells are generally specialized to function as helper cells and CD8(+) T cells are generally specialized to function as cytotoxic effector cells. To explain how such concordance is achieved between co-receptor expression and immune function, we considered two possibilities. In one case, immature CD4(+)CD8(+) thymocyte precursors might first down-regulate expression of one co-receptor molecule, with the remaining co-receptor molecule subsequently activating the appropriate helper or cytotoxic functional program. Alternatively, we considered that the same intrathymic signals that selectively extinguished expression of one or the other co-receptor molecule might simultaneously initiate the appropriate helper or cytotoxic functional program. In the present study, we attempted to distinguish between these alternatives by examining thymocyte precursors of CD8(+) T cells for expression of Cathepsin C and Cathepsin W, molecules important for cytotoxic effector function. We report in developing thymocytes that Cathepsin C and Cathepsin W are expressed coordinately with extinction of CD4 co-receptor expression. We conclude that CD4 extinction and initiation of the cytotoxic functional program occurs simultaneously during differentiation of CD8(+) T cells in the thymus.  (+info)

Cathepsin C (CTSC) also known as dipeptidyl peptidase I (DPP-I) is a lysosomal exo-cysteine protease belonging to the peptidase C1 family. In humans, it is encoded by the CTSC gene. Cathepsin C appears to be a central coordinator for activation of many serine proteases in immune/inflammatory cells. Cathepsin C catalyses excision of dipeptides from the N-terminus of protein and peptide substrates, except if (i) the amino group of the N-terminus is blocked, (ii) the site of cleavage is on either side of a proline residue, (iii) the N-terminal residue is lysine or arginine, or (iv) the structure of the peptide or protein prevents further digestion from the N-terminus. The cDNAs encoding rat, human, murine, bovine, dog and two Schistosome cathepsin Cs have been cloned and sequenced and show that the enzyme is highly conserved. The human and rat cathepsin C cDNAs encode precursors (prepro-cathepsin C) comprising signal peptides of 24 residues, pro-regions of 205 (rat cathepsin C) or 206 (human ...
Background: PLS is a rare autosomal recessive disorder characterized by early onset periodontopathia and palmar plantar keratosis. PLS is caused by mutations in the cathepsin C (CTSC) gene. Dipeptidyl-peptidase I encoded by the CTSC gene removes dipeptides from the aminoterminus of protein substrates and mainly plays an immune and inflammatory role. Several mutations have been reported in this gene in patients from several ethnic groups. We report here mutation analysis of the CTSC gene in three Indian families with PLS. Methods: Peripheral blood samples were obtained from individuals belonging to three Indian families with PLS for genomic DNA isolation. Exon-specific intronic primers were used to amplify DNA samples from individuals. PCR products were subsequently sequenced to detect mutations.PCR-SCCP and ASOH analyses were used to determine if mutations were present in normal control individuals. Results: All patients from three families had a classic PLS phenotype, which included ...
Neutrophils are among the first cells implicated in acute inflammation. Leaving the blood circulation, they quickly migrate through the interstitial space of tissues and liberate oxidants and other an
Buy anti-CTSC antibody, Rabbit anti-Bovine Cathepsin C Polyclonal Antibody-AAQ08887.1 (MBS573038) product datasheet at MyBioSource, Primary Antibodies. Application: Immunoprecipitation (IP)
Dadkhah E, Moghaddasian M, Arab H, Bustani Farkoush H, Kazemi Noughabi M, Abbaszadegan MR. Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever Syndrome. European Human Genetics Conference 2012.Nurnberg, Germany, 2012.. Abbaszadegan MR, Forghanifard MM. Impact of cancer testis antigens crosstalk with self renewal cell signaling pathways in esophageal squamous cell carcinoma. European Human Genetics Conference 2012.Nurnberg, Germany. June 23-26-2012. (Poster presentation).. ...
Dadkhah E, Moghaddasian M, Arab H, Bustani Farkoush H, Kazemi Noughabi M, Abbaszadegan MR. Novel mutation in cathepsin C gene(CTSC) and modeling of mutated protein in three Iranian families with Papillon Lefever Syndrome. European Human Genetics Conference 2012.Nurnberg, Germany, 2012.. Abbaszadegan MR, Forghanifard MM. Impact of cancer testis antigens crosstalk with self renewal cell signaling pathways in esophageal squamous cell carcinoma. European Human Genetics Conference 2012.Nurnberg, Germany. June 23-26-2012. (Poster presentation).. ...
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
The mechanism of toxicity for cytolytic lymphocytes of Leu-Leu-OMe and related dipeptide derivatives was examined. Selective inhibition of dipeptidyl peptidase I (DPPI), a lysosomal thiol protease highly enriched in cytotoxic lymphocytes, prevented all natural killer (NK) toxic effects of such agents. However, many DPPI substrates were found to possess no NK toxic properties. For some such agents, this lack of NK toxicity appeared to be related to the lack of uptake by lymphocytes. In this regard, Leu-Leu-OMe was found to be incorporated by lymphocytes and monocytes via a saturable facilitated transport mechanism with characteristics distinct from previously characterized mammalian dipeptide transport processes. This novel transport process was found to be specific for dipeptides composed of selective L-stereoisomer amino acids and enhanced by hydrophobic ester or amide additions to the COOH terminus of dipeptides. Maximal rates of Leu-Leu-OMe uptake by T8 and NK cell-enriched peripheral blood ...
The dipeptide glycyl-l-phenylalanine 2-naphthylamide (GPN) is widely used to perturb lysosomes because its cleavage by the lysosomal enzyme cathepsin C is proposed to rupture lysosomal membranes. We show that GPN evokes a sustained increase in lysosomal pH (pHly), and transient increases in cytosolic pH (pHcyt) and Ca2+ concentration ([Ca2+]c). None of these effects require cathepsin C, nor are they accompanied by rupture of lysosomes, but they are mimicked by structurally unrelated weak bases. GPN-evoked increases in [Ca2+]c require Ca2+ within the endoplasmic reticulum (ER), but they are not mediated by ER Ca2+ channels amplifying Ca2+ release from lysosomes. GPN increases [Ca2+]c by increasing pHcyt, which then directly stimulates Ca2+ release from the ER. We conclude that physiologically relevant increases in pHcyt stimulate Ca2+ release from the ER in a manner that is independent of IP3 and ryanodine receptors, and that GPN does not selectively target lysosomes. ...
Background Cystatin F is really a proteins inhibitor of cysteine peptidases, portrayed in immune cells and localised in endosomal/lysosomal compartments predominantly. High-104 cell series were set up, either by treatment by ionomycin or by immunosuppressive changing growth aspect beta. Decreased cytotoxicity correlated with an increase of degrees of cystatin F with attenuated actions of cathepsins C, L and H and of granzyme B. Co-localisation of cystatin cathepsins and F C, L and H and connections between cystatin F and cathepsins C and H were demonstrated. Conclusions Cystatin F is definitely designated as a possible regulator of T cell cytotoxicity, similar to its part in natural killer cells. (BioGenes GmbH, Berlin, Germany), as a negative control. Dynabeads protein G with bound antibodies was then added to lysates. After rotation at 4C over night, beads were washed three times with lysis buffer and boiled for 10 minutes in 1 SDS loading buffer. Eluted proteins were analysed by western blot. ...
Plasmid DPAP1-COMP-blac-flag-his from Dr. Gavin Wrights lab contains the insert cathepsin C, homolog,dipeptidyl aminopeptidase 1 (DPAP1). This plasmid is available through Addgene.
Heike Wulff. Seed grants like the CTSC award are very important because they allow us to generate preliminary data for larger NIH grants, which are typically not awarded without existing data showing that the project is feasible, said Heike Wulff, professor of pharmacology and one of this years awardees. Our CTSC grant will allow us to test whether a novel therapeutic principle, the activation of a particular neuronal potassium channel, can indeed reduce neuronal excitability and thus prevent epileptic seizures.. The CTSC awarded seven UC Davis investigators for investigations in three broad categories: highly innovative research, new approaches to neurodevelopmental disorders and mini-biorepositories from clinical research projects. The recipients are working closely with CTSC leadership for additional resources to support their collaborative research projects.. Highly innovative research. ...
Yveline Hamon, Monika Łęgowska, Patricia Fergelot, Sandrine Dallet-Choisy, Louise Newell, Lise Vanderlynden, Ali Kord Valeshabad, Karina Acrich, Hadi Kord, Tsamakis Charalampos, Fanny Morice-Picard, Ian Surplice, Jerome Zoidakis, Karen David, Antonia Vlahou, Shivanna Ragunatha, Nikoletta Nagy, Katalin Farkas, Márta Széll, Cyril Goizet, Beate Schacher, Maurizio Battino, Abdullah Al Farraj Aldosari, Xinwen Wang, Yang Liu, Sylvain Marchand-Adam, Adam Lesner, Elodie Kara, Sevil Korkmaz-Icöz, Celia Moss, Peter Eickholz, Alain Taieb, Salih Kavukcu, Dieter E. Jenne, Francis Gauthier, Brice Korkmaz, Analysis of urinary cathepsin C for diagnosing Papillon-Lefèvre syndrome, The FEBS Journal, 2016, Vol. 283, iss. 3, 498-509, IF: ...
We welcome the opportunity to assist you during this challenging time. Clinical Trial Nurse Navigators and Information Specialists will continue to operate on normal business hours. Finding a clinical trial can be overwhelming. Patients are often left to search on their own, leaving them with more questions than answers. Fortunately, The Leukemia & Lymphoma Society now
CP001994.PE2 Location/Qualifiers FT CDS complement(1457..2011) FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Mmah_0002 FT /product=peptidase S26B, signal peptidase FT /note=InterPro IPR001733; KEGG: hypothetical protein; FT K03100 signal peptidase I; SPTR: Q12VA0 Peptidase S26B, FT signal peptidase; TIGRFAM: peptidase S26B, signal FT peptidase; PFAM: Peptidase S24-like; TIGRFAM: signal FT peptidase I, archaeal type FT /db_xref=EnsemblGenomes-Gn:Mmah_0002 FT /db_xref=EnsemblGenomes-Tr:ADE35540 FT /db_xref=GOA:D5E8N1 FT /db_xref=InterPro:IPR001733 FT /db_xref=InterPro:IPR015927 FT /db_xref=InterPro:IPR036286 FT /db_xref=UniProtKB/TrEMBL:D5E8N1 FT /protein_id=ADE35540.1 FT /translation=MEIGEIIHTFKNSDNFWVGIARDALSVLAILAVIGILSQLFFGMW FT TPMVAVESGSMEPHMYRGDIIFIEDLDRTRIETLRDAPEDYISFEKKGDVILYRPYGQK FT GVTPVIHRAMYFVEEGEQMWEGGPDAPHEGYITKGDNKKTNSYYDQQGQISYLAPVKEE FT WIIGVARYKVPYIGHIRLLLS MEIGEIIHTF KNSDNFWVGI ARDALSVLAI LAVIGILSQL FFGMWTPMVA VESGSMEPHM 60 YRGDIIFIED LDRTRIETLR ...
Cumpara acum Agrafe pt. birou colorate, 28mm, 40 buc/cutie, RIO Zebra la cel mai mic pret. Confirmarea comenzii in maxim 15 minute.
Papillon-Lefevre syndrome. Coloured transmission electron micrograph (TEM) of a cell affected by Papillon-Lefevre syndrome, a rare inherited condition. Plaques of the protein keratin (blue) are seen within the cell. The disease causes hyperkeratosis (thickening of the skin) and severe periodontitis, an inflammation of the tissue that surrounds and supports the teeth. The inflammation results in bone and tooth loss. Magnification: x16,600 when printed at 10 centimetres wide. - Stock Image C020/8722
Papillon-Lefevre Disease: Rare, autosomal recessive disorder occurring between the first and fifth years of life. It is characterized by palmoplantar keratoderma with periodontitis followed by the premature shedding of both deciduous and permanent teeth. Mutations in the gene for CATHEPSIN C have been associated with this disease.
TY - JOUR. T1 - Mechanism of L-leucyl-L-leucine methyl ester-mediated killing of cytotoxic lymphocytes. T2 - Dependence on a lysosomal thiol protease, dipeptidyl peptidase I, that is enriched in these cells. AU - Thiele, Dwain L. AU - Lipsky, Peter E.. PY - 1990. Y1 - 1990. N2 - Exposure of murine or human lymphocytes to L-leucyl-L-leucine methyl ester (Leu-Leu-OMe) results in selective killing of cytotoxic lymphocytes, whereas helper T cells and B cells remain functionally intact. Cytolytic lymphocytes incubated in the presence of toxic concentrations of Leu-Leu-OMe were found to contain membranolytic metabolites of the structure (Leu-Leu)n-OMe, where n ≥ 3. The sensitivity of cytotoxic lymphocytes to Leu-Leu-OMe was found to be dependent upon production of these metabolites by a lysosomal thiol protease, dipeptidyl peptidase I, which is present at far higher levels in cytotoxic lymphocytes than in cells without cytolytic potential or not of bone marrow origin. Thus, this granule enzyme is ...
Conuco es un índice que trabaja únicamente revistas y publicaciones electrónicas creadas en Puerto Rico o por puertorriqueños fuera de Puerto Rico. Es un índice mixto que recoge tanto material académico como material popular e informativo. Así en Conuco podrá encontrar tanto un artículo erudito como una noticia sobre un incidente criminal.
The Papillon-Lefèvre syndrome or keratosis palmoplantaris associated to periodontopathy was first described by Papillon-Lefèvre, in 1924. It is an autosomal recessive genetic disease, with alteration in the gene CTSC, located in chromosome 11q14.1-q14.4, more precisely in the protein called cathepsin C (Hart et al., 2000; Shafer et al., 1987; Neville et al., 2001; Tommasi, 2002; Allende & Moreno, 2003; Hewitt et al., 2004; Selvaraju et al., 2003 ). It affects children and young adults of both sexes with no distinction. It is a very rare disease, with a prevalence of one in one million individuals. Its main oral clinical characteristics include periodontopathies, premature loss of deciduous teeth, at the age of 4-5 years and of the permanent teeth at approximately 14 years (Allegra & Gennari, 2000; Regezi & Sciubba, 2000; Tommasi, 2002; Siragusa et al., 2000). According to Shafer et al. (1987), only the permanent dentition is affected in some cases.. Patients also present halitosis, intense ...
People make mistakes and poor choices; Vision Zero says those mistakes dont have to cost lives. Working together, we can eliminate deaths and serious injuries on our streets. The CTSC focused on Vision Zero for their 2016-2018 work plan, committing to making Santa Cruz County safer for all road users. Click here to read our 2017 report, The Impact of Traffic Violence On Santa Cruz County, explore interactive maps showing our high-injury corridors and other crash data, and view our Vision Zero workplan.. Our Mission. The mission of the Community Traffic Safety Coalition is to reduce traffic-related injuries while promoting the use of alternative modes of transportation. The primary focus is on bicycle and pedestrian safety issues. The CTSC educates all road users in safety practices to decrease the risk and severity of collisions, and advocates for improved conditions to make all methods of transportation safer.. About the Community Traffic Safety Coalition. The CTSC is a creative and ...
Congratulations to our KL2 Scholars-Nicole Kucine, MD, and Danielle Novetsky Friedman, MD-on presenting their theses before the Masters Examining Committee in April. Nicole, a WCMC Assistant Professor of Pediatrics, presented on her CTSC KL2 research, Evaluation of Myeloproliferative Neoplasms in Pediatric Patients. Danielle, an MSK Instructor of Pediatrics, presented on her CTSC KL2 research, Chronic Conditions in Adult Survivors of Retinoblastoma. Wed also like to thank their mentors (Drs. Ross Levine, James Bussel, Kevin Oeffinger, Erika Abramson, and Chaya Moskowitz) and our Associate Program Directors (Drs. Yuan-Shan Zhu and Dean Bajorin) for attending and showing tremendous support for their mentees.. CTSC Research in Progress Luncheon ...
Upon stimulation, polymorphonuclear leucocytes (PMNs) release potent serine proteases, i.e. elastase, cathepsin C and proteinase 3, which contribute to the degradation of tissue and plasma components. Here, we describe the development of a plasma test to assess PMN-mediated fibrinogenolysis as a biochemical marker for actual PMN-derived proteolysis in vivo, useful for monitoring therapeutic efficacy, i.e. of elastase inhibitors. We generated a monoclonal antibody (MAb), designated 1-1/B3, with a high affinity for elastase-degraded fibrinogen (EDF). The epitope for 1-1/B3 becomes exposed in a time-dependent manner during digestion of fibrinogen with purified PMN-derived serine proteases and with isolated PMNs in vitro. However, 1-1/B3 does not react with plasma fibrinogen or with fibrin(ogen) degradation products generated by plasmin or by other active proteases that may occur locally, i.e. metalloproteases and lysosomal cathepsins. On the basis of MAb 1-1/B3, we developed a plasma test for the ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Cumpara acum Mine pentru creion 2mm, HB, 12 buc/etui, STAEDTLER Mars carbon la cel mai mic pret. Confirmarea comenzii in maxim 15 minute.
From NCBI Gene:. This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. A portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. [provided by RefSeq, Nov 2015]. From UniProt: ...
Shop Probable dipeptidyl-peptidase ELISA Kit, Recombinant Protein and Probable dipeptidyl-peptidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Clinical trial has received WCMC IRB and CTSC approval with enrollment of initial 6 subjects at WCMC. An additional 38 subjects enrolled 29 treated at participating sub-sites. Reports submitted to WCMC DSMB in December 2014 with approval to proceed without modifications.
This page contains information about of L-Alanine- -Naphthylamide Hydrobromide | Purchase L-Alanine- -Naphthylamide Hydrobromide online.
Welcome! For price inquiries, please feel free to contact us through the form on the left side. We will get back to you as soon as possible.. ...
1. L-trans-Epoxysuccinyl-leucylamido(4-guanidino)butane (E-64) at a concentration of 0.5 mM had no effect on the serine proteinases plasma kallikrein and leucocyte elastase or the metalloproteinases thermolysin and clostridial collagenase. In contrast, 10 muM-E-64 rapidly inactivated the cysteine proteinases cathepsins B, H and L and papain (t0.5 = 0.1-17.3s). The streptococcal cysteine proteinase reacted much more slowly, and there was no irreversible inactivation of clostripain. The cysteine-dependent exopeptidase dipeptidyl peptidase I was very slowly inactivated by E-64. 2. the active-site-directed nature of the interaction of cathepsin B and papain with E-64 was established by protection of the enzyme in the presence of the reversible competitive inhibitor leupeptin and by the stereospecificity for inhibition by the L as opposed to the D compound. 3. It was shown that the rapid stoichiometric reaction of the cysteine proteinases related to papain can be used to determine the operational molarity of
Glutamine supplementation has been advocated for patients requiring parenteral nutritional support. However, the direct effect of glutamine on neoplastic cells is poorly understood. We therefore investigated the effects of glutamine on the proliferation, differentiation, and cell-matrix interactions of two human colon carcinoma cell lines (Caco-2 and SW620) adapted to glutamine-free media. Doubling times were calculated by logarithmic transformation of serial cell counts. Alkaline phosphatase, cathepsin C (dipeptidyl peptidase), lactase, and isomaltase expression (markers of differentiation) were assayed by digestion of synthetic substrates. Adhesion to matrix proteins was assessed by colorimetric quantitation of toluidine blue staining of adherent cells. Surface expression of Caco-2 receptors for matrix proteins (integrins) was studied by biotinylation and immunoprecipitation with specific antibodies. Glutamine (1-10 mm) dose-dependently stimulated Caco-2 proliferation on all matrices studied ...
The UC Davis Clinical and Translational Science Center (CTSC) and the wide array of services that have supported innovative biomedical research and led to the development of new treatments for diseases during the past 10 years will continue, thanks to a $27.8 million grant from the National Center for Accelerating Translational Science and the ongoing support from the School of Medicine.
The safety and scientific validity of this study is the responsibility of the study sponsor and investigators. Listing a study does not mean it has been evaluated by the U.S. Federal Government. Know the risks and potential benefits of clinical studies and talk to your health care provider before participating. Read our disclaimer for details ...
You currently have no access to view or download this content. Please log in with your institutional or personal account if you should have access to this content through either of these. Showing a limited preview of this publication: ...
Apoptose er programmert celledød for å fjerne uønskede celler og er en felles egenskap for alle flercellede organismer. Caspase-3 er involvert i intracellulære signalkaskader ved apoptose. En ubalanse i regulering av apoptose kan føre til kreftutvikling. Apoptose spiller en viktig rolle i flere andre sykdommer som immunologisk, iskemiske, og nevrodegenerative sykdommer. For å undersøke betydningen av proteasen legumain og proteaseinhibitoren cystatin E/M for caspase-3 aktivitet, ble det brukt HEK293 (normale kontroll celler), M38L (overutrykker legumain) og M4C (overutrykker cystatin E/M) celler. Cellene ble stimulert med dødsstimulerende stoffer som staurosporin og Leu-Leu-OMe. Staurosporin er kjent for å være en kinasehemmer. Leu-Leu-OMe øker lysosomal membranpermeabilitet. Proteaser som er involvert i apoptose vil dermed frigjøres fra lysosomer til cytosol. Legumain som befinner seg i lysosomene, kan frigjøres til cytosol og dermed påvirke aktiviteten av caspase-3 eller andre ...
Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. In humans, it is coded by the CTSB gene. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene.
CTSC is a nonpartisan nonprofit organization that uses the power of technology and internet to empower social change. We do so by creating tools, engaging local developer/hacker community, funding new projects, opening data, releasing media campaigns and advocacy.
glycyl-aspartyl-aspartyl-aspartyl-aspartyl-lysine-2-naphthylamide: synthetic substrate linked via amide bond to fluorophore 2-naphthylamine
Methanol 3.5L - (pls whatsapp us to check availability),Price: RM36.00,End time 12/7/2019 9:15 AM MYT,Category: Chemical / B2B & Industrial Products
Complexes of gold( I) have long been used to treat rheumatoid arthritis although the precise biological targets of gold are not well understood. One intriguing therapeutic target of Au( I) is the cathepsin family of lysosomal cysteine proteases. Here, we present the inhibition of cathepsin B by a known Au( I)-based drug and a series of derivatives. The complexes investigated were reversible, competitive inhibitors with IC50 values ranging from 0.3 to 250 mu M, depending on the substituents around the Au( I). ...
Dipeptidyl-peptidase 3 is an enzyme that in humans is encoded by the DPP3 gene. This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternate transcriptional splice variants have been characterized. GRCh38: Ensembl release 89: ENSG00000254986 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000063904 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Fukasawa KM, Fukasawa K, Harada M (Jun 2000). Assignment of the dipeptidyl peptidase III gene (DPP3) to human chromosome 11 band q12→q13.1 by in situ hybridization. Cytogenet Cell Genet. 88 (1-2): 99-100. doi:10.1159/000015498. PMID 10773679. Entrez Gene: DPP3 dipeptidyl-peptidase ...
YSCH2B1 J01327 M25040 M25041 V01307 607bp ds-DNA PLN 23-AUG-1994 Yeast (S.cerevisiae) histone H2B-1 gene. histone; histone H2B. YSCH2B2 J01328 V01308 589bp ds-DNA PLN 23-AUG-1994 Yeast (S.cerevisiae) histone H2B-2 gene. histone; histone H2B. YSCLTG3 D16304 1779bp ds-DNA PLN 24-AUG-1994 Yeast LTG3 gene. . YSCSTEYCI L21944 3136bp ds-DNA PLN 23-AUG-1994 Saccharomyces cerevisiae dipeptidyl aminopeptidase (STE13 or YCI1) gene, complete cds. dipeptidyl aminopeptidase ...
These are the key pieces of data that will be populated within the IUID Registry, that provide information on the item, the supplier, the contract, and the delivery.. Data requirements for IUID data are based on the second DFARS Interim Rule on Unique Item Identification and Valuation which was published in the Federal Register on January 1, 2004 . (DFARS Revision 20040101 or subsequent revisions). In order to capture IUID Item Pedigree, the following core IUID data elements are required:. ...
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
This is a list of all employees at the Department of Biomedical Sciences. The list is sorted in alphabetical order in accordance to the employees first name.
CD26 antibody [M-A261] (dipeptidyl peptidase 4) for FACS, IHC-Fr, IP. Anti-CD26 mAb (GTX74879) is tested in Human samples. 100% Ab-Assurance.
Human CTSB full-length ORF (NP_001899.1, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. (H00001508-P02) - Products - Abnova
Rüppell W. P. E. S., 1835-1838. Neue Wirbelthiere zu der Fauna von Abyssinien gehörig. Fische des Rothen Meeres. Frankfurt-am-Main. 1-148, Pls. 1-33. (1835:1-28, Pls. 1-7; 1836:29-52, Pls. 8-14; 1837:53-80, Pls. 15-21; 1838:81-148, Pls. 22-33.) Fische Rothen Meeres 1835-38 ...
Of these hydrolytic enzymes, cathepsin K is of most importance. Cathepsin K and other cathepsins[edit]. Cathepsin K is a ... Several other cathepsins are expressed in osteoclasts including cathepsins B, C, D, E, G, and L. The function of these cysteine ... characterised by a lack of functional cathepsin K expression. Knockout studies of cathepsin K in mice lead to an osteopetrotic ... Studies on cathepsin L knockout mice have been mixed, with a report of reduced trabecular bone in homozygous and heterozygous ...
... , Histones & Cathepsin; PMAP The Proteolysis Map-animation [ Recent chromatin publications and news] Protocol for in ...
... s were discovered in 1884 by Albrecht Kossel.[17] The word "histone" dates from the late 19th century and is derived from the German word "Histon", a word itself of uncertain origin - perhaps from the Greek histanai or histos. In the early 1960s, before the types of histones were known and before histones were known to be highly conserved across taxonomically diverse organisms, James F. Bonner and his collaborators began a study of these proteins that were known to be tightly associated with the DNA in the nucleus of higher organisms.[18] Bonner and his postdoctoral fellow Ru Chih C. Huang showed that isolated chromatin would not support RNA transcription in the test tube, but if the histones were extracted from the chromatin, RNA could be transcribed from the remaining DNA.[19] Their paper became a citation classic.[20] Paul T'so and James Bonner had called together a World Congress on Histone Chemistry and Biology in 1964, in which it became clear that there was no consensus on the ...
... collagenases such as cathepsin B1; and hyaluronidase. PSGAG inhibits the synthesis of prostaglandin E2, which is released upon ...
Cathepsin A Breddam, K. (1986). "Serine carboxypeptidases. A review". Carlsberg Res. Commun. 51: 83-128. doi:10.1007/bf02907561 ... Miller JJ, Changaris DG, Levy RS (December 1992). "Purification, subunit structure and inhibitor profile of cathepsin A". ... Carboxypeptidase C (EC 3.4.16.5, carboxypeptidase Y, serine carboxypeptidase I, cathepsin A, lysosomal protective protein, ...
Cathepsin E. TALE homeodomain transcription factors. Hydrocortisone. Since keratinocyte differentiation inhibits keratinocyte ... "The role of cathepsin E in terminal differentiation of keratinocytes". Biological Chemistry. 392 (6): 571-85. doi:10.1515/BC. ...
Cathepsin D is involved in CLN10. DNA analysis can be used to help confirm the diagnosis of Batten disease. When the mutation ...
Mediation by cathepsin G has been suggested. The treatment of RAS usually involves administering dexamethasone IV, with the ...
... these include cathepsin L, papain, and procaricain. It forms an alpha-helical domain that runs through the substrate-binding ...
"Cathepsins as transcriptional activators? Developmental Cell 2004, 6(5):610-1. Goulet B, and Nepveu A. "Complete and Limited ...
Lushbaugh WB, Hofbauer AF, Pittman FE (June 1985). "Entamoeba histolytica: purification of cathepsin B". Experimental ...
The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein ... 1994). "Cathepsin B activity in human lung tumor cell lines: ultrastructural localization, pH sensitivity, and inhibitor status ... 1988). "Cathepsin D inactivates cysteine proteinase inhibitors, cystatins". Biochem. Biophys. Res. Commun. 154 (2): 765-72. doi ... Cystatin B has been shown to interact with Cathepsin B. GRCh38: Ensembl release 89: ENSG00000160213 - Ensembl, May 2017 GRCm38 ...
These cysteine proteases include calpain, caspase, and cathepsin. These three proteins are examples of detectable signs of ...
It is an inhibitor of cathepsin K, an enzyme involved in bone resorption. The drug was developed by Merck & Co. The phase III ... Le Gall, C. L.; Bonnelye, E.; Clézardin, P. (2008). "Cathepsin K inhibitors as treatment of bone metastasis". Current Opinion ... February 2008). "The discovery of odanacatib (MK-0822), a selective inhibitor of cathepsin K". Bioorg. Med. Chem. Lett. 18 (3 ...
... α: cathepsin L-like protein in sponge biosilica. Proceedings of the National Academy of Sciences, 95(11), pp.6234- ... Silicateins are homologous to the cysteine protease cathepsin. In sponges, the silicatein enzymes reside in the axial filaments ...
2000). "Secreted cathepsin L generates endostatin from collagen XVIII". EMBO J. 19 (6): 1187-94. doi:10.1093/emboj/19.6.1187. ... 2000). "Secreted cathepsin L generates endostatin from collagen XVIII". EMBO J. 19 (6): 1187-94. doi:10.1093/emboj/19.6.1187. ... by proteases such as cathepsins. Collagen is a component of epithelial and endothelial basement membranes. Endostatin, as a ...
Cathepsin A is also required for normal elastin biosynthesis. GRCh38: Ensembl release 89: ENSG00000170266 - Ensembl, May 2017 ... The elastin receptor complex includes S-Gal, neuraminidase and Cathepsin A. When elastin-derived peptides bind to the S-Gal ... cathepsin) A is required for proper elastic fiber formation and inactivation of endothelin-1". Circulation. 117 (15): 1973-81. ...
Under the direction of Joseph S. Fruton, Jones' dissertation research involved the catalytic properties of cathepsin C, a type ... She pursued these interests by studying androsterone and monopalmitin at Armour, and cathepsin C at Yale. Jones worked as ... Her doctorate was entitled: Transamidation reactions catalyzed by cathepsin C. Jones completed her studies in three years ... Transamidation Reactions Catalyzed by Cathepsin C. Yale University, 1952. Kresge, Nicole; Simoni, Robert D.; Hill, Robert L. ( ...
McDonald JK, Zeitman BB, Reilly TJ, Ellis S (May 1969). "New observations on the substrate specificity of cathepsin C ( ... Planta RJ, Gorter J, Gruber M (September 1964). "The catalytic properties of cathepsin C". Biochimica et Biophysica Acta (BBA ... Dipeptidyl peptidase I (EC 3.4.14.1, cathepsin C, dipeptidyl aminopeptidase I, dipeptidyl transferase, dipeptide arylamidase I ... Metroione RM, Neves AG, Fruton JS (May 1966). "Purification and properties of dipeptidyl transferase (Cathepsin C)". ...
1982). "Action of rat liver cathepsin L on glucagon". Acta Biol. Med. Ger. 40 (9): 1139-43. PMID 7340337. Kaushal GP, Walker PD ...
... cathepsin G and proteinase 3. Phthalimide derivatives were seen to be inactive, while saccharin derivatives were seen to be ... cathepsin G and proteinase 3". Bioorganic & Medicinal Chemistry. 3 (2): 187-193. doi:10.1016/0968-0896(95)00013-7. PMID 7796053 ...
It is cleavable by cathepsin and safe for therapy. Trastuzumab emtansine is a combination of the microtubule-formation ...
2000). "Secreted cathepsin L generates endostatin from collagen XVIII". EMBO J. 19 (6): 1187-94. doi:10.1093/emboj/19.6.1187. ...
1990). "Generation of human endothelin by cathepsin E." FEBS Lett. 273 (1-2): 99-102. doi:10.1016/0014-5793(90)81060-2. PMID ...
... contains cathepsin B, lysozymes, chymotrypsin, neutrophil elastase and cytokines, which aid the immune system. According ... Frohlich E, Schaumburg-Lever G, Klessen C (1993). "Immunelectron microscopic localization of cathepsin B in human exocrine ...
Cathepsin B and L play a crucial role in arthritic cartilage degeneration. The inhibitor of cathepsin isolated from this fungus ... The fungal metabolite, aurantiamide acetate, has been isolated from Aspergillus penicillioides, as a cathepsin inhibitor. ... a Selective Cathepsin Inhibitor, Produced by Aspergillus penicillioides". Bioscience, Biotechnology, and Biochemistry. 65 (5): ...
... cathepsin G". Blood. 93 (6): 2089-97. doi:10.1182/blood.V93.6.2089.406k10_2089_2097. PMID 10068683. Tan J, Prakash MD, ... antitrypsin to inhibit cathepsin proteases". Biochemistry. 41 (15): 4998-5004. doi:10.1021/bi0159985. PMID 11939796. Schick C, ... "Squamous cell carcinoma antigen 2 is a novel serpin that inhibits the chymotrypsin-like proteinases cathepsin G and mast cell ... "DNA accelerates the inhibition of human cathepsin V by serpins". The Journal of Biological Chemistry. 282 (51): 36980-6. doi: ...
BACE1, BACE2 Cathepsin D Cathepsin E Chymosin (or "rennin") Napsin-A Nepenthesin Pepsin Presenilin Renin BACE1; BACE2; CTSD; ... Eukaryotic aspartic proteases include pepsins, cathepsins, and renins. They have a two-domain structure, arising from ancestral ... Cathepsin D". In Rawlings ND, Salvesen G (eds.). Handbook of Proteolytic Enzymes (Third ed.). Academic Press. pp. 54-63. doi: ...
2000). "Cathepsin G activates protease-activated receptor-4 in human platelets". J. Biol. Chem. 275 (10): 6819-23. doi:10.1074/ ...
In humans, the group of cathepsin cysteine proteases or cysteine cathepsins comprises 11 family members, cathepsins B, C, F, H ... Examination of cathepsin activity by using chemical probes and in vivo imaging techniques demonstrated an increase in cathepsin ... Cathepsins also can be secreted by cells, associate with the cell surface, and degrade the ECM. A study of all 11 members of ... Cathepsin L is active at neutral pH by associating with a p41 splice variant of the MHC class II-associated invariant chain ...
Cathepsin: Cathepsins ( Ancient Greek kata- "down" and hepsein "boil"; abbreviated CTS ) are proteases ( enzymes that degrades ... Cathepsins have a vital role in mammalian cellular turnover, e.g. bone resorption. They degrade polypeptides and are ... There are, however, exceptions such as cathepsin K, which works extracellularly after secretion by osteoclasts in bone ...
"Human cathepsins W and F form a new subgroup of cathepsins that is evolutionary separated from the cathepsin B- and L-like ... Wex T, Levy B, Wex H, Brömme D (1999). "Human cathepsins F and W: A new subgroup of cathepsins". Biochem. Biophys. Res. Commun ... 2003). "Characterization of novel anti-cathepsin W antibodies and cellular distribution of cathepsin W in the gastrointestinal ... Cathepsin W is a protein that in humans is encoded by the CTSW gene.[5][6][7] ...
Cathepsin A is an enzyme that is classified both as a cathepsin and a carboxypeptidase. In humans, it is encoded by the CTSA ... Cathepsin A has been shown to interact with NEU1.[7] References[edit]. *^ a b c GRCh38: Ensembl release 89: ENSG00000064601 - ... "Entrez Gene: CTSA cathepsin A".. *^ Mitchell, Richard Sheppard; Kumar, Vinay; Robbins, Stanley L.; Abbas, Abul K.; Fausto, ... 1991). "Human lysosomal protective protein has cathepsin A-like activity distinct from its protective function". J. Biol. Chem ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Crystal structure of stefin A in complex with cathepsin H. 1nb3 Crystal structure of stefin A in complex with cathepsin H: N- ... CRYSTAL STRUCTURE OF PORCINE CATHEPSIN H DETERMINED AT 2.1 ANGSTROM RESOLUTION: LOCATION OF THE MINI-CHAIN C-TERMINAL CARBOXYL ...
cathepsin K. Names. cathepsin O. cathepsin O1. cathepsin O2. cathepsin X. NP_000387.1. *EC 3.4.22.38 ... Metabolic mapping showed that cathepsin B, but not cathepsin K is active in GSC niches. Title: Cysteine cathepsins B, X and K ... cathepsin K in the development of chronic subdural hematoma Title: Role of cathepsin K in the development of chronic subdural ... Cathepsin K degradation of sclerostin is affected by hypoxia. Title: The regulation of sclerostin by cathepsin K in periodontal ...
Cathepsin B. A. 266. Homo sapiens. Mutation(s): 3 Gene Names: CTSB, CPSB. EC: 3.4.22.1. ... Cathepsin B is a papain-like cysteine protease showing both endo- and exopeptidase activity, the latter due to a unique ... Cathepsin B is a papain-like cysteine protease showing both endo- and exopeptidase activity, the latter due to a unique ... The chagasin-cathepsin B complex provides a structural framework for modeling and design of inhibitors for cruzipain, the ...
Cathepsin A (serine protease) Cathepsin B (cysteine protease) Cathepsin C (cysteine protease) Cathepsin D (aspartyl protease) ... Cathepsin H (cysteine protease) Cathepsin K (cysteine protease) Cathepsin L1 (cysteine protease) Cathepsin L2 (or V) (cysteine ... Cathepsin S (cysteine protease) Cathepsin W (cysteine proteinase) Cathepsin Z (or X) (cysteine protease) Cathepsins have been ... Cathepsin K has also been shown to play a role in arthritis. Mouse cathepsin L is homologous to human cathepsin V. Mouse ...
If you know of any papers that use this antibody, please contact us at antibodies [at] alzforum [dot] org for consideration in the References section.. ...
Incubation with the cathepsin L specific inhibitor, Z-FY-DMK, blocked cathepsin L signals, confirming the cathepsin L bands in ... Z-FY-DMK cathepsin L inhibitor does not inhibit all cathepsin activity of murine endometriotic lesions. Incubation with Z-FY- ... DMK, a selective inhibitor of cathepsin L, inhibited many of the cathepsin active bands but did not block all active cathepsin ... E-64 blocks all cathepsin proteolytic activity in murine endometriotic lesions. Incubation with the broad cathepsin inhibitor, ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Cathepsin T (EC 3.4.22.24) is an enzyme. This enzyme catalyses the following chemical reaction Interconversion of the three ... Cathepsin Gohda E, Pitot HC (May 1981). "Purification and characterization of a new thiol proteinase from rat kidney". ... Cathepsin+T at the US National Library of Medicine Medical Subject Headings (MeSH) Biology portal. ... Pitot HC, Gohda E (1987). "Cathepsin T". Methods in Enzymology. 142: 279-89. doi:10.1016/s0076-6879(87)42038-7. PMID 2885716. ...
V. Zavanik-Bergant, A. Sekirnik, R. Golouh, V. Turk, and J. Kos, "Immunochemical localisation of cathepsin S, cathepsin L and ... Both stimulants caused a significant cathepsin S upregulation. A significantly elevated cathepsin S expression in gingival ... Role of Cathepsin S in Periodontal Inflammation and Infection. S. Memmert,1,2 A. Damanaki,1 A. V. B. Nogueira,3 S. Eick,4 M. ... "Antimicrobial peptide LL-37 is both a substrate of cathepsins S and K and a selective inhibitor of cathepsin L," Biochemistry, ...
Cathepsin K degrades both collagen and elastin, and is one of the most powerful proteases. Cathepsin S degrades elastin, and ... "We saw that the cathepsin K was going away much faster when there was cathepsin S present than when it was by itself," said ... "We kept increasing the amount of cathepsin S until the collagen was not affected at all because all of the cathepsin K was ... Barrys modeling suggested that effects observed could occur if cathepsin S were degrading cathepsin K instead of attacking the ...
Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry. Graham Simmons, Dhaval N. Gosalia, ... Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry. Graham Simmons, Dhaval N. Gosalia, ... Cathepsin-L-specific inhibitor blocks infection. (A) MDL28170 inhibits CTSL activity with an IC50 of 2.5 nM. A 1,000-compound ... Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry Message Subject (Your Name) has sent you ...
A direct immunohistochemical method of high specificity is presented for the demonstration of sites of cathepsin B1. Antisera ... Snellman, O.: Cathepsin B, the lysosomal thiol proteinase of calf liver. Biochem. J. 114, 673-678 (1969)Google Scholar ... Otto, K.: Cathepsins B1 and B2. In: Tissue proteinases, ed. by A. J. Barrett and J. T. Dingle, p. 1-28. North-Holland ... V. Cathepsin B as a potential effector of LNA hydrolysis. Histochemie 12, 240-243 (1968)Google Scholar ...
Cathepsin S is a cysteine protease highly expressed in many type of cancers including colorectal, prostate, breast, and ... This mini-review provides an overview of therapeutic antibody targeting Cathepsin S strategies in the last half decade, ... In recent years, antibody research specifically targeting Cathepsin S to block/inhibit tumorigenic effects were generated some ... focusing on the rationale of cell-surface Cathepsin S targeted and their potential clinical application. ...
Rabbit polyclonal Cathepsin E antibody. Validated in WB, IHC, ICC/IF and tested in Mouse, Rat, Human. Cited in 3 publication(s ... Anti-Cathepsin E antibody (ab36996) at 1/1000 dilution + Murine reticulocyte lysate at 10 µg. Predicted band size: 42 kDa. ... High Expression of Cathepsin E in Tissues but Not Blood of Patients with Barretts Esophagus and Adenocarcinoma.. Ann Surg ... Cathepsin E is expressed abundantly in the stomach, Clara cells and alveolar macrophages of the lung, brain microglia, spleen, ...
Rabbit polyclonal Cathepsin D antibody validated for WB, ELISA, IHC, ICC/IF and tested in Human. Referenced in 1 publication ... This antibody reacts with human liver cathepsin D, and does not react with cathepsins B, H and L. ... IHC image of Cathepsin D staining in Human Lung formalin fixed paraffin embedded tissue section, performed on a Leica Bond™ ... Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cathepsin D antibody (ab19555) ...
... administration of rat recombinant cathepsin B and rat recombinant cathepsin L at the same or higher doses than rrCatS had no ... Inhibition of spinal microglial cathepsin S for the reversal of neuropathic pain. Anna K. Clark, Ping K. Yip, John Grist, Clive ... cathepsin S;. rrCatS,. rat recombinant CatS;. LHVS,. morpholinurea-leucine-homophenylalanine-vinyl phenyl sulfone;. PNL,. ... Here, we report that in peripheral nerve-injured rats, the lysosomal cysteine protease cathepsin S (CatS) is critical for the ...
Protease activity Apolipoprotein A-I Aortic valve stenosis Cathepsin S C. Gebhard and F. Maafi contributed equally to this work ... Hooshdaran B, Kolpakov MA, Guo X, Miller SA, Wang T, Tilley DG, Rafiq K, Sabri A (2017) Dual inhibition of cathepsin G and ... Lindstedt L, Lee M, Oorni K, Bromme D, Kovanen PT (2003) Cathepsins F and S block HDL3-induced cholesterol efflux from ... Targeting circulating cathepsin S may lead to new therapies for human aortic valve disease. ...
Cathepsin B. Cathepsin B, EC 3.4.22.1 (APP secretase, APPS) (Cathepsin B1) [Cleaved into: Cathepsin B light chain; Cathepsin B ... Cathepsin BImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a href="/ ... tr,E9PL32,E9PL32_HUMAN Cathepsin B (Fragment) OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=2 ...
Cathepsin GAdd BLAST. ›26. Proteomic databases. PaxDb, a database of protein abundance averages across all three domains of ... sp,P17977,CATG_RAT Cathepsin G (Fragment) OS=Rattus norvegicus GN=Ctsg PE=1 SV=1 IIGGREARPNSHPYMAFLLIQSPEGL ...
Cathepsin G is the serine protease released by neutrophils upon their activation. Cathepsin G is currently being explored as a ... Cathepsins - A class of globular lysosomal proteases. Cathepsins play a vital role in mammalian cellular turnover. There are ... Cathepsin L, a lysosomal endopeptidase, is a member of the papain-like family of cysteine proteinases. It is involved in the ... Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in protein degradation ...
MAGIC RED® CATHEPSIN B KIT. A fluorogenic test kit for Cathepsin B. (Patent# 6,235,493-May 22, 2001). Ref.: 1. Van Noorden, C.J ... MAGIC RED® CATHEPSIN K KIT. A fluorogenic test kit for Cathepsin K. (Patent# 6,235,493-May 22, 2001). Ref.: 1. Van Noorden, C.J ... MAGIC RED® CATHEPSIN L KIT. A fluorogenic test kit for Cathepsin L. (Patent# 6,235,493-May 22, 2001). Ref.: 1. Van Noorden, C.J ...
Cathepsin K Polyclonal Antibody from Invitrogen for Western Blot, Immunohistochemistry (Paraffin) and Flow Cytometry ... Protein Aliases: Cathepsin K; Cathepsin O; cathepsin O1; Cathepsin O2; Cathepsin X; CTSK; CTSO; CTSO2 ... Cite Cathepsin K Polyclonal Antibody. The following antibody was used in this experiment: Cathepsin K Polyclonal Antibody from ...
"Entrez Gene: CTSD cathepsin D".. *↑ Barrett AJ (April 1970). "Cathepsin D. Purification of isoenzymes from human and chicken ... Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes.[3] The main function of cathepsin D is ... The optimum pH for cathepsin D in vitro is 4.5-5.0.[9] Cathepsin-D is an aspartic protease that depends critically on ... Cathepsin D is a protein that in humans is encoded by the CTSD gene.[1][2] This gene encodes a lysosomal aspartyl protease ...
Although a lysosomal, cathepsin B-dependent (Ctsb-dependent) pathway of apoptosis has been described, the contribution of this ...
... Xue Li,1 Zhou Wu,2,3 Junjun Ni,2 ... Fibroblasts are essential for tissue repair due to producing collagens, and lysosomal proteinase cathepsin B (CatB) is involved ...
Distribution of cathepsin L in human umbilical cord tissues.. [Tomasz Gogiel, Małgorzata Wolańska, Zofia Galewska, Piotr ... The active cathepsin L activity (without activation by pepsin digestion), its percentage in the total activity (after pepsin ... Cathepsin L activity and anti-papain inhibitory effect of cysteine protease inhibitors were quantified in extracts of separated ... Cathepsin L is a potent cysteine protease engaged in degradation of extracellular matrix proteins, including collagens. We ...
  • We hypothesize that cysteine cathepsins, a group of powerful extracellular matrix proteases, facilitate endometrial tissue invasion and endometriosis lesion establishment in the peritoneal wall and inhibiting this activity would decrease endometriosis lesion implantation. (nih.gov)
  • Intraperitoneal injection of the broad cysteine cathepsin inhibitor, E-64, significantly reduced the number of attached endometriosis lesions in our murine model compared to vehicle-treated controls demonstrating that cathepsin proteases contribute to endometriosis lesion establishment, and their inhibition may provide a novel, nonhormonal therapy for endometriosis. (nih.gov)
  • Cathepsins are proteases, which are enzymes that are responsible for degrading proteins. (news-medical.net)
  • Dubbed "cathepsin cannibalism," the phenomenon may help explain problems with drugs that have been developed to inhibit the effects of these powerful proteases. (innovations-report.com)
  • Cathepsin K degrades both collagen and elastin, and is one of the most powerful proteases. (innovations-report.com)
  • There is growing recognition that alternative proteolytic enzymes such as the lysosomal cathepsin proteases may initiate or propagate proapoptotic signals, but it is currently unclear how cathepsins mediate apoptosis. (biovision.com)
  • Lysosomes contain many well-characterized proteases, and cathepsin B has previously been utilized to release chemotherapeutics in the context of targetable antibody-based treatments. (bloodjournal.org)
  • SerpinB1 is a potent inhibitor of neutrophil serine proteases neutrophil elastase (NE) and cathepsin G (CG). (bloodjournal.org)
  • 6 , 7 Interestingly, noncaspase cysteine proteases calpain and cathepsin D were reported to induce PMN apoptosis through activation of caspases. (bloodjournal.org)
  • 8 ⇓ ⇓ - 11 In addition, PMNs carry a unique set of serine proteases (neutrophil serine proteases [NSPs]) including elastase (NE), cathepsin G (CG), and proteinase-3 (PR3) stored active in primary granules. (bloodjournal.org)
  • In this review we discuss recent advances addressing the role of lysosomal proteases in the diverse aspects of the immune response, and also the involvement of cathepsins in the pathogenesis of diseases in which these proteases seem not to be properly under control. (smw.ch)
  • Cathepsin B is an ancient family of eukaryotic cysteine proteases. (apsnet.org)
  • Our findings provide evidence for the highly specialized functions of closely related cysteine cathepsin proteases in extra-embryonic development, and reinforce their importance for a successful outcome of pregnancy. (biologists.org)
  • Two of the genes identified from this screen were the cathepsin proteases Cts7 and Cts8 . (biologists.org)
  • Cathepsin cysteine proteases are effectors of invasive growth and angiogenesis during multistage tumorigenesis. (semanticscholar.org)
  • Cathepsins are lysosomal proteases that breakdown peptide bonds linked to specific amino acids. (frontiersin.org)
  • Cathepsin B is the first described member of the family of lysosomal cysteine proteases. (neuromics.com)
  • Here we adopt a novel in silico target fishing method to reveal the target profile of RD. Cathepsin K (Ctsk) is one of the cysteine proteases that is over-expressed in osteoclasts and accounts for the increase in bone resorption in metabolic bone disorders such as postmenopausal osteoporosis. (mdpi.com)
  • Though cytokines and phagocyte, as host factors, have been shown to participate in defence against Aspergillus species yet the role of cysteine proteases, that is cathepsins, a lysosomal enzymes of phagocytes, remains unknown in fungal infection. (ijpsonline.com)
  • Cathepsins are cysteine proteases, act as endopeptidases and are mainly involved in intracellular protein degradation and involved in large number of diseases [ 11 , 12 ]. (ijpsonline.com)
  • Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes . (wikipedia.org)
  • [13] Cathepsin-D is an aspartic protease that depends critically on protonation of its active site Asp residue. (wikipedia.org)
  • Along with Asp-protonation, lower pH also leads to conformational switch in cathepsin-D : the N-terminal segment of the protease moves out of the active site as pH drops. (wikipedia.org)
  • Cathepsin D (an aspartyl protease) appears to cleave a variety of substrates such as fibronectin and laminin. (wikipedia.org)
  • Unlike some of the other cathepsins, cathepsin D has some protease activity at neutral pH. (wikipedia.org)
  • Cathepsin B is a papain-like cysteine protease showing both endo- and exopeptidase activity, the latter due to a unique occluding loop that restricts access to the active site cleft. (rcsb.org)
  • The chagasin-cathepsin B complex provides a structural framework for modeling and design of inhibitors for cruzipain, the parasite cysteine protease and a virulence factor in Chagas disease. (rcsb.org)
  • Cathepsin Protease Inhibition Reduces Endometriosis Lesion Establishment. (nih.gov)
  • All types of cathepsin are classified into three of these protease families. (news-medical.net)
  • Cathepsin S is a cysteine protease and regulator of autophagy with possible involvement in periodontitis. (hindawi.com)
  • The cathepsin S protease is implicated in generation of chronic pain by releasing a cytokine. (sciencemag.org)
  • Here, we report that in peripheral nerve-injured rats, the lysosomal cysteine protease cathepsin S (CatS) is critical for the maintenance of neuropathic pain and spinal microglia activation. (pnas.org)
  • We have recently found that after peripheral nerve injury, the mRNA for the lysosomal cysteine protease cathepsin S (CatS) was up-regulated in the DRG because of CatS expression in infiltrating macrophages ( 5 ). (pnas.org)
  • Cathepsin G is the serine protease released by neutrophils upon their activation. (anaspec.com)
  • Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption. (anaspec.com)
  • The lysosomal cysteine protease, cathepsin S, is increased in Alzheimer's disease and Down syndrome brain: an immunocytochemical study," American Journal of Pathology , vol. 146, no. 4, pp. 848-860, 1995. (hindawi.com)
  • Mutants of Caenorhabditis elegans having about 10% of wild-type activity of the aspartyl protease cathepsin D have been isolated by screening. (genetics.org)
  • Cathepsin L is a potent cysteine protease engaged in degradation of extracellular matrix proteins, including collagens. (sigmaaldrich.com)
  • We evaluated the activity and expression of cathepsin L, and the inhibitory effect of cysteine protease inhibitors in the umbilical cord arteries, vein and Wharton's jelly. (sigmaaldrich.com)
  • Cathepsin L activity and anti-papain inhibitory effect of cysteine protease inhibitors were quantified in extracts of separated umbilical cord tissues using fluorogenic substrates. (sigmaaldrich.com)
  • Cathepsin B kit detects protease activity within whole living cells as a marker of intracellular cathepsin B activity. (sigmaaldrich.com)
  • Cathepsin B, K, and L protease activities can be detected within whole living cells using substrate-based fluorescent assays, which utilize cathepsin target sequence peptides, derivatives of the cresyl violet fluorophore, conjugated to Magic Red™ (MR) fluorogenic substrate (cresyl violet). (sigmaaldrich.com)
  • The lysosomal cysteine protease cathepsin B is thought to play a central role in intrapancreatic trypsinogen activation and the onset of experimental pancreatitis. (sigmaaldrich.com)
  • Cathepsin G (CatG) is a chymotrypsin-like protease released upon degranulation of neutrophils. (mdpi.com)
  • Cathepsin K (CatK) is a lysosomal protease with collagenolytic activity, and its secretion by osteoclasts is responsible for degrading organic bone matrix. (wiley.com)
  • Recent work shows that the cysteine protease cathepsin S (Cat S) is required for the terminal step in CLIP formation in B cells and most dendritic cells (DCs), and in vitro can mediate all steps of digestion of class II-Ii complexes ( 20 , 21 , 22 , 23 , 24 , 25 ). (jimmunol.org)
  • Cathepsin-D (Cat-D) is a lysosomal protease that is present at elevated levels in amyloid plaques and neurons in patients with AD and is also elevated in some cancers. (biomedsearch.com)
  • Serine protease inhibitor serpinB1 protects neutrophils by inhibition of their own azurophil granule protease cathepsin G. (bloodjournal.org)
  • Combined deletion of cathepsin protease family members reveals compensatory mechanisms in cancer. (springer.com)
  • Arampatzidou M, Rehders M, Dauth S, Yu DMT, Tedelind S, Brix K. Imaging of protease functions-current guide to spotting cysteine cathepsins in classical and novel scenes of action in mammalian epithelial cells and tissues. (springer.com)
  • However, we here report an unexpected finding that cysteine protease genes of the family cathepsin B are massively amplified in the lineage of aphids, and that many of the protease genes exhibit gut-specific over-expression. (inria.fr)
  • Cathepsin F is a cysteine protease that plays a role in invariant chain processing and major histocompatibility complex class II peptide loading by macrophages. (neuromics.com)
  • The protease cathepsin D is one such target involved in several diseases such as tumors, degenerative processes, and vital processes of parasites causing schistosomiasis. (ovid.com)
  • Here, we describe how intracellular sigma peptide modulation of RPTPσ induces enhanced protease Cathepsin B activity. (jneurosci.org)
  • Here, we have found that one important mechanism by which peptide modulation of the receptor enhances axon outgrowth is through secretion of a protease, Cathepsin B, which enables digestion of CSPGs. (jneurosci.org)
  • Identification of a human neutrophil angiotension II-generating protease as cathepsin G. J Clin Invest. (umassmed.edu)
  • Cathepsin D is the lysosomal protease in the retinal pigment epithelium which is presumed to be the major enzyme involved in the degradation of shed discs during the photoreceptor renewal process. (arvojournals.org)
  • This antibody is specific for Cathepsin E. (abcam.com)
  • This antibody reacts with human liver cathepsin D, and does not react with cathepsins B, H and L. (abcam.com)
  • The following antibody was used in this experiment: Cathepsin K Polyclonal Antibody from Thermo Fisher Scientific, catalog # PA5-14270, RRID AB_2087668. (thermofisher.com)
  • This antibody reacts with the zymogen as well as the activated form of cathepsin D. It stains fibroblasts and macrophages strongly but stains the myoepithelial cells of breast weakly. (novusbio.com)
  • Cathepsin D Polyclonal antibody specifically detects Cathepsin D in Human, Mouse, Rat samples. (fishersci.com)
  • Cathepsin 6 Monoclonal antibody specifically detects Cathepsin 6 in Mouse samples. (fishersci.com)
  • Over-expression of cathepsin D stimulates tumorigenicity and metastasis as well as initiation of tumor apoptosis. (wikipedia.org)
  • [21] [22] Knock-out of CTSD gene would cause intestinal necrosis and hemorrhage and increase apoptosis in thymus , indicating that cathepsin D is required in certain epithelial cells for tissue remodeling and renewal. (wikipedia.org)
  • Almost all cathepsin activity is found in lysosome organelles, which are a type of organelle responsible for breaking down excess or aging parts of cells and in aiding apoptosis (cell death). (news-medical.net)
  • Although a lysosomal, cathepsin B-dependent (Ctsb-dependent) pathway of apoptosis has been described, the contribution of this pathway to tissue damage remains unclear. (jci.org)
  • Cathepsins are apoptosis markers associated with Alzheimer′s disease, numerous types of cancer, autoimmune arthritis, and the breakdown of bone structure seen with osteoporosis. (sigmaaldrich.com)
  • Schwartz-Roberts, Shajahan, Cook, Wärri, Abu-Asab, Clarke: GX15-070 (obatoclax) induces apoptosis and inhibits cathepsin D- and L-mediated autophagosomal lysis in antiestrogen-resistant breast cancer cells. (antibodies-online.com)
  • This suggests that cathepsin D exerts its apoptosis-stimulating effect upstream of caspase-3-like activation. (diva-portal.org)
  • Cathepsin W is a protein that in humans is encoded by the CTSW gene . (wikipedia.org)
  • Cathepsin D is a protein that in humans is encoded by the CTSD gene . (wikipedia.org)
  • Cathepsin B may function as a beta-secretase 1, cleaving amyloid precursor protein to produce amyloid beta. (wikipedia.org)
  • Osteoclasts are the bone resorbing cells of the body, and they secrete cathepsin K in order to break down collagen, the major component of the non-mineral protein matrix of the bone. (wikipedia.org)
  • To clarify the mode by which natural protein inhibitors manage to overcome this obstacle, we have analyzed the structure and function of cathepsin B in complexes with the Trypanosoma cruzi inhibitor, chagasin. (rcsb.org)
  • Incubation with the broad cathepsin inhibitor, E-64, completely abolished cathepsin activity detected by zymography identifying the active bands as cysteine cathepsins (A). Cathepsin protein levels in lesions were compared to eutopic uterine tissue by Western blot (B, n = 6). (nih.gov)
  • Each cathepsin works to degrade a different protein, and they have different structures and work via different mechanisms. (news-medical.net)
  • Cathepsin S was upregulated most strongly and thus further studied in vitro at gene and protein levels. (hindawi.com)
  • When the researchers combined the two cathepsins and allowed them to attack samples of elastin, they expected to see increased degradation of the protein. (innovations-report.com)
  • Barry's modeling suggested that effects observed could occur if cathepsin S were degrading cathepsin K instead of attacking the elastin - a protein essential in arteries and the cardiovascular system. (innovations-report.com)
  • Cathepsin D is a lysosomal aspartic proteinase, active in intracellular protein breakdown. (anaspec.com)
  • H. Phipps-Yonas, V. Semik, and K. T. Hastings, "GILT expression in B cells diminishes cathepsin S steady-state protein expression and activity," European Journal of Immunology , vol. 43, no. 1, pp. 65-74, 2013. (hindawi.com)
  • Zusätzlich bieten wir Ihnen Cathepsin D Kits (99) und Cathepsin D Proteine (58) und viele weitere Produktgruppen zu diesem Protein an. (antikoerper-online.de)
  • Additionally we are shipping Cathepsin D Antibodies (347) and Cathepsin D Proteins (55) and many more products for this protein. (antibodies-online.com)
  • Cathepsin H is a disulfide-linked heavy and light chain dimer which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. (scbt.com)
  • cathepsin H Inhibitors offered by Santa Cruz inhibit cathepsin H and, in some cases, other cellular metabolism and protein degradation related proteins. (scbt.com)
  • After 4 days of diabetes, cathepsin B and L activities were decreased by 15-45% when correlated with the levels of glomerular protein or DNA. (diabetesjournals.org)
  • Cathepsin D is an estrogen-regulated protein associated with tissue breakdown. (genetex.com)
  • Partially purified Cathepsin B protein was inhibited by a variety of peptide inhibitors but evidence of inhibition by several pathogen-derived inhibitors that are secreted during infection was inconclusive. (bl.uk)
  • Mechanistic studies indicated that the absence of CatL reduced lesion chemokine monocyte chemotactic protein-1 content, macrophage and T-cell in vitro transmigration, and angiogenesis, and altered the expression and activities of matrix metalloproteinases and other cysteinyl cathepsins in inflammatory cells, vascular cells, and AAA lesions. (harvard.edu)
  • Active cathepsins, cathepsin inhibitors and cathepsin antibodies are also available. (biovision.com)
  • 75 Cathepsin S (CTSS) Antibodies from 18 manufacturers are available on www.antibodies-online.com. (antibodies-online.com)
  • On www.antibodies-online.com are 88 Cathepsin D (CTSD) ELISA Kits from 20 different suppliers available. (antibodies-online.com)
  • The main physiological functions of cathepsin D consist of metabolic degradation of intracellular proteins, activation and degradation of polypeptide hormones and growth factors , activation of enzymatic precursors, processing of enzyme activators and inhibitors, brain antigen processing and regulation of programmed cell death . (wikipedia.org)
  • Five cyclic peptides show inhibitory activity towards human cathepsins L, B, H, and K. Zymography is a type of gel electrophoresis that uses a polyacrylamide gel co-polymerized with a substrate in order to detect enzyme activity. (wikipedia.org)
  • Cathepsin T (EC 3.4.22.24) is an enzyme. (wikipedia.org)
  • All cathepsins are made up of a signal peptide, a propeptide, and a mature functional enzyme that is catalytically active. (news-medical.net)
  • The researchers used a variety of tests to determine the amount of each enzyme, including fluorogenic substrate analysis, Western blotting and multiplex cathepsin zymography - a sensitive technique developed in the Platt laboratory. (innovations-report.com)
  • Beyond demonstrating for the first time that cathepsins can attack one another, the research also shows the complexity of the body's enzyme system - and may suggest why drugs designed to inhibit cathepsins haven't worked as intended. (innovations-report.com)
  • Cathepsin D purified from a mutant strain has a lower activity per unit mass of pure enzyme. (genetics.org)
  • The active cathepsin L activity (without activation by pepsin digestion), its percentage in the total activity (after pepsin activation), and the expression of the mature single-chain enzyme were the lowest in the umbilical cord arteries and the highest in Wharton's jelly. (sigmaaldrich.com)
  • A Novel Dual Fluorochrome Near-Infrared Imaging Probe for Potential Alzheimer's Enzyme Biomarkers-BACE1 and Cathepsin D. Molecules. (harvard.edu)
  • As cathepsin D activity is increased by cigarette smoke, the enzyme may contribute to lung tissue damage in smokers. (genetex.com)
  • We offer various assays to detect and quantify cathepsin, calpain and granzyme B activity and screen for respective enzyme inhibitors. (promocell.com)
  • Cathepsin D was released from lysosomes to the cytosol upon exposure to naphthazarin, and the enzyme activity decreased simultaneously. (diva-portal.org)
  • Later, cathepsin D reappeared in granules of increased size, and enzyme activity was restored. (diva-portal.org)
  • Lysosomal serine carboxypeptidase Cathepsin A (CTSA) is a multifunctional enzyme with distinct protective and catalytic function. (frontiersin.org)
  • Herein, we describe the preparation of a fused silica capillary, cathepsin D (CatD)-immobilized enzyme reactor (IMER) using in a multidimensional High Performance Liquid Chromatography-based method (2D-HPLC) and zonal affinity chromatography as an alternative in the search for new ligands. (ovid.com)
  • The prodrug demonstrates enzyme-responsive drug release features, and over 95% GEM was released from the carrier with the Cathepsin B within 3 h. (rsc.org)
  • The presence of a cathepsin B-like enzyme in rabbit ear cartilage was established by the use of the synthetic substrates benzoyl- l -arginine amide and benzoyl- dl -arginine 2-naphthylamide. (biochemj.org)
  • The enzymic properties of cathepsin B in cartilage have been compared with an endogenous enzyme that liberates chondromucopeptide by degrading the cartilage matrix autocatalytically at pH5. (biochemj.org)
  • The experimental evidence indicates that a cathepsin B-like enzyme may be partly responsible for the autolytic degradation of cartilage matrix at pH5. (biochemj.org)
  • It was catalytically active, as demonstrated by active-site-directed radioiodination, and hydrolysed three cathepsin B substrates, two with Km values similar to those of lysosomal cathepsin B. In addition, the rates of inactivation of the sputum and lysosomal forms of the enzyme by L-3-carboxy-2,3-transepoxypropionyl-leucylamido(4-guanidino) butane (Compound E-64) were very similar. (portlandpress.com)
  • However, the sputum enzyme differed from lysosomal cathepsin B in the following respects. (portlandpress.com)
  • Inhibition by chicken cystatin was much weaker for sputum cathepsin B than for the lysosomal enzyme. (portlandpress.com)
  • There were many hurdles in the drug discovery of cathepsin K inhibitors such as species differences not only in bone metabolism but also in amino acid sequences in the critical site of the target enzyme, discrepancies between PK/PD due to unique tissue distribution of the inhibitor affecting both efficacy and side effects originated from a characteristic intracellular or tissue distribution of some classes of compounds. (eurekaselect.com)
  • The cathepsin K inhibitor drug discovery was initiated based on a strong and osteoclast-specific expression of this enzyme. (eurekaselect.com)
  • The data suggest that the higher levels of cathepsin D activity observed in the freshly isolated RPE from the area centralis result from modulators of enzyme activity which are not present in culture. (arvojournals.org)
  • When in the extracellular matrix, cysteine cathepsins, in particular, can degrade the structural components of the ECM, such as collagen or elastin, and contribute to the processing of chemokines, which are molecules that are involved in activating inflammatory immune responses. (news-medical.net)
  • As such, extracellular cysteine cathepsins may be implicated in certain inflammatory diseases such as arthritis or psoriasis and could be important in studying treatments for these types of diseases. (news-medical.net)
  • Cysteine cathepsins belong to the papain-like family C1 of clan CA cysteine peptidases. (nih.gov)
  • Moreover, cysteine cathepsins are active in pericellular environments as soluble enzymes or bound to cell surface receptors at the plasma membrane, and possibly even within secretory vesicles, the cytosol, mitochondria, and within the nuclei of eukaryotic cells. (nih.gov)
  • Proteolytic actions performed by cysteine cathepsins are essential in the maintenance of homeostasis and depend heavily upon their correct sorting and trafficking within cells. (nih.gov)
  • This review focuses upon the transport pathways directing cysteine cathepsins to their points of action and thus emphasizes the broader role and functionality of cysteine cathepsins in a number of specific cellular locales. (nih.gov)
  • This review sought to evaluate recent findings in this field, highlighting how among cathepsins, the inhibition of cathepsin S in particular, could play a significant role in diminishing the effects of CVD, especially for patients with CKD. (frontiersin.org)
  • Spi2A defects were ameliorated by cathepsin-B/L inhibition, and by genetic co-deletion of lysosomal cathepsin B. Pharmacological inhibition of cathepsin B/L enhanced EPO-induced red cell formation in normal mice. (rupress.org)
  • The catalytic sites of cathepsin D include two critical aspartic residues ( amino acid 33 and 231) located on the 14 kDa and 34kDa chains. (wikipedia.org)
  • Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. (anaspec.com)
  • Cathepsins are intracellular proteinases that hydrolyze the peptide bonds of proteins. (oregonstate.edu)
  • Surprisingly, at a concentration of 10 μ m , CA-074 slowly permeated the cells, causing an 80-95% inhibition of intracellular cathepsin B after 12 h, the duration of the invasion assay. (aacrjournals.org)
  • The membrane-permeant cathepsin B inhibitor, CA-074 methyl ester, and the higher concentration of CA-074 that inhibited intracellular cathepsin B both significantly reduced Matrigel invasion. (aacrjournals.org)
  • Collectively, these results identify an intracellular role for cathepsin B in matrix degradation. (aacrjournals.org)
  • These cells were tested in an in vitro Matrigel invasion assay with membrane-permeant and impermeant inhibitors of cathepsin B. The results, which provided direct proof for the participation of cathepsin B in matrix penetration, also yielded the unexpected finding that an intracellular form of cathepsin B was required for Matrigel invasion. (aacrjournals.org)
  • A composite docking approach for the identification and characterization of ectosteric inhibitors of cathepsin K. Law S, et al . (nih.gov)
  • The availability of a purified preparation of salmon muscle cathepsins should stimulate interest and research in the characterization of these enzymes and lead to better means for the control of catheptic activity in fish muscle. (oregonstate.edu)
  • Stroke Traumatic brain injury Alzheimer's disease Arthritis Ebola, Cathepsin B and to a lesser extent cathepsin L have been found to be necessary for the virus to enter host cells. (wikipedia.org)
  • Elevated levels of Cathepsin B were detected in metastases and neurological disorders including Alzheimer's disease (AD). (anaspec.com)
  • Additionally cathepsin D has been associated with amyloid formation in Alzheimer's plaques. (genetex.com)
  • Osteocytes express genes required in osteoclasts for bone resorption, including cathepsin K (Ctsk), and lactation elevates their expression. (jci.org)
  • Cathepsin zymography separates different cathepsins based on their migration through a polyacrylamide gel co-polymerized with a gelatin substrate. (wikipedia.org)
  • The gel is then put into an activation buffer of a specific pH and left to incubate overnight at 37 °C. This activation step allows the cathepsins to degrade the gelatin substrate. (wikipedia.org)
  • Hoechst stain can be used to label the cell nuclei after labeling with the MR-Cathepsin B substrate. (sigmaaldrich.com)
  • BioVision's newly developed Cathepsin Activity Assay kits are fluorescence-based assays that utilize the preferred substrate sequence for each cathepsin, labeled with AFC (amino-4-trifluoromethyl coumarin). (biovision.com)
  • Cell lysates or other samples that contain cathepsins will cleave the synthetic substrate to release free AFC. (biovision.com)
  • Cathepsin F has the substrate specificity similar to that of cathepsins L and S. (neuromics.com)
  • [7] The main function of cathepsin D is to degrade proteins and activate precursors of bioactive proteins in pre-lysosomal compartments. (wikipedia.org)
  • They are classified in these families based on the amino acids present in the proteins that the cathepsins break down. (news-medical.net)
  • Cathepsins play a role in the degradation of proteins, energy metabolism, and the body's immune responses, among other functions. (news-medical.net)
  • Cathepsins break down proteins by cutting the peptide bonds that link amino acids together. (news-medical.net)
  • Cathepsins are important in neurodegenerative diseases as they break down several important proteins. (news-medical.net)
  • Researchers for the first time have shown that members of a family of enzymes known as cathepsins - which are implicated in many disease processes - may attack one another instead of the bodily proteins they normally degrade. (innovations-report.com)
  • Because cathepsins have harmful effects on critical proteins such as collagen and elastin, pharmaceutical companies have been developing drugs to inhibit activity of the enzymes, but so far these compounds have had too many side effects to be useful and have failed clinical trials. (innovations-report.com)
  • Using mass spectrometry analysis of cells treated with a pan cathepsin inhibitor, we observed an increased abundance of proteins involved in central carbon metabolism. (mcponline.org)
  • We further demonstrate that incorporating a cathepsin B-cleavable linker between the BIM BH3 peptide and the hydrophobic tail within individual amphiphiles results in increased binding to recombinant BCL-2 proteins while also allowing for increased cellular uptake and mitochondrial localization leading to faster and more potent dose-dependent cytotoxicity and caspase activation in malignant cells. (bloodjournal.org)
  • Pepstatin A pretreatment did not prevent release of cathepsin D from lysosomes but did significantly inhibit subsequent naphthazarin-induced caspase activation and apoptotic morphology. (diva-portal.org)
  • Lysosomes and lysosomal cathepsins in cell death. (semanticscholar.org)
  • Cathepsins have a vital role in mammalian cellular turnover, e.g. bone resorption. (genenames.org)
  • Cathepsin K is the most potent mammalian collagenase. (wikipedia.org)
  • Cysteinyl cathepsin K (CatK) is one of the most potent mammalian collagenases involved in cardiovascular disease. (ahajournals.org)
  • The collagenolytic activity of cathepsin K is unique among mammalian proteinases. (semanticscholar.org)
  • Human AAA lesions express high levels of cathepsin L (CatL), one of the most potent mammalian elastases. (harvard.edu)
  • It is widely held that invasion is facilitated by a membrane or secreted form of cathepsin B that acts outside the cell to degrade ECM components at or adjacent to the surface of the invading cell. (aacrjournals.org)
  • Sputum cathepsin B had greater stability at pH 7.5 and a higher apparent Mr, even after deglycosylation, than lysosomal cathepsin B. We conclude that the form of cathepsin B found in sputum is probably a truncated form of human procathepsin B, with some differences in properties that could be of physiological importance. (portlandpress.com)
  • Elevated levels of cathepsin H correlates with malignant progression of prostate tumors. (scbt.com)
  • Levels of cathepsin D have been positively correlated with recurring breast cancers of both node negative and node positive types. (genetex.com)
  • Cathepsin K, among other cathepsins, plays a role in cancer metastasis through the degradation of the extracellular matrix. (wikipedia.org)
  • Cathepsin K associates with lymph node metastasis and poor prognosis in oral squamous cell carcinoma. (nih.gov)
  • Elevated Cathepsin K potentiates metastasis of epithelial ovarian cancer. (nih.gov)
  • Cathepsins are involved in disease processes as varied as cancer metastasis, atherosclerosis, cardiovascular disease, osteoporosis and arthritis. (innovations-report.com)
  • Involvement of cathepsins in the invasion, metastasis and proliferation of cancer cells. (wikidoc.org)
  • Cathepsin B is among the candidate proteinases believed to participate in invasion and metastasis. (aacrjournals.org)
  • Besides caspases, cathepsins have recently been shown to be associated with cell death regulation [6-12] and various other physiological and pathological processes, such as maturation of the MHC class II complex, bone remodelling, keratinocyte differentiation, tumour progression and metastasis, rheumatoid arthritis and osteoarthritis, as well as atherosclerosis [13, 14] (table 1). (smw.ch)
  • Auf www.antikoerper-online.de finden Sie aktuell 344 Cathepsin D (CTSD) Antikörper von 36 unterschiedlichen Herstellern. (antikoerper-online.de)
  • The purpose of the research reported herein was to develop procedures for the purification of the cathepsin from salmon muscle. (oregonstate.edu)
  • It was decided to attempt the purification of the cathepsin optimally active at pH 3.7. (oregonstate.edu)
  • The purification was accomplished by extracting the salmon muscle cathepsin with two parts 0.2 N KC1. (oregonstate.edu)
  • The purification of cathepsin D from pig uterus by two-step affinity chromatography on concanavalin A- and pepstatin-Sepharose was described previously [Afting & Becker (1981) Biochem. (biochemj.org)
  • These diseases may also involve the degradation of the extracellular matrix by cathepsins. (news-medical.net)
  • [23] Cathepsin D enzymatic activity induces hydrolytic modification of apolipoprotein B-100-containing lipoproteins, including LDL, which means it may be involved in atherosclerosis as well. (wikipedia.org)
  • The cathepsin A activity in lysates of metastatic lesions of malignant melanoma is significantly higher than in primary focus lysates. (wikipedia.org)
  • oxLDL inhibits differentiation and functional activity of osteoclasts via scavenger receptor-A mediated autophagy and cathepsin K secretion. (nih.gov)
  • Human endometriosis lesions also exhibited greater cathepsin activity than adjacent peritoneum tissue, supporting the mouse results. (nih.gov)
  • Finally, we tested the hypothesis that inhibiting cathepsin activity could block endometriosis lesion attachment and implantation in vivo. (nih.gov)
  • Mouse endometriotic lesions exhibit elevated cathepsin proteolytic activity. (nih.gov)
  • E-64 blocks all cathepsin proteolytic activity in murine endometriotic lesions. (nih.gov)
  • Dysregulated cathepsin synthesis and activity have been seen in several diseases, rheumatoid arthritis, cancer, and inflammatory neurological diseases. (news-medical.net)
  • Dysregulated cathepsin activity can result in the overexpression (over-activity) of the cathepsins and cause them to be secreted outside of cells. (news-medical.net)
  • The work could affect not only the development of drugs to inhibit cathepsin activity, but could also lead to a better understanding of how the enzymes work together. (innovations-report.com)
  • By increasing the amount of cathepsin S ten-fold over the amount used in the original experiment, Platt and Barry were able to completely block the activity of cathepsin K, preventing damage to the collagen sample. (innovations-report.com)
  • Platt's long-term research has focused on cathepsins, including the development of sensitive tools and assays to quantify their activity in cells and tissue, as well as potential diagnostic applications for breast, lung and cervical cancer. (innovations-report.com)
  • The selective demonstration of cathepsin B activity by means of the naphthylamide reaction. (springer.com)
  • Distribution of the activity and expression of mature cathepsin L within the umbilical cord probably results from distinctions in the proenzyme activation process. (sigmaaldrich.com)
  • In the assay (z-Arginine-Arginine) 2 (z-RR) 2 derivative of the cresyl violet fluorophore easily penetrates the cell membrane and the membranes of the internal cellular organelles enabling to detect cathepsin B activity within whole living cells. (sigmaaldrich.com)
  • Here we report that loss of cathepsin L (Cts L) is associated with a fast proliferation rate and enhanced glycolytic metabolism that depend on lactate dehydrogenase A (LDHA) activity. (mcponline.org)
  • Transient expression of human cathepsin B in a poorly metastatic B16F1 murine melanoma variant produced a 3-5-fold increase in cathepsin B activity and a comparable increase in invasiveness. (aacrjournals.org)
  • For measuring cathepsin B activity by fluorometer or fluorescence plate reader. (promocell.com)
  • This project aims to examine the utility of the proteolytic activity signatures of caspase 1 and cathepsin S (CTSS) as readouts of particle-induced inflammation and to elucidate the role and dynamic regulation of CTSS in response to cellular stress. (bl.uk)
  • Dariusz Szajda S, Jankowski M, Zalewska B, Kożuszko B, Gabrylewski W, Skrzydlewski Z. Activity of cancer procoagulant and cathepsin D in breast cancer. (termedia.pl)
  • Immunohistochemical investigations on cathepsin D activity in structures of cholesteatoma. (medscimonit.com)
  • The aim of the present study was to evaluate the activity of cathepsin D in the structures of cholesteatoma. (medscimonit.com)
  • Results: Cathepsin D demonstrates high activity in perimatrix cells adjacent to bone tissue, while it occurs in trace amounts in the matrix. (medscimonit.com)
  • BACKGROUND: Serum cathepsin B activity has been considered a potential marker of tumor progression. (lu.se)
  • The aim of this study was to assess serum cathepsin activity during tumor progression and regression. (lu.se)
  • Serum cathepsin B activity was determined, tumor volumes were measured, and. (lu.se)
  • RESULTS: Of the 45 BRT-treated rats, tumor regression was observed in 31 rats, and serum cathepsin activity was analyzed in these rats. (lu.se)
  • The activity profiles of four cathepsins in the kidney and liver tissue were analysed and correlated with blood cytokines level in the presence and absence of antifungal compounds (amphotericin B, a standard drug and 2-(3,4-dimethyl-2,5-dihydro-1H-pyrrole-2-yl)-1-methylethyl pentanoate, isolated in our laboratory from natural source) treatment. (ijpsonline.com)
  • Regional comparisons of cathepsin D activity in bovine retinal pigment epithelium. (arvojournals.org)
  • In this study, the cathepsin D activity in RPE cells from the posterior area centralis was compared to the activity in cells from the equatorial region of the same bovine eyes. (arvojournals.org)
  • Analysis of freshly isolated RPE cells from 30 eyes indicated that cells from the area centralis have significantly higher cathepsin D activity than cells from the more peripheral retina. (arvojournals.org)
  • There are, however, exceptions such as cathepsin K, which works extracellularly after secretion by osteoclasts in bone resorption. (genenames.org)
  • Cathepsin K is involved in osteoporosis, a disease in which a decrease in bone density causes an increased risk for fracture. (wikipedia.org)
  • Arkona C, Wiederanders B. Expression, subcellular distribution and plasma membrane binding of cathepsin B and gelatinases in bone metastatic tissue. (springer.com)
  • Impaired osteoclastic bone resorption leads to osteopetrosis in cathepsin-K-deficient mice. (semanticscholar.org)
  • Conclusions: Cathepsin D places a major role in bone tissue destruction due to cholesteatoma. (medscimonit.com)
  • Genomic structure, chromosomal localization, and expression of human cathepsin W". Biochem Biophys Res Commun . (wikipedia.org)
  • CTSZ, which has been also known as cathepsin X and cathepsin P, exhibits carboxy-monopeptidase and carboxy-dipeptidase activities. (prospecbio.com)
  • Leukocyte cathepsin S is a potent regulator of both cell and matrix turnover in advanced atherosclerosis," Arteriosclerosis, Thrombosis, and Vascular Biology , vol. 29, no. 2, pp. 188-194, 2009. (hindawi.com)
  • Novel, Nonpeptidic Cyanamides as Potent and Reversible Inhibitors of Human Cathepsins K and L, J. Med. (patentgenius.com)
  • In particular, no defects in granulopoiesis or PMN homeostasis have been reported in mice deficient in cathepsin G ( CG −/− ), 15 neutrophil elastase ( NE −/− ), 16 , 17 or dipeptidylpeptidase I ( DPPI −/− ), which lack active NSPs. (bloodjournal.org)
  • Neutrophil cathepsin G increases calcium flux and inositol polyphosphate production in cultured endothelial cells. (jimmunol.org)
  • Exposure of endothelial cells (ENDO) to human neutrophil cathepsin G (CG) increases albumin flux across the endothelial monolayer. (jimmunol.org)
  • Identification of a putative structural gene for cathepsin D in Caenorhabditis elegans. (genetics.org)
  • These data suggest that cad-1 is a structural gene for cathepsin D. (genetics.org)
  • These results suggest that the ecdysone response elements are vital for activation of the promoter by 20-hydroxyecdysone (20E) in the larval fat body and further support the crucial role of ecdysone signaling to control cathepsin D gene transcription. (antibodies-online.com)
  • By making use of EST data, sequenced cDNAs, and genomic trace sequences of the pea aphid Acyrthosiphon pisum, we identified a total of 28 cathepsin B-like gene copies in the genome of A. pisum. (inria.fr)
  • In addition, this work also implicates Cathepsin B genes in senescence, a developmental form of PCD, via regulation of the senescence marker gene Senescence Associated Gene 12 ( SAG12 ). (bl.uk)
  • Fluorometric kit to for fast screening of potential cathepsin B (CTSB) inhibitors. (promocell.com)
  • Cathepsin L-deficient mice were shown to have less adipose tissue, lower serum glucose and insulin levels, more insulin receptor subunits, more glucose transporter (GLUT4) and more fibronectin than wild type controls. (wikipedia.org)
  • To test this, we used an immunocompetent endometriosis mouse model and found that endometriotic lesions exhibited a greater than 5-fold increase in active cathepsins compared to tissue from peritoneal wall or eutopic endometrium, with cathepsins L and K specifically implicated. (nih.gov)
  • Keilová, H.: On the specificity and inhibition of cathepsins D and B. In: Tissue proteinases, ed. by A. J. Barrett and J. T. Dingle, p. 45-65. (springer.com)
  • IHC image of Cathepsin D staining in Human Lung formalin fixed paraffin embedded tissue section, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. (abcam.com)
  • Weight loss reduces adipose tissue cathepsin S and its circulating levels in morbidly obese women," Journal of Clinical Endocrinology and Metabolism , vol. 91, no. 3, pp. 1042-1047, 2006. (hindawi.com)
  • Cathepsin F staining of paraffin-embedded human heart tissue sections. (neuromics.com)
  • Phylogenetic analyses of all the cathepsin B genes in aphids revealed that genic expansion has continuously proceeded with basal, intermediary and recent duplications. (inria.fr)
  • Cathepsin B has also been implicated in the progression of various human tumors including ovarian cancer. (wikipedia.org)
  • Cathepsin B is a lysosomal cysteine proteinase whose expression and trafficking are frequently altered in cancer, and plasma membrane and secreted forms are thought to contribute to the invasive and metastatic properties of malignant tumors. (aacrjournals.org)
  • Cathepsin L , a lysosomal endopeptidase, is a member of the papain-like family of cysteine proteinases. (anaspec.com)
  • A cell-permeable inhibitor of calpain I, calpain II, cathepsin B, and cathepsin L. (promocell.com)
  • A cell-permeable inhibitor of calpain 1, calpain 2 which also inhibits cathepsin B, and cathepsin L. (promocell.com)
  • The genetic knockout for cathepsin S and K in mice with atherosclerosis was shown to reduce the size of atherosclerotic lesions. (wikipedia.org)
  • Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases. (anaspec.com)
  • More importantly, cathepsins play a crucial role in various conditions that involve large biological systems such as autoimmune disease, cardiac repair, cardiomyopathy, heart valve disease, and atherosclerosis. (frontiersin.org)
  • Cathepsin-Z (CTSZ) is a lysosomal cysteine proteinase and member of the peptidase C1 family. (prospecbio.com)
  • Cathepsin K is a recently identified lysosomal cysteine proteinase. (semanticscholar.org)
  • For instance, cathepsins have been found to degrade low-density lipoprotein (LDL-P) and reduce the effect of cholesterol leaving macrophages. (news-medical.net)
  • We saw that the cathepsin K was going away much faster when there was cathepsin S present than when it was by itself," said Platt, who is also a Georgia Cancer Coalition Distinguished Scholar and a Fellow of the Keystone Symposia on Molecular and Cellular Biology. (innovations-report.com)
  • Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms. (anaspec.com)
  • Targeting cathepsin S induces tumor cell autophagy via the EGFR-ERK signaling pathway," Cancer Letters , vol. 317, no. 1, pp. 89-98, 2012. (hindawi.com)
  • p53, cathepsin D, Bcl-2 are joint prognostic indicators of breast cancer metastatic spreading. (harvard.edu)
  • CONCLUSIONS: Cathepsin B may play an important role, not only in tumor expansion, but also during the processes of cancer cell death and resorption. (lu.se)
  • The area of contact is slightly larger than in chagasin complexes with the endopeptidase, cathepsin L. However, residues important for high affinity to both enzymes are mainly found in the outer loops L4 and L6 of chagasin. (rcsb.org)
  • Cathepsin B possesses both endopeptidase and exopeptidase activities, in the latter case acting as a peptidyl-dipeptidase. (neuromics.com)
  • Essential role for cathepsin S in MHC class II-associated invariant chain processing and peptide loading," Immunity , vol. 4, no. 4, pp. 357-366, 1996. (hindawi.com)
  • A direct immunohistochemical method of high specificity is presented for the demonstration of sites of cathepsin B1. (springer.com)
  • In this review we cover specific roles of cathepsins in innate and adaptive immunity, as well as their implication in the pathogenesis of several diseases. (smw.ch)
  • It is of note to mention that this review is not meant to comprehensively cover the present literature on viruses encountering cathepsins but rather illustrates, on some representative examples, the possible roles of cathepsins in replication of viruses and in the course of disease. (springer.com)
  • These data strongly suggest that decreases in the lysosomal cathepsin activities may contribute to IDDM-induced glomerular cellular hypertrophy. (diabetesjournals.org)
  • Moreover, cytosolic and nuclear forms of cathepsins have been described and are currently an emerging field of research aiming at understanding their functions in such unexpected cellular locations. (springer.com)
  • Gingival biopsies from periodontitis patients showed a significantly higher cathepsin S expression than those from healthy gingiva. (hindawi.com)