Carboxylic Ester Hydrolases: Enzymes which catalyze the hydrolysis of carboxylic acid esters with the formation of an alcohol and a carboxylic acid anion.EstersSterol Esterase: An enzyme that catalyzes the hydrolysis of CHOLESTEROL ESTERS and some other sterol esters, to liberate cholesterol plus a fatty acid anion.Hydrolases: Any member of the class of enzymes that catalyze the cleavage of the substrate and the addition of water to the resulting molecules, e.g., ESTERASES, glycosidases (GLYCOSIDE HYDROLASES), lipases, NUCLEOTIDASES, peptidases (PEPTIDE HYDROLASES), and phosphatases (PHOSPHORIC MONOESTER HYDROLASES). EC 3.Carboxylic Acids: Organic compounds containing the carboxy group (-COOH). This group of compounds includes amino acids and fatty acids. Carboxylic acids can be saturated, unsaturated, or aromatic.Glycoside HydrolasesPhospholipases A2: Phospholipases that hydrolyze the acyl group attached to the 2-position of PHOSPHOGLYCERIDES.Phospholipases A: Phospholipases that hydrolyze one of the acyl groups of phosphoglycerides or glycerophosphatidates.Pancreas: A nodular organ in the ABDOMEN that contains a mixture of ENDOCRINE GLANDS and EXOCRINE GLANDS. The small endocrine portion consists of the ISLETS OF LANGERHANS secreting a number of hormones into the blood stream. The large exocrine portion (EXOCRINE PANCREAS) is a compound acinar gland that secretes several digestive enzymes into the pancreatic ductal system that empties into the DUODENUM.Phospholipases: A class of enzymes that catalyze the hydrolysis of phosphoglycerides or glycerophosphatidates. EC 3.1.-.Platelet Activating Factor: A phospholipid derivative formed by PLATELETS; BASOPHILS; NEUTROPHILS; MONOCYTES; and MACROPHAGES. It is a potent platelet aggregating agent and inducer of systemic anaphylactic symptoms, including HYPOTENSION; THROMBOCYTOPENIA; NEUTROPENIA; and BRONCHOCONSTRICTION.Group X Phospholipases A2: A secreted phospholipase A2 subtype that contains a interfacial-binding region with specificity for PHOSPHATIDYLCHOLINE. This enzyme group may play a role in eliciting ARACHIDONIC ACID release from intact cellular membranes and from LOW DENSITY LIPOPROTEINS. Members of this group bind specifically to PHOSPHOLIPASE A2 RECEPTORS.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Crystallography, X-Ray: The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Liposomes: Artificial, single or multilaminar vesicles (made from lecithins or other lipids) that are used for the delivery of a variety of biological molecules or molecular complexes to cells, for example, drug delivery and gene transfer. They are also used to study membranes and membrane proteins.Immunoassay: A technique using antibodies for identifying or quantifying a substance. Usually the substance being studied serves as antigen both in antibody production and in measurement of antibody by the test substance.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Antigen-Antibody Complex: The complex formed by the binding of antigen and antibody molecules. The deposition of large antigen-antibody complexes leading to tissue damage causes IMMUNE COMPLEX DISEASES.Patents as Topic: Exclusive legal rights or privileges applied to inventions, plants, etc.Acute-Phase Reaction: An early local inflammatory reaction to insult or injury that consists of fever, an increase in inflammatory humoral factors, and an increased synthesis by hepatocytes of a number of proteins or glycoproteins usually found in the plasma.Complement System Proteins: Serum glycoproteins participating in the host defense mechanism of COMPLEMENT ACTIVATION that creates the COMPLEMENT MEMBRANE ATTACK COMPLEX. Included are glycoproteins in the various pathways of complement activation (CLASSICAL COMPLEMENT PATHWAY; ALTERNATIVE COMPLEMENT PATHWAY; and LECTIN COMPLEMENT PATHWAY).Amaranth Dye: A sulfonic acid-based naphthylazo dye used as a coloring agent for foodstuffs and medicines and as a dye and chemical indicator. It was banned by the FDA in 1976 for use in foods, drugs, and cosmetics. (From Merck Index, 11th ed)Autistic Disorder: A disorder beginning in childhood. It is marked by the presence of markedly abnormal or impaired development in social interaction and communication and a markedly restricted repertoire of activity and interest. Manifestations of the disorder vary greatly depending on the developmental level and chronological age of the individual. (DSM-V)Caenorhabditis elegans Proteins: Proteins from the nematode species CAENORHABDITIS ELEGANS. The proteins from this species are the subject of scientific interest in the area of multicellular organism MORPHOGENESIS.Caenorhabditis elegans: A species of nematode that is widely used in biological, biochemical, and genetic studies.Aedes: A genus of mosquitoes (CULICIDAE) frequently found in tropical and subtropical regions. YELLOW FEVER and DENGUE are two of the diseases that can be transmitted by species of this genus.Butterflies: Slender-bodies diurnal insects having large, broad wings often strikingly colored and patterned.Genitalia, Female: The female reproductive organs. The external organs include the VULVA; BARTHOLIN'S GLANDS; and CLITORIS. The internal organs include the VAGINA; UTERUS; OVARY; and FALLOPIAN TUBES.Drosophila melanogaster: A species of fruit fly much used in genetics because of the large size of its chromosomes.Drosophila: A genus of small, two-winged flies containing approximately 900 described species. These organisms are the most extensively studied of all genera from the standpoint of genetics and cytology.EsterasesGenitalia, Male: The male reproductive organs. They are divided into the external organs (PENIS; SCROTUM;and URETHRA) and the internal organs (TESTIS; EPIDIDYMIS; VAS DEFERENS; SEMINAL VESICLES; EJACULATORY DUCTS; PROSTATE; and BULBOURETHRAL GLANDS).Drosophila Proteins: Proteins that originate from insect species belonging to the genus DROSOPHILA. The proteins from the most intensely studied species of Drosophila, DROSOPHILA MELANOGASTER, are the subject of much interest in the area of MORPHOGENESIS and development.Carboxylesterase: Carboxylesterase is a serine-dependent esterase with wide substrate specificity. The enzyme is involved in the detoxification of XENOBIOTICS and the activation of ester and of amide PRODRUGS.Cholesterol Esters: Fatty acid esters of cholesterol which constitute about two-thirds of the cholesterol in the plasma. The accumulation of cholesterol esters in the arterial intima is a characteristic feature of atherosclerosis.Serine Proteases: Peptide hydrolases that contain at the active site a SERINE residue involved in catalysis.Foam Cells: Lipid-laden macrophages originating from monocytes or from smooth muscle cells.Search Engine: Software used to locate data or information stored in machine-readable form locally or at a distance such as an INTERNET site.Databases, Genetic: Databases devoted to knowledge about specific genes and gene products.Cholesterol: The principal sterol of all higher animals, distributed in body tissues, especially the brain and spinal cord, and in animal fats and oils.Cholic Acid: A major primary bile acid produced in the liver and usually conjugated with glycine or taurine. It facilitates fat absorption and cholesterol excretion.Cholic Acids: The 3 alpha,7 alpha,12 alpha-trihydroxy-5 beta-cholanic acid family of bile acids in man, usually conjugated with glycine or taurine. They act as detergents to solubilize fats for intestinal absorption, are reabsorbed by the small intestine, and are used as cholagogues and choleretics.ATP Binding Cassette Transporter 1: A superfamily of large integral ATP-binding cassette membrane proteins whose expression pattern is consistent with a role in lipid (cholesterol) efflux. It is implicated in TANGIER DISEASE characterized by accumulation of cholesteryl ester in various tissues.Bile Acids and Salts: Steroid acids and salts. The primary bile acids are derived from cholesterol in the liver and usually conjugated with glycine or taurine. The secondary bile acids are further modified by bacteria in the intestine. They play an important role in the digestion and absorption of fat. They have also been used pharmacologically, especially in the treatment of gallstones.Orphan Nuclear Receptors: A broad category of receptor-like proteins that may play a role in transcriptional-regulation in the CELL NUCLEUS. Many of these proteins are similar in structure to known NUCLEAR RECEPTORS but appear to lack a functional ligand-binding domain, while in other cases the specific ligands have yet to be identified.Sterol Regulatory Element Binding Protein 1: A sterol regulatory element binding protein that regulates expression of GENES involved in FATTY ACIDS metabolism and LIPOGENESIS. Two major isoforms of the protein exist due to ALTERNATIVE SPLICING.Lactobacillus: A genus of gram-positive, microaerophilic, rod-shaped bacteria occurring widely in nature. Its species are also part of the many normal flora of the mouth, intestinal tract, and vagina of many mammals, including humans. Pathogenicity from this genus is rare.Probiotics: Live microbial DIETARY SUPPLEMENTS which beneficially affect the host animal by improving its intestinal microbial balance. Antibiotics and other related compounds are not included in this definition. In humans, lactobacilli are commonly used as probiotics, either as single species or in mixed culture with other bacteria. Other genera that have been used are bifidobacteria and streptococci. (J. Nutr. 1995;125:1401-12)T-Lymphocytes: Lymphocytes responsible for cell-mediated immunity. Two types have been identified - cytotoxic (T-LYMPHOCYTES, CYTOTOXIC) and helper T-lymphocytes (T-LYMPHOCYTES, HELPER-INDUCER). They are formed when lymphocytes circulate through the THYMUS GLAND and differentiate to thymocytes. When exposed to an antigen, they divide rapidly and produce large numbers of new T cells sensitized to that antigen.Hypersensitivity: Altered reactivity to an antigen, which can result in pathologic reactions upon subsequent exposure to that particular antigen.Tetanus ToxoidLactobacillus casei: A rod-shaped bacterium isolated from milk and cheese, dairy products and dairy environments, sour dough, cow dung, silage, and human mouth, human intestinal contents and stools, and the human vagina.Lactobacillus rhamnosus: A species of gram-positive, rod-shaped bacteria used in PROBIOTICS.

Genetic polymorphism and interethnic variability of plasma paroxonase activity. (1/1703)

A method for determining plasma paroxonase activity using an auto-analyser is described. Frequency distributions for British and Indian subjects show bimodality. A study of 40 British families confirms the presence of a genetic polymorphism with regard to plasma paroxonase activity. Two phenotypes can be defined, controlled by two alleles at one autosomal locus. The frequency of the low activity phenotype is less in the Indian population than in the British population. Malay, Chinese, and African subjects fail to show obvious bimodality.  (+info)

Comparison of two in vitro activation systems for protoxicant organophosphorous esterase inhibitors. (2/1703)

In order to perform in vitro testing of esterase inhibition caused by organophosphorous (OP) protoxicants, simple, reliable methods are needed to convert protoxicants to their esterase-inhibiting forms. Incubation of parathion or chlorpyrifos with 0.05% bromine solution or uninduced rat liver microsomes (RLM) resulted in production of the corresponding oxygen analogs of these OP compounds and markedly increased esterase inhibition in SH-SY5Y human neuroblastoma cells. Neither activation system affected cell viability or the activity of AChE or NTE in the absence of OP compounds. Although parathion and chlorpyrifos were activated by RLM, bromine activation required fewer steps and produced more esterase inhibition for a given concentration of chlorpyrifos. However, RLM activation of OP protoxicants produced metabolites other than oxygen analogs and may, therefore, be more relevant as a surrogate for OP biotransformation in vivo. This methodology makes the use of intact cells for in vitro testing of esterase inhibition caused by protoxicant organophosphate compounds a viable alternative to in vivo tests.  (+info)

Inhibition of translation and cell growth by minigene expression. (3/1703)

A random five-codon gene library was used to isolate minigenes whose expression causes cell growth arrest. Eight different deleterious minigenes were isolated, five of which had in-frame stop codons; the predicted expressed peptides ranged in size from two to five amino acids. Mutational analysis demonstrated that translation of the inhibitory minigenes is essential for growth arrest. Pulse-labeling experiments showed that expression of at least some of the selected minigenes results in inhibition of cellular protein synthesis. Expression of the deleterious minigenes in cells deficient in peptidyl-tRNA hydrolase causes accumulation of families of peptidyl-tRNAs corresponding to the last minigene codon; the inhibitory action of minigene expression could be suppressed by overexpression of the tRNA corresponding to the last sense codon in the minigene. Experimental data are compatible with the model that the deleterious effect of minigene expression is mediated by depletion of corresponding pools of free tRNAs.  (+info)

Pectin methylesterase gene (pmeA) from Aspergillus oryzae KBN616: its sequence analysis and overexpression, and characterization of the gene product. (4/1703)

A gene (pmeA) encoding pectin methylesterase was isolated from a shoyu koji mold, Aspergillus oryzae KBN616, and characterized. The structural gene comprised 1,370 bp with six introns. The PMEA protein consisted of 331 amino acids with a putative signal peptide of 17 amino acids. The deduced amino acid sequence was very similar to those of Aspergillus niger PMEA and Aspergillus aculeatus PME1. The pmeA gene was efficiently expressed under control of the A. oryzae TEF1 gene promoter for purification and characterization of the ezymatic properties. PMEA had a molecular mass of 38.5 kDa, a pH optimum of 5.0, and a temperature optimum of 55 degrees C.  (+info)

Localization of a candidate surfactant convertase to type II cells, macrophages, and surfactant subfractions. (5/1703)

Pulmonary surfactant exists in the alveolus in several distinct subtypes that differ in their morphology, composition, and surface activity. Experiments by others have implicated a serine hydrolase in the production of the inactive small vesicular subtype of surfactant (N. J. Gross and R. M. Schultz. Biochim. Biophys. Acta 1044: 222-230, 1990). Our laboratory recently identified this enzyme in the rat as the serine carboxylesterase ES-2 [F. Barr, H. Clark, and S. Hawgood. Am. J. Physiol. 274 (Lung Cell. Mol. Physiol. 18): L404-L410, 1998]. In the present study, we determined the cellular sites of expression of ES-2 in rat lung using a digoxygenin-labeled ES-2 riboprobe. ES-2 mRNA was localized to type II cells and alveolar macrophages but not to Clara cells. Using a specific ES-2 antibody, we determined the protein distribution of ES-2 in the lung by immunohistochemistry, and it was found to be consistent with the sites of mRNA expression. Most of the ES-2 in rat bronchoalveolar lavage is in the surfactant-depleted supernatant, but ES-2 was also consistently localized to the small vesicular surfactant subfraction presumed to form as a consequence of conversion activity. These results are consistent with a role for endogenous lung ES-2 in surfactant metabolism.  (+info)

Preferential release of 11-cis-retinol from retinal pigment epithelial cells in the presence of cellular retinaldehyde-binding protein. (6/1703)

In photoreceptor cells of the retina, photoisomerization of 11-cis-retinal to all-trans-retinal triggers phototransduction. Regeneration of 11-cis-retinal proceeds via a complex set of reactions in photoreceptors and in adjacent retinal pigment epithelial cells where all-trans-retinol is isomerized to 11-cis-retinol. Our results show that isomerization in vitro only occurs in the presence of apo-cellular retinaldehyde-binding protein. This retinoid-binding protein may drive the reaction by mass action, overcoming the thermodynamically unfavorable isomerization. Furthermore, this 11-cis-retinol/11-cis-retinal-specific binding protein potently stimulates hydrolysis of endogenous 11-cis-retinyl esters but has no effect on hydrolysis of all-trans-retinyl esters. Apo-cellular retinaldehyde-binding protein probably exerts its effect by trapping the 11-cis-retinol product. When retinoid-depleted retinal pigment epithelial microsomes were preincubated with different amounts of all-trans-retinol to form all-trans-retinyl esters and then [3H]all-trans-retinol was added, as predicted, the specific radioactivity of [3H]all-trans-retinyl esters increased during subsequent reaction. However, the specific radioactivity of newly formed 11-cis-retinol stayed constant during the course of the reaction, and it was largely unaffected by expansion of the all-trans-retinyl ester pool during the preincubation. The absence of dilution establishes that most of the ester pool does not participate in isomerization, which in turn suggests that a retinoid intermediate other than all-trans-retinyl ester is on the isomerization reaction pathway.  (+info)

Production of poly(3-hydroxybutyric acid-co-4-hydroxybutyric acid) and poly(4-hydroxybutyric acid) without subsequent degradation by Hydrogenophaga pseudoflava. (7/1703)

A Hydrogenophaga pseudoflava strain was able to synthesize poly(3-hydroxybutyric acid-co-4-hydroxybutyric acid) [P(3HB-co-4HB)] having a high level of 4-hydroxybutyric acid monomer unit (4HB) from gamma-butyrolactone. In a two-step process in which the first step involved production of cells containing a minimum amount of poly(3-hydroxybutyric acid) [P(3HB)] and the second step involved polyester accumulation from the lactone, approximately 5 to 10 mol% of the 3-hydroxybutyric acid (3HB) derived from the first-step culture was unavoidably reincorporated into the polymer in the second cultivation step. Reincorporation of the 3HB units produced from degradation of the first-step residual P(3HB) was confirmed by high-resolution 13C nuclear magnetic resonance spectroscopy. In order to synthesize 3HB-free poly(4-hydroxybutyric acid) [P(4HB)] homopolymer, a three-stage cultivation technique was developed by adding a nitrogen addition step, which completely removed the residual P(3HB). The resulting polymer was free of 3HB. However, when the strain was grown on gamma-butyrolactone as the sole carbon source in a synthesis medium, a copolyester of P(3HB-co-4HB) containing 45 mol% 3HB was produced. One-step cultivation on gamma-butyrolactone required a rather long induction time (3 to 4 days). On the basis of the results of an enzymatic study performed with crude extracts, we suggest that the inability of cells to produce 3HB in the multistep culture was due to a low level of 4-hydroxybutyric acid (4HBA) dehydrogenase activity, which resulted in a low level of acetyl coenzyme A. Thus, 3HB formation from gamma-butyrolactone is driven by a high level of 4HBA dehydrogenase activity induced by long exposure to gamma-butyrolactone, as is the case for a one-step culture. In addition, intracellular degradation kinetics studies showed that P(3HB) in cells was completely degraded within 30 h of cultivation after being transferred to a carbon-free mineral medium containing additional ammonium sulfate, while P(3HB-co-4HB) containing 5 mol% 3HB and 95 mol% 4HB was totally inert in interactions with the intracellular depolymerases. Intracellular inertness could be a useful factor for efficient synthesis of the P(4HB) homopolymer and of 4HB-rich P(3HB-co-4HB) by the strain used in this study.  (+info)

Relationship between succinate transport and production of extracellular poly(3-hydroxybutyrate) depolymerase in Pseudomonas lemoignei. (8/1703)

The relationship between extracellular poly(3-hydroxybutyrate) (PHB) depolymerase synthesis and the unusual properties of a succinate uptake system was investigated in Pseudomonas lemoignei. Growth on and uptake of succinate were highly pH dependent, with optima at pH 5.6. Above pH 7, growth on and uptake of succinate were strongly reduced with concomitant derepression of PHB depolymerase synthesis. The specific succinate uptake rates were saturable by high concentrations of succinate, and maximal transport rates of 110 nmol/mg of cell protein per min were determined between pH 5.6 and 6. 8. The apparent KS0.5 values increased with increasing pH from 0.2 mM succinate at pH 5.6 to more than 10 mM succinate at pH 7.6. The uptake of [14C]succinate was strongly inhibited by several monocarboxylates. Dicarboxylates also inhibited the uptake of succinate but only at pH values near the dissociation constant of the second carboxylate function (pKa2). We conclude that the succinate carrier is specific for the monocarboxylate forms of various carboxylic acids and is not able to utilize the dicarboxylic forms. The inability to take up succinate2- accounts for the carbon starvation of P. lemoignei observed during growth on succinate at pH values above 7. As a consequence the bacteria produce high levels of extracellular PHB depolymerase activity in an effort to escape carbon starvation by utilization of PHB hydrolysis products.  (+info)

*Wax-ester hydrolase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... In enzymology, a wax-ester hydrolase (EC 3.1.1.50) is an enzyme that catalyzes the chemical reaction a wax ester + H2O ⇌ {\ ... Huang AH, Moreau RA, Liu KD (1978). "Development and properties of a wax ester hydrolase in the cotyledons of jojoba seedlings ... Moreau RA; Huang AHC (1981). "Enzymes of wax ester catabolism in jojoba; Chapter: [93] Enzymes of wax ester catabolism in ...

*4-methyloxaloacetate esterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... the two substrates of this enzyme are oxaloacetate 4-methyl ester and H2O, whereas its two products are oxaloacetate and ... is an enzyme that catalyzes the chemical reaction oxaloacetate 4-methyl ester + H2O ⇌ {\displaystyle \rightleftharpoons } ... this enzyme class is oxaloacetate-4-methyl-ester oxaloacetohydrolase. Donnelly MI, Dagley S (1980). "Production of methanol ...

*Sterol esterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... cholesteryl ester hydrolase, sterol ester hydrolase, cholesterol ester hydrolase, cholesterase, and acylcholesterol lipase. ... Okawa Y, Yamaguchi T (May 1977). "Studies on sterol-ester hydrolase from Fusarium oxysporum. I Partial purification and ... In enzymology, a sterol esterase (EC 3.1.1.13) is an enzyme that catalyzes the chemical reaction sterol ester + H2O ⇌ {\ ...

*Cutinase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... Cutinase is a serine esterase containing the classical Ser, His, Asp triad of serine hydrolases. The protein belongs to the ... this enzyme class is cutin hydrolase. Aerial plant organs are protected by a cuticle composed of an insoluble polymeric ...

*3-oxoadipate enol-lactonase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... 3-oxoadipic enol-lactone hydrolase, and beta-ketoadipate enol-lactone hydrolase. This enzyme participates in benzoate ... Other names in common use include carboxymethylbutenolide lactonase, beta-ketoadipic enol-lactone hydrolase, 3-ketoadipate enol ...

*N-acetylgalactosaminoglycan deacetylase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ...

*Lysophospholipase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. This family consists of ... Abe M, Ohno K & Sato R (1974). "Possible identity of lysolecithin acyl-hydrolase with lysolecithin-lysolecithin acyl- ... lysophosphatidylcholine hydrolase, lysophospholipase A1, lysophopholipase L2, lysophospholipase transacylase, neuropathy target ...

*Triacetate-lactonase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... Other names in common use include triacetic lactone hydrolase, triacetic acid lactone hydrolase, TAL hydrolase, and triacetate ... III Properties of triacetic acid lactone hydrolase.]". Nippon Nogei Kagaku Kaishi. 42: 596-600. Molecular and Cellular Biology ... lactone hydrolase. Kato S, Ueda H, Nonomura S, Tatsumi C (1968). "[Degradation of dehydroacetic acid by microorganisms. ...

*Poly(3-hydroxyoctanoate) depolymerase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... hydrolase. Jendrossek D (2001). "Microbial degradation of polyesters". Adv. Biochem. Eng. Biotechnol. 71: 293-325. doi:10.1007/ ... this enzyme class is poly{oxycarbonyl[(R)-2-pentylethylene]} hydrolase. Other names in common use include PHO depolymerase, ...

*Orsellinate-depside hydrolase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... In enzymology, an orsellinate-depside hydrolase (EC 3.1.1.40) is an enzyme that catalyzes the chemical reaction orsellinate ... This enzyme is also called lecanorate hydrolase. Schultz J, Mosbach K (1971). "Studies on lichen enzymes. Purification and ... properties of an orsellinate depside hydrolase obtained from Lasallia pustulata". Eur. J. Biochem. 22 (2): 153-7. doi:10.1111/j ...

*Acetylxylan esterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ...

*Alpha-amino-acid esterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... This enzyme is also called alpha-amino acid ester hydrolase. As of late 2007, 5 structures have been solved for this class of ... Kato K, Kawahara K, Takahashi T & Kakinuma A (1980). "Purification of an alpha-amino acid ester hydrolase from Xanthomonas ... Kato K, Kawahara K, Takahashi T & Kakinuma A (1980). "Substrate specificity of an alpha-amino acid ester hydrolase from ...

*Cetraxate benzylesterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... the two substrates of this enzyme are cetraxate benzyl ester and H2O, whereas its two products are cetraxate and benzyl alcohol ... and some properties and reactivities of cetraxate benzyl ester hydrochloride-hydrolyzing enzyme". Chem. Pharm. Bull. Tokyo. 37 ... is an enzyme that catalyzes the chemical reaction cetraxate benzyl ester + H2O ⇌ {\displaystyle \rightleftharpoons } cetraxate ...

*Dihydrocoumarin hydrolase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... In enzymology, a dihydrocoumarin hydrolase (EC 3.1.1.35) is an enzyme that catalyzes the chemical reaction dihydrocoumarin + ... V Purification and properties of dihydrocoumarin hydrolase of Melilotus alba". J. Biol. Chem. 237: 1653-6. PMID 14458747. ...

*Fatty-acyl-ethyl-ester synthase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... In enzymology, a fatty-acyl-ethyl-ester synthase (EC 3.1.1.67) is an enzyme that catalyzes the chemical reaction a long-chain- ... the two substrates of this enzyme are long-chain-fatty-acyl ethyl ester and H2O, whereas its two products are long-chain-fatty ... fatty-acyl ethyl ester + H2O ⇌ {\displaystyle \rightleftharpoons } a long-chain-fatty acid + ethanol Thus, ...

*Hydroxybutyrate-dimer hydrolase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... In enzymology, a hydroxybutyrate-dimer hydrolase (EC 3.1.1.22) is an enzyme that catalyzes the chemical reaction (R)-3-((R)-3- ... This enzyme is also called D-(−)-3-hydroxybutyrate-dimer hydrolase. This enzyme participates in butanoate metabolism. Delafield ... FP, Cooksey KE, Doudoroff M (1965). "beta-Hydroxybutyric dehydrogenase and dimer hydrolase of Pseudomonas lemoignei". J. Biol. ...

*L-rhamnono-1,4-lactonase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ...

*Feruloyl esterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... cinnamoyl ester hydrolase (cinnAE). As of late 2007, 6 structures have been solved for this class of enzymes, with PDB ...

*Deoxylimonate A-ring-lactonase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ...

*Acetylsalicylate deacetylase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... Other names in common use include aspirin esterase, acetylsalicylic acid esterase, and aspirin hydrolase. Ali B, Kaur S (1983 ... "Partial purification and characterization of a microsomal carboxylesterase specific for salicylate esters from guinea-pig liver ...

*11-cis-retinyl-palmitate hydrolase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... In enzymology, a 11-cis-retinyl-palmitate hydrolase (EC 3.1.1.63) is an enzyme that catalyzes the chemical reaction 11-cis- ... Blaner WS, Prystowsky JH, Smith JE, Goodman DS (1984). "Rat liver retinyl palmitate hydrolase activity. Relationship to ... cholesteryl oleate and triolein hydrolase activities". Biochim. Biophys. Acta. 794 (3): 419-27. doi:10.1016/0005-2760(84)90008- ...

*Aminoacyl-tRNA hydrolase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... Other names in common use include aminoacyl-transfer ribonucleate hydrolase, N-substituted aminoacyl transfer RNA hydrolase, ... In enzymology, an aminoacyl-tRNA hydrolase (EC 3.1.1.29) is an enzyme that catalyzes the chemical reaction N-Substituted ... and peptidyl-tRNA hydrolase. As of late 2007, 9 structures have been solved for this class of enzymes, with PDB accession codes ...

*1-alkyl-2-acetylglycerophosphocholine esterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ...

*Sialate O-acetylesterase

This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of ... The SIAE protein functions in carbohydrate metabolism and catalyzes the removal of O-acetyl ester groups from position 9 of the ...

*Arylesterase

... specifically those acting on carboxylic ester bonds. The systematic name of this enzyme class is aryl-ester hydrolase. Other ... This enzyme belongs to the family of hydrolases, ...

*Metabolism

For example, the set of carboxylic acids that are best known as the intermediates in the citric acid cycle are present in all ... Proteins are made from amino acids that have been activated by attachment to a transfer RNA molecule through an ester bond. ... These digestive enzymes include proteases that digest proteins into amino acids, as well as glycoside hydrolases that digest ... a glycerol molecule attached to three fatty acid esters is called a triacylglyceride. Several variations on this basic ...
Neuropathy target esterase also known as patatin-like phospholipase domain-containing protein 6 (PNPLA6) is a neuropathy target esterase enzyme that in humans is encoded by the PNPLA6 gene. Neuropathy target esterase is a phospholipase that deacetylates intracellular phosphatidylcholine to produce glycerophosphocholine. It is thought to function in neurite outgrowth and process elongation during neuronal differentiation. The protein is anchored to the cytoplasmic face of the endoplasmic reticulum in both neurons and non-neuronal cells. Neuropathy target esterase is an enzyme with phospholipase B activity: It sequentially hydrolyses both fatty acids from the major membrane lipid phosphatidylcholine, which generates water-soluble glycerophosphocholine. In cells of eukaryotes from yeast to humans, NTE is anchored to the cytoplasmic face of the endoplasmic reticulum membrane and is particularly abundant in neurons, the placenta, and the kidney. Loss of NTE activity results in abnormally elevated ...
In enzymology, an acyloxyacyl hydrolase (EC 3.1.1.77) is an enzyme that catalyzes the chemical reaction 3-(acyloxy)acyl group of bacterial lipopolysaccharide (lipid A moiety) ⇌ {\displaystyle \rightleftharpoons } 3-hydroxyacyl group of bacterial lipopolysaccharide + a fatty acid Hence, this enzyme has one substrate, the 3-(acyloxy)acyl groups of bacterial lipopolysaccharides, and two products, [partially deacylated lipopolysaccharide] and fatty acid. The enzyme removes from lipid A the secondary acyl chains that are needed for lipopolysaccharides to be recognized by the MD-2--TLR4 receptor on animal cells. This reaction inactivates the lipopolysaccharide (endotoxin). Acyloxyacyl hydrolase is produced by monocyte-macrophages, neutrophils, dendritic cells, and renal cortical epithelial cells. It is a protein of Mr = ~60,000 that has two disulfide-linked subunits. The smaller subunit, of Mr = ~14,000 (including glycosylation), is a member of the SAPLIP (saposin-like protein) family along with ...
List of words make out of Pectinesterase. Anagrams and Words made out of Pectinesterase. Find Scrabble Point of Pectinesterase. Definition of Pectinesterase. Puzzle Solver.
Carboxylesterases hydrolyze numerous endogenous and foreign compounds with diverse structures. Humans and rodents express multiple forms of carboxylesterases, which share a high degree of sequence identity (∼70%). Alignment analyses locate in carboxylesterases several functional subsites such the catalytic triad as seen in acetylcholinesterase. The aim of this study was to determine among human and rodent carboxylesterases the immunorelatedness, overlapping substrate specificity, differential sensitivity to serine enzyme inhibitors, tissue distribution, and tumor-related expression. Six antibodies against whole carboxylesterases or synthetic peptides were tested for their reactivity toward 11 human or rodent recombinant carboxylesterases. The antibodies against whole proteins generally exhibited a broader cross-reactivity than the anti-peptide antibodies. All carboxylesterases hydrolyzed para-nitrophenylacetate and para-nitrophenylbutyrate. However, the relative activity varied markedly from ...
cell wall, extracellular region, acylglycerol lipase activity, carboxylic ester hydrolase activity, short-chain carboxylesterase activity, medium-chain fatty acid catabolic process, monoacylglycerol catabolic process, short-chain fatty acid catabolic process
Peptidyl-tRNA hydrolase (Pth) catalyzes the breakdown of peptidyl-tRNA into peptide and tRNA components. Pth from Acinetobacter baumannii (AbPth) was cloned, expressed, purified and crystallized in a native unbound (AbPth-N) state and in a bound state with the phosphate ion and cytosine arabinoside (cytarabine) (AbPth-C). Structures of AbPth-N and AbPth-C were determined at 1.36 and 1.10 Å resolutions, respectively. The structure of AbPth-N showed that the active site is filled with water molecules. In the structure of AbPth-C, a phosphate ion is present in the active site, while cytarabine is bound in a cleft which is located away from the catalytic site. The cytarabine-binding site is formed with residues: Gln19, Trp27, Glu30, Gln31, Lys152, Gln158 and Asp162. In the structure of AbPth-N, the side chains of two active-site residues, Asn70 and Asn116, were observed in two conformations. Upon binding of the phosphate ion in the active site, the side chains of both residues were ordered to ...
The Peptidyl-tRNA Hydrolase 2 (PTRH2) gene codes for a highly conserved mitochondrial protein. This protein prevents the accumulation of dissociated peptidyl-tRNA, and plays an important role in regulating cell survival and death. It promotes cell survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix (ECM), through interaction with focal adhesion kinase (FAK) and subsequent activation of the PI3K-AKT-NFkB pathway. It also induces Bcl-2 transcription that blocks the intrinsic mitochondrial apoptotic pathway. PTRH2 functions as a phosphoprotein that regulates NFkB and ERK signaling. In cells that have lost their attachment to the ECM through anoikos, PTRH2 promotes apoptosis. Upon loss of integrin-mediated cell attachment to the ECM, PTRH2 protein is phosphorylated, is released from the mitochondria into the cytosol, and promotes apoptosis through interactions with transcriptional regulator amino-terminal enhancer of split (AES). Defects in this protein ...
Shop Feruloyl esterase ELISA Kit, Recombinant Protein and Feruloyl esterase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Plasmodium falciparum glucose-6-phosphate dehydrogenase 6-phosphogluconolactonase is a potential drug target Journal Articles Refereed ...
Carboxylesterases play an important role in the metabolism of endogenous compounds and exogenous substances such as drugs (including prodrugs), pesticides, and herbicides. Carboxylesterases are widely distributed in the microsomes of the several tissues such as liver, kidney, brain, and lung, where they are loosely bound to the luminal surface of the ER. The highest concentration of carboxylesterases is found in the liver microsomes (Morgan et al., 1994). Furthermore, it has been reported that secretory form such as serum carboxylesterase is highly expressed in rodent (Yan et al., 1995b). Therefore, the in vivo hydrolysis of drug containing ester moiety depends on hydrolase activity in the tissues as well as the blood.. Taking into account the drug disposition after administration, hydrophilic drugs are mainly distributed to the systemic blood circulation, whereas hydrophobic drugs distribute in several tissues. The hydrophobicity and basicity of butyryl-PL strongly suggest that butyryl-PL is ...
Copying of this document in whole or in part is allowable only for scholarly purposes. It is understood, however, that any copying or publication of this documentation for commercial purposes, or for financial gain, shall not be allowed without the authors written permission.. ...
CP001825.PE410 Location/Qualifiers FT CDS_pept complement(441864..442601) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Tter_0412" FT /product="6-phosphogluconolactonase" FT /note="TIGRFAM: 6-phosphogluconolactonase; PFAM: FT glucosamine/galactosamine-6-phosphate isomerase; KEGG: FT dvu:DVU2313 6-phosphogluconolactonase" FT /db_xref="EnsemblGenomes-Gn:Tter_0412" FT /db_xref="EnsemblGenomes-Tr:ACZ41334" FT /db_xref="GOA:D1CEH8" FT /db_xref="InterPro:IPR005900" FT /db_xref="InterPro:IPR006148" FT /db_xref="InterPro:IPR037171" FT /db_xref="InterPro:IPR039104" FT /db_xref="UniProtKB/TrEMBL:D1CEH8" FT /inference="protein motif:TFAM:TIGR01198" FT /protein_id="ACZ41334.1" FT /translation="MAGKLSIVENSSEVARAGAEQFISRAKESIDDHGSFFVALSGGST FT PVAMYKLLASDEYRGKVDWDKVLFFWSDERCVPPDHPDSNYGSAHQHLLQPLGITEDRV FT FRMKGELPPEEAAREYEEIVKKAVPGDPPRFDLIFLGLGDDAHTASLFPETDALHVTDR FT LVVHNYVPKLNTYRITFTSTLINAAASVVFLVSGEGKAEALKSVLEGEQNPTKYPAQMV FT NPTSGALLWVVDRAAASLLSGTQ" atggcaggaa agttatcgat tgtagaaaat tcctccgagg ...
Background: Our understanding of how fungi evolved to develop a variety of ecological niches, is limited but of fundamental biological importance. Specifically, the evolution of enzymes affects how well species can adapt to new environmental conditions. Feruloyl esterases (FAEs) are enzymes able to hydrolyze the ester bonds linking ferulic acid to plant cell wall polysaccharides. The diversity of substrate specificities found in the FAE family shows that this family is old enough to have experienced the emergence and loss of many activities. Methodology/Principal Findings: In this study we evaluate the relative activity of FAEs against a variety of model substrates as a novel predictive tool for Ascomycota taxonomic classification. Our approach consists of two analytical steps; (1) an initial unsupervised analysis to cluster the FAEs substrate specificity data which were generated by cultivation of 34 Ascomycota strains and then an analysis of the produced enzyme cocktail against 10 substituted
Background One of the most intriguing groups of enzymes, the feruloyl esterases (FAEs), is ubiquitous in both simple and complex organisms. FAEs have gained importance in biofuel, medicine and food industries due to their capability of acting on a large range of substrates for cleaving ester bonds and synthesizing high-added value molecules through esterification and transesterification reactions. During the past two decades extensive studies have been carried out on the production and partial characterization of FAEs from fungi, while much less is known about FAEs of bacterial or plant origin. Initial classification studies on FAEs were restricted on sequence similarity and substrate specificity on just four model substrates and considered only a handful of FAEs belonging to the fungal kingdom. Results Our study centers on the descriptor-based classification and structural analysis of experimentally verified and putative FAEs. 365 FAE-related sequences of fungal, bacterial and plantae origin were
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Build: Wed Jun 21 18:33:50 EDT 2017 (commit: 4a3b2dc). National Center for Advancing Translational Sciences (NCATS), 6701 Democracy Boulevard, Bethesda MD 20892-4874 • 301-435-0888. ...
Build: Wed Jun 21 18:33:50 EDT 2017 (commit: 4a3b2dc). National Center for Advancing Translational Sciences (NCATS), 6701 Democracy Boulevard, Bethesda MD 20892-4874 • 301-435-0888. ...
Shop Methylesterase ELISA Kit, Recombinant Protein and Methylesterase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
B14. Advances in plant biochemistry Lectures L27.1 Polyisoprenoids secondary metabolites or physiologically important superlipids? Liliana Surmacz, Ewa Swiezewska Institute of Biochemistry and Biophysics,
Donaghy et al. (1998) added the ethyl ferulate solution directly to the media immediately before pouring the plates, and used a final concentration of 2mg/mL while Hassan and Pattat (2011) added it to the top agar at a stated concentration of 0.05mg/ml. Weve found that the hassan and pattat concentration is way too low to make the agar cloudy but 1mg/ml can work well in a pinch. -- ...
Donaghy et al. (1998) added the ethyl ferulate solution directly to the media plates at a final concentration of 2mg/mL while Hassan and Pattat (2011) added it to the top agar at a stated concentration of 0.05mg/ml. Weve found that the hassan and pattat concentration is way too low to make the agar cloudy but 1mg/ml can work well in a pinch. -- ...
From Prosite: Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH) is a bacterial enzyme that cleaves peptidyl-tRNA or N-acyl-aminoacyl-tRNA to yield free peptides or N-acyl-amino acids and tRNA. The natural substrate for this enzyme may be peptidyl-tRNA which drop off the ribosome during protein synthesis ...
1FDK: Crystal structure of the complex of bovine pancreatic phospholipase A2 with the inhibitor 1-hexadecyl-3-(trifluoroethyl)-sn-glycero-2-phosphomethanol,.
In this study, we provided insights into how PMEI modulates the activity of PME through the formation of the PME-PMEI complex. We chose GhPMEI3 as a possible pathogen resistance-associated PMEI, and GhPME2 and GhPME31 as representatives of two different types of PMEs. The alignment of the GhPMEI3 sequence with sequences of functionally characterized PMEIs showed that GhPMEI3 has two INH sequences (Fig. 1). The structure of an INH from tobacco (Nt-CIF) has been previously elucidated (Hothorn et al., 2004a). KwPMEI and Nt-CIF are strikingly similar from a structural point of view, but recognize different target enzymes, as key amino acids that are involved in the formation of intermolecular H-bonds with PMEs are only conserved in PMEIs. Therefore, the structural view of the PMEI-PME complex provided insights into the specific binding between GhPMEI3 and GhPME2/ GhPME31. Since the highly conserved INHs lack the PKF motif in the α3 helix, GhPMEI3 may be unable to participate in interactions with ...
Esta serie de fotos de Sevilla está dedicada a todos mis hermanos (Leo,Rubén y Manu) y a mis amigos: Andrea Niederfriniger,Conchi y Adrián González Da Sousa.Con ellos, he disfrutado,conocido,amado a esta gran ciudad que SIEMPRE estará en mí. Un saludo PD:Todas las fotos agrupadas en esta serie, están hechas en los puentes y vacaciones que me he pasado en Sevilla, algunas ya están en la galería
Yesterday we were travelling but forgot to apply for our ESTA, so we had to submit a last minute application. How long does it take for an ESTA to be approved?
Shows the %age of participants who met specific weight-transformation thresholds 6 and 24 months after randomization. At two years, the %age of participants in
Control and hyperhydric micropropagated plantlets from three carnation cultivars have been used to study their pectin composition and the activity of pectin methyl esterases (PMEs; EC 3.1.1.11). Pectins are a highly heterogeneous group of polymers that contribute to cell adhesion, cell wall architecture, and cell wall mechanical strength. Pectins control cell wall porosity and cell wall ionic status and are implicated in intercellular space development. The degree of esterification of pectins is controlled by the activity of cell wall PMEs; their different actions can affect the properties of the cell wall, which have been considered important with respect to controlling the development of hyperhydricity. The total pectins of hyperhydric leaves of the three varieties were significantly reduced in comparison with controls. The pectate fraction was significantly increased in hyperhydric leaves of all varieties while soluble pectins and protopectins were significantly lower. The PME activity of ...
Sensory adaptation by the chemotaxis system of Escherichia coli requires adjustments of the extent of methyl esterification of the chemotaxis receptor proteins. One mechanism utilized by E. coli to make such adjustments is to control the activity of CheB, the enzyme responsible for removing receptor methyl ester groups. Previous work has established the existence of a multicomponent signal transduction pathway that enables the chemotaxis receptor proteins to control the methylesterase activity in response to chemotactic stimuli. We isolated and characterized CheB mutants that do not respond normally to this control mechanism. In intact cells these CheB variants could not be activated in response to negative chemotaxis stimuli. Further characterization indicated that these CheB variants could not be phosphorylated by the chemotaxis protein kinase CheA. Disruption of the mechanism responsible for regulating methylesterase activity was also observed in cells carrying chromosomal deletions of either cheA or
Carboxyl Ester Lipase/CEL Antibodies available through Novus Biologicals. Browse our Carboxyl Ester Lipase/CEL Antibody catalog backed by our Guarantee+.
Contents. EC 3.1.1 Carboxylic Ester Hydrolases. EC 3.1.2 Thioester Hydrolases. EC 3.1.3 Phosphoric Monoester Hydrolases. EC 3.1.4 Phosphoric Diester Hydrolases. EC 3.1.5 Triphosphoric Monoester Hydrolases. EC 3.1.6 Sulfuric Ester Hydrolases. EC 3.1.7 Diphosphoric Monoester Hydrolases. EC 3.1.8 Phosphoric Triester Hydrolases. EC 3.1.11 Exodeoxyribonucleases Producing 5-Phosphomonoesters. EC 3.1.12 Exodeoxyribonucleases Producing 3-Phosphomonoesters. EC 3.1.13 Exoribonucleases Producing 5-Phosphomonoesters. EC 3.1.14 Exoribonucleases Producing 3-Phosphomonoesters. EC 3.1.15 Exonucleases Active with either Ribo- or Deoxyribonucleic Acids and Producing 5-Phosphomonoesters. EC 3.1.16 Exonucleases Active with either Ribo- or Deoxyribonucleic Acids and Producing 3-Phosphomonoesters. EC 3.1.21 Endodeoxyribonucleases Producing 5-Phosphomonoesters. EC 3.1.22 Endodeoxyribonucleases Producing 3-Phosphomonoesters. EC 3.1.23 Site Specific Endodeoxyribonucleases: Cleavage is Sequence Specific ...
TY - JOUR. T1 - Identification and comparison of cutinases for synthetic polyester degradation. AU - Baker, Peter James. AU - Poultney, Christopher. AU - Liu, Zhiqiang. AU - Gross, Richard. AU - Montclare, Jin. PY - 2012/1. Y1 - 2012/1. N2 - Cutinases have been exploited for a broad range of reactions, from hydrolysis of soluble and insoluble esters to polymer synthesis. To further expand the biotechnological applications of cutinases for synthetic polyester degradation, we perform a comparative activity and stability analysis of five cutinases from Alternaria brassicicola (AbC), Aspergillus fumigatus (AfC), Aspergillus oryzae (AoC), Humicola insolens (HiC), and the well-characterized Fusarium solani (FsC). Of the cutinases, HiC demonstrated enhanced poly(ε-caprolactone) hydrolysis at high temperatures and under all pH values, followed by AoC and AfC. Both AbC and FsC are least stable and function poorly at high temperatures as well as at acidic pH conditions. Surface charge calculations and ...
The primary structure of AtPAEs revealed that they are unlikely to be membrane proteins and that most isoforms have a basic pI, as suggested in the early literature [17]. However, the predicted GPI anchor for AtPAE10 and AtPAE12, both from clade 2, could indicate a putative role in plant signaling and some interaction with the plasma membrane. The presence of such a predicted GPI anchor has been observed in other pectin-related genes, including PMEI [55]. The absence of a predicted signaling sequence for three AtPAEs, AtPAE2, AtPAE4 and AtPAE5, indicates that some Arabidopsis PAEs without a signal peptide could have a functional activity. Similar results have been observed with several PMEs from distinct plant species and particularly for AtPME31, which has no signaling sequence but is active and cannot be inhibited by the kiwi pectin methylesterase inhibitor, a strong PME inhibitor [56]. 3D homology modeling of AtPME31 revealed an external loop. The function and the mechanism by which AtPME31 ...
Flutamide, an antiandrogen drug, is widely used for the treatment of prostate cancer. The major metabolic pathways of flutamide are hydroxylation and hydrolysis. The hydrolyzed metabolite, 5-amino-2-nitrobenzotrifluoride (FLU-1), is further metabolized to N-hydroxy FLU-1, an assumed hepatotoxicant. Our previous study demonstrated that arylacetamide deacetylase (AADAC), one of the major serine esterases expressed in the human liver and gastrointestinal tract, catalyzes the flutamide hydrolysis. However, the enzyme kinetics in human tissue microsomes were not consistent with the kinetics by recombinant human AADAC. Thus, it seemed that AADAC is not the sole enzyme responsible for flutamide hydrolysis in human. In the present study, we found that recombinant carboxylesterase (CES) 2 could hydrolyze flutamide at low concentrations of flutamide. In the inhibition assay, the flutamide hydrolase activities at a flutamide concentration of 5 μM in human liver and jejunum microsomes were strongly ...
In order to establish the thermal process required by acified papaya pulp (pH 3.8) var formosa, a study was carried out on the kinetics of thermal inactivation of the heat resistant enzymes present in the pulp. Since no peroxidase activity was detected, the study was focused on pectinesterase. The heat inactivation curves at 75, 77 and 80C showed a change in slope indicating the presence of two different portions of the enzyme, one heat labile and the other hear resistant. The decimal reduction limes (D value) of pectinesterase were 0.8, 0.3 and 0.2 min for the heat labile portion and for the heat resistant portion 16.7, 7.2 and 3.7 min, respectively. The temperature-dependency factor for the heat labile portion was 9.2C and 7.8C for the thermostable portion, while the activation energies were 258.3 and 304.4 Kj/mol. These values were within the range of 167.5-418.7 Kj/mol reported in the literature for the thermal inactivation of enzymes. Thermal destruction studies with Clostridium ...
Lipase de Fusarium solani FS1 foi imobilizada por ligação covalente usando esferas de poliacrilamida e Dacron magnetizado, retendo 12%, e 97% de atividade, respectivamente. A lipase foi também enclausurada em esferas de poliacrilamida e reteve 53% de sua atividade específica. Investigações sobre...
Indivior (formerly Reckitt Benckiser Pharmaceuticals) is developing RBP 8000 as an intravenous antidote for cocaine toxicity. RBP 8000 is a cocaine esterase
In this study, we exploited two different expression systems in two distant plant species to address pivotal questions concerning the role and regulation of Chlase in chlorophyll catabolism. Although the EST database suggests that most plants contain more than one Chlase homolog, we chose to conduct this study using the Chlase1 gene from citrus (Jacob-Wilk et al., 1999) because (1) it is the only Chlase gene encoding an enzyme experimentally shown to be localized to the chloroplast (Trebitsh et al., 1993; Jacob-Wilk et al., 1999) and (2) it is one of only two Chlases for which the processing site of the mature protein was experimentally determined (Jacob-Wilk et al., 1999; Tsuchiya et al., 1999). The citrus Chlase1 gene was overexpressed in two systems: (1) a ZYMV-based viral vector expression system that efficiently expressed citrus Chlase versions in squash plants for at least 21 d, which was more than sufficient time to study the physiological effects of Chlase expression in plants; and (2) a ...
Abdomen • Abscisic Acid • Acetaminophen • Acetylcholinesterase • Actins • Action Potentials • Adaptation, Biological • Adaptation, Physiological • Adaptor Proteins, Signal Transducing • Adenosine • Adolescent • Adult • Aedes • Aging • Algorithms • Alleles • Allosteric Regulation • Allosteric Site • Amaranth Dye • Analysis of Variance • Animal Nutritional Physiological Phenomena • Animals • Anopheles • Anti-Inflammatory Agents, Non-Steroidal • Antidepressive Agents • Antioxidants • Ants • Arsenic • Autistic Disorder • Autoreceptors • Bangladesh • Bees • Beetles • Behavior, Animal • Betaine • Biochemistry • Biological Evolution • Biological Markers • Biological Transport • Biomass • Biometry • Body Constitution • Body Patterning • Body Size • Body Weight • Body Weights and Measures • Brain • Butterflies • Caenorhabditis elegans Proteins • Carbohydrates • Carbon • Carboxylic Ester Hydrolases • ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
This cell line was derived from the peripheral blood of a 1 year old male with acute monocytic leukaemia. THP-1 cells show alpha-naphtyl butyrate esterase activity, phagocytose latex particles as well as sensitized sheep erythrocytes and have the ability to restore T-lymphocyte response to Con A. When incubating with TPA or DMSO the cells can be differentiated into macrophage-like cells ...
Would anyone know structural charactersitics of enzymes catalyzing the hydrolysis of 4-methylumbelliferyl-p-guanidinobenzoate to its product, 4-methylumbelliferone? I am presently working with the identification of a sperm protein possessing this enzymatic capability. zu04516 at uabdpo.dpo.uab.edu ...
Landowski, Christopher P. et al "Nucleoside Ester Prodrug Substrate Specificity of Liver Carboxylesterase." Journal of Pharmacology and Experimental Therapeutics 316.2 (2006): 572-580. Web. 29 Mar. 2020. ...
Sterol esterase belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. The systematic name of this enzyme class is steryl-ester acylhyd
Corona del Mar High graduate Tumua Anae will attempt to become the third local athlete to win a gold medal at the London Olympics on Thursday. Anae, a backup goalie on the U.S. women's water polo team, will help the Americans battle Spain in the gold-medal game. The two teams, both 4-0-1 in the...
1LE7: Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.
Measurement of Carboxylesterase (CES) Activities (Masakiyo Hosokawa, Chiba University, Chiba, Japan and Tetsuo Satoh, Biomedical Research Institute, Chiba, Japan)
Powers R, Mirkovic N, Goldsmith-Fischman S, Acton TB, Chiang Y, Huang YJ, Ma L, Rajan PK, Cort JR, Kennedy MA, et al. Solution structure of Archaeglobus fulgidis peptidyl-tRNA hydrolase (Pth2) provides evidence for an extensive conserved family of Pth2 enzymes in archea, bacteria, and eukaryotes. Protein Sci. 2005 ;14(11):2849-61. ...
Powers R, Mirkovic N, Goldsmith-Fischman S, Acton TB, Chiang Y, Huang YJ, Ma L, Rajan PK, Cort JR, Kennedy MA, et al. Solution structure of Archaeglobus fulgidis peptidyl-tRNA hydrolase (Pth2) provides evidence for an extensive conserved family of Pth2 enzymes in archea, bacteria, and eukaryotes. Protein Sci. 2005 ;14(11):2849-61. ...
Salt bridges on the surface of cutinase. Amino acids involved in the formation of salt bridges on the surface of cutinase, as predicted by the pKa shifts using
NTE130 series- Integrated circuit. AM/FM IF. in 7-pin SIP package. Operational temperature range from -15°C to 60°C. from NTE datasheet
Keon, J. P. R., Byrde, R. J. W. and Cooper, R. M., 1987. Microbial depolymerases in the establishment and progress of pathogenic infections. In: Pegg, G. F. and Ayers, P. G., eds. Plant Infecting Fungi: Establishment, Progress and Outcome of Pathogenic and Mutualistic Infection. ...
Seriole, esp ces diverses - Tout ce que vous devez savoir propos de laliment Seriole, esp ces diverses : Toutes les informations nutritionnelles de Seriole, esp ces diverses
Mollusques, mye (palourde), esp ces diverses - Tout ce que vous devez savoir propos de laliment Mollusques, mye (palourde), esp ces diverses : Toutes les informations nutritionnelles de Mollusques, mye (palourde), esp ces diverses
[QUOTE=shibz]Smile and MaNan Cr-Lostmymusic [/QUOTE] matlab what a kameena,itna kuch galat karne k baad bhi he wants her to smile for him.some confidence the guy has. i like how Nandu says meri smile bahot achi hai but you dont deserve it. Lol. mu tod jawab. | Page: 25 | 4610678 | Kaisi Yeh Yaariaan Forum
Ilolelini vino ya Nte Yakwe Yeova yakaomba-yaaya impendwa ku ma 8 milyoni kufuma mu mitundu ipusane-pusane mu mpanga ukucila pali 230, nupya yalemenkana mu kupepa Leza nu kuomba imilimo.
The samples to be analyzed in the study (PME11-A1, A2, A3) consist of a yeast tryptic digest (C-18 purified), spiked-in with three different concentrations of a mixture of 20 human phosphopeptide standards (Phosphomix 1and 2 from Sigma-Aldrich, see attached specification file), containing light isotopes.. ...
¿Quieres moverte con ligereza en la jungla metropolitana sin renunciar a tu estilo? Esta sudadera roja con cremallera, bolsillos y bandas laterales será un aliado imprescindible. Confeccionada 100% en algodón, esta sudadera es cómoda y cálida, perfecta pa
Notas: - Se han inclu do, adem s del t tulo en espa ol, los t tulos originales de algunas pel culas y series para as facilitar su b squeda en el ndic
OTL Extras logfile created on: 6/12/2013 6:08:07 PM - Run 1 OTL by OldTimer - Version 3.2.69.0 Folder = C:\Users\quiringt\Desktop 64bit- Home Premium...
Libros electrónicos en la plataforma Myilibrary Cómo acceder a ellos fuera del CUCEI? Junio Los libros de esta lista están registrado en el Catálogo en línea del CUCEI (http:// :8991/f/?func=find-b-0&local_base=cucei),
Esta plataforma upstream conecta un sistema de expresión con los mejores equipos y controles de proceso para un desarrollo rápido y aumento de escala de procesos robustos de carga virales altas
Esta plataforma upstream conecta un sistema de expresión con los mejores equipos y controles de proceso para un desarrollo rápido y aumento de escala de procesos robustos de carga virales altas
2015 SeriesNid Series Estreno, Todos los derechos reservados. Ningun video esta alojado en nuestros servidores, todos los enlaces fueron tomados de diferentes servidores gratuitos ...
A Planfor, viveiros e jardinaria on-line o seu parceiro para o jardim seja qual for a esta o do ano: a maior empresa de viveiros on-line, a n vel europeu, uma jardinaria a pre os baixos, especialistas de jardim sempre atentos s suas necessidades, in meros guias de compra e fichas de conselhos, milhares de plantas e produtos de jardim.
Estudia el medioambiente y las ciencias medioambientales con esta categoría de eBooks gratuitos. Por ejemplo, puedes aprender sobre el tratamiento de aguas residuales y la contaminación atmosférica.
En esta página se enumeran las publicaciones científicas de Fundació ACE y de sus miembros y figuran también las respectivas referencias bibliográficas.
Kya aap bhi aapke chehre par pade red spot ko lekar pareshan hai to aaiye jante hai laal dhabbe ko hatane ke tarike jisse aap sundar dikh sakege.
走這路… 正如你所知道的有, 或知道誰的人有, 馬尾綜合徵, 它使你的行走步態的嘲弄. 我已經描述自己是走路像科學怪人. 現在到了新的, 這CES做有趣的事情. 感覺已經開始返回到我的腳踝兩側. 因為它有, 我已經… 更多精彩閱讀… ...
Bethke G., Grundman R.E., Sreekanta S., Truman W., Katagiri F., Glazebrook J.. Pectins, major components of dicot cell walls, are synthesized in a heavily methylesterified form in the Golgi and are partially deesterified by pectin methylesterases (PMEs) upon export to the cell wall. PME activity is important for the virulence of the necrotrophic fungal pathogen Botrytis cinerea. Here, the roles of Arabidopsis PMEs in pattern-triggered immunity and immune responses to the necrotrophic fungus Alternaria brassicicola and the bacterial hemibiotroph Pseudomonas syringae pv maculicola ES4326 (Pma ES4326) were studied. Plant PME activity increased during pattern-triggered immunity and after inoculation with either pathogen. The increase of PME activity in response to pathogen treatment was concomitant with a decrease in pectin methylesterification. The pathogen-induced PME activity did not require salicylic acid or ethylene signaling, but was dependent on jasmonic acid signaling. In the case of ...
Talaromyces thermophilus lipase (TTL) was found to hydrolyze monogalactosyl diacylglycerol (MGDG) and digalactosyl diacylglycerol (DGDG) substrates presented in various forms to the enzyme. Different assay techniques were used for each substrate: pHstat with dioctanoyl galactolipid-bile salt mixed micelles, barostat with dilauroyl galactolipid monomolecular films spread at the air-water interface, and UV absorption using a novel MGDG substrate containing α-eleostearic acid as chromophore and coated on microtiter plates. The kinetic properties of TTL were compared to those of the homologous lipase from Thermomyces lanuginosus (TLL), guinea pig pancreatic lipase-related protein 2 and Fusarium solani cutinase. TTL was found to be the most active galactolipase, with a higher activity on micelles than on monomolecular films or surface-coated MGDG. Nevertheless, the UV absorption assay with coated MGDG was highly sensitive and allowed measuring significant activities with about 10 ng of enzymes, against 100
Looking for online definition of carboxylesterase 2 in the Medical Dictionary? carboxylesterase 2 explanation free. What is carboxylesterase 2? Meaning of carboxylesterase 2 medical term. What does carboxylesterase 2 mean?
The duration of the experimental period was from January to December 2000 - a period characterized by considerable changes in temperature, photoperiod, light intensity, relative humidity and rainfall.. The temperature ranged between 38.9° C in summer to 10.4° C in winter. The photoperiod ranged from a summer maximum of 14.4 hours to a winter minimum of 9 hours. Light intensity varied from 69,000 lux in summer to 20,000 lux in winter. Relative humidity ranged from 84% during rainy months to 58.2% in summer month Our experimental results indicate that chlorophyll content both chlorophyll a and chlorophyll b and therefore the total chlorophyll is higher in the winter season and successively lowered in summer season. It was also observed that levels of chlorophyll were higher in Bangla variety in comparison to Mitha variety (Fig1). An increase in the activity of Chlorophyllase enzyme (responsible for enzymatic breakdown of chlorophyll by removing the phytol side chain) was reduced in winter season ...
The duration of the experimental period was from January to December 2000 - a period characterized by considerable changes in temperature, photoperiod, light intensity, relative humidity and rainfall.. The temperature ranged between 38.9° C in summer to 10.4° C in winter. The photoperiod ranged from a summer maximum of 14.4 hours to a winter minimum of 9 hours. Light intensity varied from 69,000 lux in summer to 20,000 lux in winter. Relative humidity ranged from 84% during rainy months to 58.2% in summer month Our experimental results indicate that chlorophyll content both chlorophyll a and chlorophyll b and therefore the total chlorophyll is higher in the winter season and successively lowered in summer season. It was also observed that levels of chlorophyll were higher in Bangla variety in comparison to Mitha variety (Fig1). An increase in the activity of Chlorophyllase enzyme (responsible for enzymatic breakdown of chlorophyll by removing the phytol side chain) was reduced in winter season ...
Port Phillip Bay, Australia, is a large semi-closed bay with over four million people living in its catchment basin. The Bay receives waters from the Yarra River which drains the city of Melbourne, as well as receiving the discharges of sewage treatment plants and petrochemical and agricultural chemicals. A 1999 study demonstrated that fish inhabiting Port Phillip Bay showed signs of effects related to pollutant exposure despite pollution management practices having been implemented for over a decade. To assess the current health status of the fish inhabiting the Bay, a follow up survey was conducted in 2015. A suite of biomarkers of exposure and effects were measured to determine the health status of Port Phillip Bay sand flathead (Platycephalus bassensis), namely ethoxyresorufin-O-deethylase (EROD) activity, polycyclic aromatic hydrocarbons (PAH) biliary metabolites, carboxylesterase activity (CbE) and DNA damage (8-oxo-dG). The reduction in EROD activity in the present study suggests a ...
A new ratiometric fluorescent probe derived from 2-(2-hydroxy-3-methoxyphenyl) benzothiazole (HMBT) has been developed for selective monitoring of human carboxylesterase 1 (hCE1). The probe is designed by introducing benzoyl moiety to HMBT. The prepared latent spectroscopic probe 1 displays satisfying stability under physiological pH conditions with very low background signal. Both the reaction phynotyping and chemical inhibition assays demonstrated that hCE1 mediated the specific cleavage of the carboxylic ester bond of probe 1 in human biological samples. The release of HMBT leads to a remarkable red-shifted emission in fluorescence spectrum (120 nm large emission shift). Furthermore, human cell-based assays show that probe 1 is cell membrane permeable, and it can be used for bioassay and cellular imaging of hCE1 activity in HepG2 cells. These findings lead to the development of a simple and sensitive fluorescent method for measurement of hCE1 activity in vitro or in living cells, in the ...
Systemic movement of plant viruses through the host vasculature, one of the central events of the infection process, is essential for maximal viral accumulation and development of disease symptoms. The host plant proteins involved in this transport, however, remain unknown. Here, we examined whether …
A long-term suspension culture line (c-WRT-7) was successfully established from a transplantable myelomonocytic leukemia induced by a neonatal injection of Rauscher leukemia virus in a WKA/Hok rat. A c-WRT-7 cell line was capable of being transplanted into syngeneic rats, and when transplanted, increased numbers of macrophage-like cells were observed in the peripheral blood of rats after i.v. injection. In in vitro culture, about 10% of the c-WRT-7 cells naturally differentiated into macrophage-like cells, which adhered to the bottom of a culture flask, and also possessed phagocytic activity. By means of cytological examination, about 30% of the c-WRT-7 cells were observed to be monoblastic with α-naphthyl butyrate esterase activity. The nature of these c-WRT-7 cells as a myelomonocytic leukemia line was constant during in vitro passages of more than 30 generations. In vitro treatment of c-WRT-7 cells with lipopolysaccharide, 12-O-tetradecanoylphorbol-13-acetate, or retinoic acid increased the ...
The use of a prodrug, a conjugate of an active drug with a lipophilic substituent, is a good way of increasing the cutaneous absorption of a drug. However, the activity of dermal hydrolases has rarely been investigated in humans, or experimental animals. In the present study, we focused on the identification of rat dermal esterases and the hydrolysis of a prodrug during permeation across rat skin. We found that carboxylesterase (CES), especially the rat CES1 isozyme, Hydrolase A, is expressed in rat skin and that the hydrolysis of p-nitrophenyl acyl derivatives and caproyl-propranolol (PL) was 20-fold lower in the 9000g supernatant fraction of skin homogenate than in liver microsomes. A permeation study of caproyl-PL was performed in rat full-thickness and stripped skin using a flow-through diffusion cell. Caproyl-PL was easily partitioned into the stratum corneum and retained, not only in the stratum corneum, but also in viable epidermis and dermis. Caproyl-PL could barely be detected in the receptor
Principal Investigator:SAKAKI Takeshi, Project Period (FY):1994 - 1995, Research Category:Grant-in-Aid for General Scientific Research (C), Research Field:植物生理
A near-infrared fluorescent probe (DDAB) for highly selective and sensitive detection of carboxylesterase 2 (CE2) has been designed, synthesized, and systematically studied both in vitro and in vivo. Upon addition of CE2, the ester bond of DDAB could be rapidly cleaved and then release a near-infrared (NIR) fluorophore DDAO, which brings a remarkable yellow-to-blue color change and strong NIR fluo ...
Note from Pfam: this protein didnt match Pfam, but it pretty soon became clear that this protein should have belonged to PF01182. I have rebuilt that family to include this protein. Gene YP_001050605 from SHEWANELLA BALTICA OS155 encodes a protein with 232 residues, whcih has annotated 6-phosphogluconolactonase. Sequence alignment indicates that this proteim belongs to the sugarP_isomerase superfamily. Dali search even suggests this target be a glucose-6-phosphate 1-dehydrogenase or glucosamine-6-phosphate deaminase. More details for this structures investigation will be presented in the future hopefully. ...
Although esterases have been reported in peas, their properties have not been studied. The purpose of this investigation was to determine the substrate and inhibitor specificity of the esterases present in a water extract of lyophilized peas, and to determine if pea esterases could be classified according to the criteria established for animal esterases. Esterase activity was determined manometrically using the Gilson differential respirometer. The effect of pH on esterase activity was determined using phenyl acetate, phenyl propionate, tripropionin, and tributyrin as substrates. The pH optima appeared to lie between 6.9 and 7.2, and pH 7 was selected for use in this study. The acetyl, propionyl, and n-butyryl esters of phenol, 2-naphthol-6-SO₃ Na and glycerol were hydrolyzed by the enzyme extract. Long chain esters of 2-naphthol-6-SO₃Na, however, were not hydrolyzed. Cholinesterases and lipases did not appear to be present in the extract since only a very small amount of activity was ...
Complete information for NCEH1 gene (Protein Coding), Neutral Cholesterol Ester Hydrolase 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Fusarium root rot (FRR), caused by Fusarium solani f.sp. phaseoli, is one of the most serious root rot diseases of common bean (Phaseolus vulgaris L.) throughout the world. Yield losses of up to 84% have been attributed ...
Fusarium root rot (FRR) disease, caused by the fungus Fusarium solani f. sp. phaseoli (FSP), is an important soil-borne disease reducing common bean (Phaseolus vulgaris L.) yields, and hence food security, in Uganda and ...
Human serum paraoxonase/arylesterase 1 (PON1) standard, for use in running standard curves in AlphaLISA detection and quantitation assays
Complete information for ESD gene (Protein Coding), Esterase D, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
The paperless office appears further away than ever before. According to recent research from AIIM we are using more paper records than ever before, there are still significant problems capturing and
Analysis of how the courts have interpreted a free appropriate public education (FAPE) to be an appropriate program rather than the
Please contact [email protected] if you would like to add more articles to this list.. Articles marked with an asterik (*) offer FREE CME hours. All CE activities offered in CA: A Cancer Journal for Clinicians are FREE of charge. ...
Tom Thumb Snaffle Mouth Western Horse Bit (A5101) - This versatile, loose jaw style bit is a true all-around training and show bit. The shanks are - A5101 - 17983
La Respuesta Esta En El Colageno by Ana Maria Lajusticia, 9788441418509, available at Book Depository with free delivery worldwide.
Revision as of 16:31, 29 November 2008 by Dherik (Talk , contribs) (New page: {{Tip,Nota: Esta página trata-se de conteúdo relacionado ao KDE 3. Se você está desenvolvendo para KDE 4, esta informação pode não ser mais válida.}} Category:KDE3 ...) ...
CES 2017 took place from Jan 3-8th in Las Vegas. This years show was crazy big with interesting technology that has some unique potential.
We isolated cDNA clones (pSgPG1 through pSgPG4, pSgPME1 and pSgGN1) for the polygalacturonases (PGs), pectin methylesterase (PME) and β-1,3-glucanase (GN) that are expressed specifically in male flowers of the dioecious willow (Salix gilgiana Seemen). The structural characteristics of the deduced proteins, designated SgPGs, SgPME1 and SgGN1, respectively, suggest that these enzymes function in pollens or anthers. The four SgPGs were more than 91.9% homologous to one another at the amino acid level, indicating that their genes are members of a single family. Although the expression of the SgPGs, SgPME1 and SgGN1 was specific to male catkins (inflorescences), these genes were found in the genomes of both male and female plants. The expression of the transcripts of SgPGs, SgPME1 and SgGN1 was regulated developmentally in male reproductive organs. Maximal expression of SgPGs and SgPME1 was detected when male flowers were fully open and mature, while maximal expression of SgGN1 occurred at an ...
0043]In one exemplary embodiment, a transformed bacterial host cell with a mutant ferulic acid esterase gene is constructed. A mutant ferulic acid esterase gene is inserted into a pG+host5 vector. The mutant ferulic acid esterase gene is then transferred into bacterial host cells using electroporation. The mutant ferulic acid esterase then becomes part of the bacterial host cells genome by recombination. The bacterial host cells can be Lactobacillus buchneri cells. In some embodiments, the Lactobacillus buchneri cells will be Lactobacillus buchneri strain PTA-6138 cells. The mutant ferulic acid esterase gene can be a knock out. New strains of Lactobacillus buchneri with mutant, including knocked-out ferulic acid esterase, can be used as negative controls. For example, a transformed Lactobacillus buchneri strain can be used in an assay for studying the impact of ferulic acid esterase activity. One example of such an assay would be inoculating whole plant material, such as whole plant silage, with ...
Fat tissue is the most important energy depot in vertebrates. The release of free fatty acids (FFAs) from stored fat requires the enzymatic activity of lipases. We showed that genetic inactivation of adipose triglyceride lipase (ATGL) in mice increases adipose mass and leads to triacylglycerol deposition in multiple tissues. ATGL-deficient mice accumulated large amounts of lipid in the heart, causing cardiac dysfunction and premature death. Defective cold adaptation indicated that the enzyme provides FFAs to fuel thermogenesis. The reduced availability of ATGL-derived FFAs leads to increased glucose use, increased glucose tolerance, and increased insulin sensitivity. These results indicate that ATGL is rate limiting in the catabolism of cellular fat depots and plays an important role in energy homeostasis.. ...
Introduction: Myocardial metabolism undergoes change in response to pathological cardiac hypertrophy (PH), characterized by increased reliance on glucose oxidation, decreased free fatty acid (FFA) oxidation and a loss of metabolic flexibility. Cardiac metabolism is influenced by other organs such as adipose tissue. Hence, we aimed to investigate the effect of Adipose Triglyceride Lipase (ATGL) in adipose tissue on the development of PH and heart failure (HF) in a pressure overload-induced cardiac hypertrophy model in mice.. Methods: Male adipose tissue specific ATGL-knock out (atATGL-KO) and wild type mice (WT) underwent sham surgery (sham) or transverse aortic constriction (TAC). After 11 weeks, mice were sacrificed and organs were harvested.. We performed echocardiography one week before and 11 weeks after surgery. Left ventricular mass (LVM), left ventricular mass/tibia length (LVM/TL) and ejection fraction (EF) were calculated. Beta-myosin heavy chain (β-MyHC) was measured in RNA of hearts. ...
TY - JOUR. T1 - Regioselective deacetylation of cellulose acetates by acetyl xylan esterases of different CE-families. AU - Altaner, Clemens. AU - Saake, Bodo. AU - Tenkanen, Maija. AU - Eyzaguirre, Jaime. AU - Faulds, Craig B.. AU - Biely, Peter. AU - Viikari, Liisa. AU - Siika-aho, Matti. AU - Puls, Jurgen. PY - 2003. Y1 - 2003. N2 - Cellulose acetate (CA) was found to be a substrate of several acetyl xylan esterases (AXE). Eight AXE from different carbohydrate esterase (CE) families were tested on their activity against CA with a degree of substitution of 0.7 and 1.4. The classification of the AXEs into CE families according to their structure by hydrophobic cluster analysis followed clearly their activity against CA. Within the same CE family similar, and between the CE families different deacetylation behaviours could be observed. Furthermore, each esterase family showed a distinct regioselective mode of action. The CE 1 family enzymes regioselectively cleaved the substituents in C2- and ...
We describe the rapid and sensitive detection of 4-hydroxybutyric acid, which is a marker compound for succinic semialdehyde dehydrogenase (SSADH) deficiency. Urinary 4-hydroxybutyric acid and 3,4-dihydroxybutyric acid were targeted, quantified by gas chromatography-mass spectrometry after simplifie …
To evaluate a leucocyte esterase test as a predictor of gonorrhoea or chlamydia in asymptomatic Aboriginal males at the Central Australian Aboriginal Congress Male Clinic (Ingkintja), first-void urine samples and clinical information were collected from consecutive asymptomatic males presenting to the Ingkintja in Alice Springs between March 2008 and December 2009. Urine was tested immediately with a leucocyte esterase test dipstick and then by polymerase chain reaction for gonorrhoea and chlamydia. Among the 292 specimens from asymptomatic males, 15.4% were positive for gonorrhoea or chlamydia. In this group, compared with polymerase chain reaction result for gonorrhoea or chlamydia, leucocyte esterase test alone and in combination with age =35 years showed sensitivities of 66.7% and 60%, specificities of 90.7% and 94.7%, positive predictive values of 56.6% and 67.5%, negative predictive values of 93.7% and 92.8% and the area under receiver operating characteristics curve values of 0.79 and ...

carboxylic ester hydrolase activity | SGDcarboxylic ester hydrolase activity | SGD

... carboxylic acid esterase activity, carboxylic ester hydrolase activity, carboxylic esterase activity, cocaine esterase activity ... Gene Ontology Term: carboxylic ester hydrolase activity. GO ID. GO:0052689 Aspect. Molecular Function. Description. Catalysis ... carboxyl ester hydrolase activity, carboxylate esterase activity, carboxylesterase activity, ... of the hydrolysis of a carboxylic ester bond.. Synonyms. Ali-esterase activity, ali-esterase activity, alpha-carboxylesterase ...
more infohttps://www.yeastgenome.org/go/GO:0052689

Carboxylic Ester Hydrolases
     Summary Report | CureHunterCarboxylic Ester Hydrolases Summary Report | CureHunter

Enzymes which catalyze the hydrolysis of carboxylic acid esters with the formation of an alcohol and a carboxylic acid anion. ... Carboxylic Ester Hydrolases. Subscribe to New Research on Carboxylic Ester Hydrolases Enzymes which catalyze the hydrolysis of ... carboxylic acid esters with the formation of an alcohol and a carboxylic acid anion. ... Ester Hydrolases, Carboxylic; Hydrolases, Carboxylic Ester; Carboxylesterases. Networked: 40 relevant articles (1 outcomes, 3 ...
more infohttp://www.curehunter.com/public/keywordSummaryD002265.do

RCSB PDB 









- 1FDK: CARBOXYLIC ESTER HYDROLASE (PLA2-MJ33 INHIBITOR COMPLEX) Literature Report PageRCSB PDB - 1FDK: CARBOXYLIC ESTER HYDROLASE (PLA2-MJ33 INHIBITOR COMPLEX) Literature Report Page

CARBOXYLIC ESTER HYDROLASE (PLA2-MJ33 INHIBITOR COMPLEX). *DOI: 10.2210/pdb1fdk/pdb. *Classification: HYDROLASE ...
more infohttp://www.rcsb.org/pdb/explore/litView.do?structureId=1FDK

Sequence Similarity 









- 1LE7: CARBOXYLIC ESTER HYDROLASE, C 2 2 21 space group Sequence Similarity Report PageSequence Similarity - 1LE7: CARBOXYLIC ESTER HYDROLASE, C 2 2 21 space group Sequence Similarity Report Page

1LE7: Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.
more infohttp://www.rcsb.org/pdb/explore/sequenceCluster.do?structureId=1LE7

CES1 carboxylesterase 1 [Homo sapiens (human)] - Gene - NCBICES1 carboxylesterase 1 [Homo sapiens (human)] - Gene - NCBI

carboxylic ester hydrolase activity IBA Inferred from Biological aspect of Ancestor. more info ... retinyl ester hydrolase. serine esterase 1. triacylglycerol hydrolase. NP_001020365.1. *EC 3.1.1.1 ... cholesteryl ester hydrolase. cocaine carboxylesterase. egasyn. human monocyte/macrophage serine esterase 1. methylumbelliferyl- ... and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester ...
more infohttps://www.ncbi.nlm.nih.gov/gene?Db=gene&Cmd=ShowDetailView&TermToSearch=1066

Patent US4483921 - Immunoassay with antigen or antibody labeled liposomes sequestering enzyme - Google PatentsPatent US4483921 - Immunoassay with antigen or antibody labeled liposomes sequestering enzyme - Google Patents

3. Hydrolases. 3.1 Acting on ester bonds. 3.1.1 Carboxylic ester hydrolases ... diimide esters, aromatic and aliphatic diisocyanates, Bis-p-nitrophenyl esters of dicarboxylic acids, aromatic disulfonyl ... di- and triglycerides, long chain protonated fatty acids, sterol esters, long-chain alcohols, phytols, retinals, Vitamin A, ...
more infohttp://www.google.com/patents/US4483921?dq=6,952,563

Transcriptome analysis reveals the activation of neuroendocrine-immune system in shrimp hemocytes at the early stage of WSSV...Transcriptome analysis reveals the activation of neuroendocrine-immune system in shrimp hemocytes at the early stage of WSSV...

carboxylic ester hydrolase activity. cellular component biogenesis. 2. nucleus. cholinesterase activity. RNA metabolic process ...
more infohttps://link.springer.com/article/10.1186%2Fs12864-019-5614-4

Nuclear factor of activated T cells 2a - Xiphophorus maculatus (Southern platyfish)Nuclear factor of activated T cells 2a - Xiphophorus maculatus (Southern platyfish)

Carboxylic ester hydrolase. XENTR. 873. UniRef50_F7E2E8. RHD domain-containing protein. XENLA ...
more infohttps://www.uniprot.org/uniprot/M3ZP49

Center for Theoretical & Mathematical Sciences   » PeopleCenter for Theoretical & Mathematical Sciences » People

Carboxylic Ester Hydrolases • Carrier Proteins • Case-Control Studies • Cautery • cdc42 GTP-Binding Protein, Saccharomyces ... Hydrolases • Immunohistochemistry • Infant • Inflammation • Inheritance Patterns • Injections • Insect Hormones • Insect ...
more infohttp://fds.duke.edu/db/aas/math/ctms/faculty/hfn

Est-6 - Esterase-6 precursor - Drosophila melanogaster (Fruit fly) - Est-6 gene & proteinEst-6 - Esterase-6 precursor - Drosophila melanogaster (Fruit fly) - Est-6 gene & protein

carboxylic ester hydrolase activity Source: FlyBase ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a direct assay for ... A carboxylic ester + H2O = an alcohol + a carboxylate.PROSITE-ProRule annotation. ,p>Manual validated information which has ... Hydrolase, Serine esterase. Protein family/group databases. ESTHER database of the Alpha/Beta-hydrolase fold superfamily of ... Acyl-ester intermediatePROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the UniProtKB ...
more infohttp://www.uniprot.org/uniprot/P08171

KEGG ENZYME: 3.1.1.82KEGG ENZYME: 3.1.1.82

Hydrolases;. Acting on ester bonds;. Carboxylic-ester hydrolases. Sysname. pheophorbide-a hydrolase. ...
more infohttps://www.genome.jp/dbget-bin/www_bget?enzyme+3.1.1.82

KEGG ENZYME: 3.1.1.26KEGG ENZYME: 3.1.1.26

Hydrolases;. Acting on ester bonds;. Carboxylic-ester hydrolases. Sysname. 1,2-diacyl-3-beta-D-galactosyl-sn-glycerol ...
more infohttps://www.genome.jp/dbget-bin/www_bget?enzyme+3.1.1.26

Adipose overexpression of desnutrin promotes fatty acid use and attenuates diet-induced obesity.Adipose overexpression of desnutrin promotes fatty acid use and attenuates diet-induced obesity.

Carboxylic Ester Hydrolases / genetics*, physiology. Cloning, Molecular. Energy Intake*. Female. Lipase / metabolism. Lipolysis ... 122-32-7/Triolein; 63231-63-0/RNA; EC 3.1.1.-/Carboxylic Ester Hydrolases; EC 3.1.1.1/desnutrin protein, mouse; EC 3.1.1.3/ ... TAG hydrolase activity of WAT extracts was performed essentially as described (10). Briefly, WAT was homogenized in lysis ... 1138899 - Effect of methoxyindole 2-carboxylic acid and 4-pentenoic acid on adipose tissue metabo.... 6165809 - Effect of ...
more infohttp://www.biomedsearch.com/nih/Adipose-overexpression-desnutrin-promotes-Fatty/19136649.html

NCEH1 Gene - GeneCards | NCEH1 Protein | NCEH1 AntibodyNCEH1 Gene - GeneCards | NCEH1 Protein | NCEH1 Antibody

Neutral Cholesterol Ester Hydrolase 1, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards ... serine hydrolase activity. IBA. --. GO:0042301. phosphate ion binding. IEA. --. GO:0052689. carboxylic ester hydrolase activity ... NCEH1 (Neutral Cholesterol Ester Hydrolase 1) is a Protein Coding gene. Among its related pathways are Bile secretion and ... Identification of neutral cholesterol ester hydrolase, a key enzyme removing cholesterol from macrophages. (PMID: 18782767) ...
more infohttp://www.genecards.org/cgi-bin/carddisp.pl?id_type=entrezgene&id=57552

DiVA - Search resultDiVA - Search result

Carboxylic ester hydrolase: a serum marker of acute pancreatitis1987In: Pancreas, ISSN 0885-3177, E-ISSN 1536-4828, Vol. 2, no ... Carboxylic ester hydrolase. A sensitive serum marker and indicator of severity of acute pancreatitis.1991In: International ... Hence, a raised carboxylic ester hydrolase level, even in presence of normal amylase, could be indicative of acute pancreatic ... Serum levels of carboxylic ester hydrolase and amylase were determined in 129 patients admitted due to abdominal emergency ...
more infohttp://umu.diva-portal.org/smash/resultList.jsf?searchType=ORGANISATION&language=en&onlyFullText=false&af=%5B%5D&aq=%5B%5B%7B%22organisationId%22%3A%22751%22%7D%5D%5D

Andersson, YvonneAndersson, Yvonne

Open this publication in new window or tab ,,Carboxylic ester hydrolase. A sensitive serum marker and indicator of severity of ... Blind, P.-J., Büchler, M., Bläckberg, L., Andersson, Y., Uhl, W., Beger, H. G. & Hernell, O. (1991). Carboxylic ester hydrolase ... Based on a clinical study, elevated serum levels of the pancreatic lipolytic enzyme carboxylic ester hydrolase (CEH) was ...
more infohttp://umu.diva-portal.org/smash/person.jsf?pid=authority-person%3A64983

EC 3.1.1.1EC 3.1.1.1

... carboxylic acid esterase; cocaine esterase. Systematic name: carboxylic-ester hydrolase. Comments: Wide specificity. The ... carboxylic esterase; methylbutyrate esterase; triacetin esterase; carboxyl ester hydrolase; butyrate esterase; methylbutyrase; ... Reaction: A carboxylic ester + H2O = an alcohol + a carboxylate. Other name(s): ali-esterase; B-esterase; monobutyrase; cocaine ... palmitoyl-CoA hydrolase), EC 3.5.1.4 (amidase) and EC 3.5.1.13 (aryl-acylamidase). Also hydrolyses vitamin A esters.. Links to ...
more infohttps://www.qmul.ac.uk/sbcs/iubmb/enzyme/EC3/1/1/1.html

The Development of Bacterial Carboxylesterase Biological Recognition Elements for Cocaine Detection | SpringerLinkThe Development of Bacterial Carboxylesterase Biological Recognition Elements for Cocaine Detection | SpringerLink

equi is a novel nonspecific carboxylic ester hydrolase. FEMS Microbiology Letters, 289, 181-186.CrossRefPubMedPubMedCentral ... Leinweber, F. J. (1987). Possible physiological roles of carboxyl ester hydrolases. Drug Metabolism Reviews, 18, 379-439. ... 1992). The alpha/beta hydrolase fold. Protein Engineering, 5, 197-211.CrossRefPubMedGoogle Scholar ... Nardini, M., & Dijkstra, B. W. (1999). a/ß hydrolase fold enzymes: The family keeps growing. Current Opinion in Structural ...
more infohttps://link.springer.com/article/10.1007%2Fs12033-018-0098-z

Gibberellic acid - DrugBankGibberellic acid - DrugBank

Carboxylic ester hydrolase activity. Specific Function. Not Available. Gene Name. AADACL2. Uniprot ID. Q6P093. Uniprot Name. ... Carboxylic acid ester / Secondary alcohol / LactoneCarboxylic acid derivative / Carboxylic acid / Oxacycle / Organoheterocyclic ... Carboxylic acid esters / Oxacyclic compounds / Carboxylic acidsOrganic oxides / Hydrocarbon derivatives / Carbonyl compounds. ... C19-gibberellin 6-carboxylic acids. Alternative Parents. Diterpene lactones / Gamma butyrolactones / Dicarboxylic acids and ...
more infohttps://www.drugbank.ca/drugs/DB07814

Methylphosphinic Acid - DrugBankMethylphosphinic Acid - DrugBank

Carboxylic ester hydrolase activity. Specific Function. Not Available. Gene Name. estA. Uniprot ID. P22266. Uniprot Name. ... Serine hydrolase activity. Specific Function. Terminates signal transduction at the neuromuscular junction by rapid hydrolysis ... Can degrade neurotoxic organophosphate esters.. Gene Name. BCHE. Uniprot ID. P06276. Uniprot Name. Cholinesterase. Molecular ... Can degrade neurotoxic organophosphate esters.. Gene Name. BCHE. Uniprot ID. P06276. Uniprot Name. Cholinesterase. Molecular ...
more infohttps://www.drugbank.ca/drugs/DB02845

Fatty acid ethyl ester synthase inhibition ameliorates ethanol-induced Ca2+-dependent mitochondrial dysfunction and acute...Fatty acid ethyl ester synthase inhibition ameliorates ethanol-induced Ca2+-dependent mitochondrial dysfunction and acute...

Carboxylic ester hydrolase. A sensitive serum marker and indicator of severity of acute pancreatitis. Int J Pancreatol 1991;8: ... Purification and characterization of a carboxyl ester hydrolase from human pancreatic juice. Biochim Biophys Acta 1978;527:142- ... and the carboxylic acid group of POA in the active site of CEL (figure 6A (i)). Interaction of Ser194 with the carboxylic acid ... Fatty acid ethyl esters: toxic non-oxidative metabolites of ethanol and markers of ethanol intake. Front Biosci 2003;8:e202-17. ...
more infohttps://gut.bmj.com/content/63/8/1313

Publications from UOBSPublications from UOBS

Aspidogaster conchicola: histochemical localization of carboxylic ester hydrolases. Exp. Parasitol. 32:181-190. ...
more infohttp://www.ou.edu/uobs/research/publications-from-uobs

Juvenile & Adult AspidogastreaJuvenile & Adult Aspidogastrea

... histochemical localization of carboxylic ester hydrolases. Experimental Parasitology 32, 181-190.. Watson, N. A. and Rohde, K ...
more infohttp://www.tolweb.org/accessory/Juvenile_&_Adult_Aspidogastrea?acc_id=1791

Juvenile & Adult AspidogastreaJuvenile & Adult Aspidogastrea

... histochemical localization of carboxylic ester hydrolases. Experimental Parasitology 32, 181-190.. Watson, N. A. and Rohde, K ...
more infohttp://www.tolweb.org/articles/?article_id=1791

FlyBase Gene Report: Dmel\CG5397FlyBase Gene Report: Dmel\CG5397

carboxylic ester hydrolase activity. inferred from biological aspect of ancestor with PANTHER:PTN000168392 ... A carboxylic ester + H(2)O = an alcohol + a carboxylate (3.1.1.1) ...
more infohttp://flybase.org/reports/FBgn0031327.html
  • The enzymes from microsomes also catalyse the reactions of EC 3.1.1.2 (arylesterase), EC 3.1.1.5 (lysophospholipase), EC 3.1.1.6 (acetylesterase), EC 3.1.1.23 (acylglycerol lipase), EC 3.1.1.28 (acylcarnitine hydrolase), EC 3.1.2.2 (palmitoyl-CoA hydrolase), EC 3.5.1.4 (amidase) and EC 3.5.1.13 (aryl-acylamidase). (qmul.ac.uk)
  • Objective Non-oxidative metabolism of ethanol (NOME) produces fatty acid ethyl esters (FAEEs) via carboxylester lipase (CEL) and other enzyme action implicated in mitochondrial injury and acute pancreatitis (AP). (bmj.com)
  • Bacterial carboxylesterases pnbA1 and pnbA2 mimic hCE1 and not hCE2 in its reaction pathways hydrolysing cocaine into benzoylecgonine and methanol rather than ecgonine methyl ester and benzoic acid. (springer.com)