Carbohydrate Epimerases: Enzymes that catalyze the epimerization of chiral centers within carbohydrates or their derivatives. EC 5.1.3.Racemases and Epimerases: Enzymes that catalyze inversion of the configuration around an asymmetric carbon in a substrate having one (racemase) or more (epimerase) center(s) of asymmetry. (Dorland, 28th ed) EC 5.1.UDPglucose 4-Epimerase: A necessary enzyme in the metabolism of galactose. It reversibly catalyzes the conversion of UDPglucose to UDPgalactose. NAD+ is an essential component for enzymatic activity. EC 5.1.3.2.Carbohydrates: The largest class of organic compounds, including STARCH; GLYCOGEN; CELLULOSE; POLYSACCHARIDES; and simple MONOSACCHARIDES. Carbohydrates are composed of carbon, hydrogen, and oxygen in a ratio of Cn(H2O)n.Carbohydrate Metabolism: Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.Dietary Carbohydrates: Carbohydrates present in food comprising digestible sugars and starches and indigestible cellulose and other dietary fibers. The former are the major source of energy. The sugars are in beet and cane sugar, fruits, honey, sweet corn, corn syrup, milk and milk products, etc.; the starches are in cereal grains, legumes (FABACEAE), tubers, etc. (From Claudio & Lagua, Nutrition and Diet Therapy Dictionary, 3d ed, p32, p277)Plesiomonas: A genus of gram-negative, facultatively anaerobic, rod-shaped bacteria that occurs in fish and other aquatic animals and in a variety of mammals, including man. Its organisms probably do not belong to the normal intestinal flora of man and can cause diarrhea.Azotobacter vinelandii: A species of gram-negative, aerobic bacteria first isolated from soil in Vineland, New Jersey. Ammonium and nitrate are used as nitrogen sources by this bacterium. It is distinguished from other members of its genus by the ability to use rhamnose as a carbon source. (From Bergey's Manual of Determinative Bacteriology, 9th ed)Iduronic Acid: Component of dermatan sulfate. Differs in configuration from glucuronic acid only at the C-5 position.Hexuronic Acids: Term used to designate tetrahydroxy aldehydic acids obtained by oxidation of hexose sugars, i.e. glucuronic acid, galacturonic acid, etc. Historically, the name hexuronic acid was originally given to ascorbic acid.Uronic Acids: Acids derived from monosaccharides by the oxidation of the terminal (-CH2OH) group farthest removed from the carbonyl group to a (-COOH) group. (From Stedmans, 26th ed)Glucuronic Acid: A sugar acid formed by the oxidation of the C-6 carbon of GLUCOSE. In addition to being a key intermediate metabolite of the uronic acid pathway, glucuronic acid also plays a role in the detoxification of certain drugs and toxins by conjugating with them to form GLUCURONIDES.Carbohydrate Sequence: The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.Alginates: Salts of alginic acid that are extracted from marine kelp and used to make dental impressions and as absorbent material for surgical dressings.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Substrate Specificity: A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.Carbohydrate Conformation: The characteristic 3-dimensional shape of a carbohydrate.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Crystallography, X-Ray: The study of crystal structure using X-RAY DIFFRACTION techniques. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)Sequence Alignment: The arrangement of two or more amino acid or base sequences from an organism or organisms in such a way as to align areas of the sequences sharing common properties. The degree of relatedness or homology between the sequences is predicted computationally or statistically based on weights assigned to the elements aligned between the sequences. This in turn can serve as a potential indicator of the genetic relatedness between the organisms.Models, Molecular: Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Sequence Homology, Amino Acid: The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.Kinetics: The rate dynamics in chemical or physical systems.Bacterial Proteins: Proteins found in any species of bacterium.Oligosaccharides: Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.Cloning, Molecular: The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.Antigens, Tumor-Associated, Carbohydrate: Carbohydrate antigens expressed by malignant tissue. They are useful as tumor markers and are measured in the serum by means of a radioimmunoassay employing monoclonal antibodies.Lectins: Proteins that share the common characteristic of binding to carbohydrates. Some ANTIBODIES and carbohydrate-metabolizing proteins (ENZYMES) also bind to carbohydrates, however they are not considered lectins. PLANT LECTINS are carbohydrate-binding proteins that have been primarily identified by their hemagglutinating activity (HEMAGGLUTININS). However, a variety of lectins occur in animal species where they serve diverse array of functions through specific carbohydrate recognition.Starch: Any of a group of polysaccharides of the general formula (C6-H10-O5)n, composed of a long-chain polymer of glucose in the form of amylose and amylopectin. It is the chief storage form of energy reserve (carbohydrates) in plants.Stereoisomerism: The phenomenon whereby compounds whose molecules have the same number and kind of atoms and the same atomic arrangement, but differ in their spatial relationships. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 5th ed)UTP-Glucose-1-Phosphate Uridylyltransferase: An enzyme that catalyzes the formation of UDPglucose from UTP plus glucose 1-phosphate. EC 2.7.7.9.Uridine Diphosphate Glucose: A key intermediate in carbohydrate metabolism. Serves as a precursor of glycogen, can be metabolized into UDPgalactose and UDPglucuronic acid which can then be incorporated into polysaccharides as galactose and glucuronic acid. Also serves as a precursor of sucrose lipopolysaccharides, and glycosphingolipids.Arabidopsis Proteins: Proteins that originate from plants species belonging to the genus ARABIDOPSIS. The most intensely studied species of Arabidopsis, Arabidopsis thaliana, is commonly used in laboratory experiments.Arabidopsis: A plant genus of the family BRASSICACEAE that contains ARABIDOPSIS PROTEINS and MADS DOMAIN PROTEINS. The species A. thaliana is used for experiments in classical plant genetics as well as molecular genetic studies in plant physiology, biochemistry, and development.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Complement Activation: The sequential activation of serum COMPLEMENT PROTEINS to create the COMPLEMENT MEMBRANE ATTACK COMPLEX. Factors initiating complement activation include ANTIGEN-ANTIBODY COMPLEXES, microbial ANTIGENS, or cell surface POLYSACCHARIDES.Complement C3: A glycoprotein that is central in both the classical and the alternative pathway of COMPLEMENT ACTIVATION. C3 can be cleaved into COMPLEMENT C3A and COMPLEMENT C3B, spontaneously at low level or by C3 CONVERTASE at high level. The smaller fragment C3a is an ANAPHYLATOXIN and mediator of local inflammatory process. The larger fragment C3b binds with C3 convertase to form C5 convertase.Complement System Proteins: Serum glycoproteins participating in the host defense mechanism of COMPLEMENT ACTIVATION that creates the COMPLEMENT MEMBRANE ATTACK COMPLEX. Included are glycoproteins in the various pathways of complement activation (CLASSICAL COMPLEMENT PATHWAY; ALTERNATIVE COMPLEMENT PATHWAY; and LECTIN COMPLEMENT PATHWAY).Complement C4: A glycoprotein that is important in the activation of CLASSICAL COMPLEMENT PATHWAY. C4 is cleaved by the activated COMPLEMENT C1S into COMPLEMENT C4A and COMPLEMENT C4B.Complement C5: C5 plays a central role in both the classical and the alternative pathway of COMPLEMENT ACTIVATION. C5 is cleaved by C5 CONVERTASE into COMPLEMENT C5A and COMPLEMENT C5B. The smaller fragment C5a is an ANAPHYLATOXIN and mediator of inflammatory process. The major fragment C5b binds to the membrane initiating the spontaneous assembly of the late complement components, C5-C9, into the MEMBRANE ATTACK COMPLEX.Receptors, Complement: Molecules on the surface of some B-lymphocytes and macrophages, that recognize and combine with the C3b, C3d, C1q, and C4b components of complement.Metabolic Networks and Pathways: Complex sets of enzymatic reactions connected to each other via their product and substrate metabolites.Cytidine Diphosphate Choline: Donor of choline in biosynthesis of choline-containing phosphoglycerides.Cytidine Diphosphate Diglycerides: The ester of diacylglycerol with the terminal phosphate of cytidine diphosphate. It serves as an intermediate in the biosynthesis of phosphatidylethanolamine and phosphatidylserine in bacteria.Cytosine NucleotidesHexosesNucleoside Diphosphate SugarsYersinia pseudotuberculosis: A human and animal pathogen causing mesenteric lymphadenitis, diarrhea, and bacteremia.Cytidine: A pyrimidine nucleoside that is composed of the base CYTOSINE linked to the five-carbon sugar D-RIBOSE.Flavobacteriaceae Infections: Infections with bacteria of the family FLAVOBACTERIACEAE.Flavobacteriaceae: A family of bacteria in the order Sphingobacteriales, class Sphingobacteria. They are gram-negative rods, mostly saprophytic in terrestrial and aquatic habitats.Chondroitin Lyases: Enzymes which catalyze the elimination of delta-4,5-D-glucuronate residues from polysaccharides containing 1,4-beta-hexosaminyl and 1,3-beta-D-glucuronosyl or 1,3-alpha-L-iduronosyl linkages thereby bringing about depolymerization. EC 4.2.2.4 acts on chondroitin sulfate A and C as well as on dermatan sulfate and slowly on hyaluronate. EC 4.2.2.5 acts on chondroitin sulfate A and C.Tenacibaculum: A genus of gram-negative, rod-shaped bacteria in the family FLAVOBACTERIACEAE. Tenacibaculum adheres to surfaces of marine organisms and is pathogenic to fish.Fish Diseases: Diseases of freshwater, marine, hatchery or aquarium fish. This term includes diseases of both teleosts (true fish) and elasmobranchs (sharks, rays and skates).Virulence: The degree of pathogenicity within a group or species of microorganisms or viruses as indicated by case fatality rates and/or the ability of the organism to invade the tissues of the host. The pathogenic capacity of an organism is determined by its VIRULENCE FACTORS.Genome, Bacterial: The genetic complement of a BACTERIA as represented in its DNA.

Tissue expression and amino acid sequence of murine UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase. (1/698)

Neuraminic acids are widely expressed as terminal carbohydrates on glycoconjugates and are involved in a variety of biological functions. The key enzyme of N-acetylneuraminic acid synthesis is UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase, which catalyses the first two steps of neuraminic acid biosynthesis in the cytosol. In this study we report the complete amino acid sequence of the mouse UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase. The ORF of 2166 bp encodes 722 amino acids and a protein with a predicted molecular mass of 79.2 kDa. Northern blot analysis and in situ hybridization revealed that UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase is expressed at early stages during development and in all tissues investigated with a maximal expression in the liver.  (+info)

The recombinant Azotobacter vinelandii mannuronan C-5-epimerase AlgE4 epimerizes alginate by a nonrandom attack mechanism. (2/698)

The Ca2+-dependent mannuronan C-5-epimerase AlgE4 is a representative of a family of Azotobacter vinelandii enzymes catalyzing the polymer level epimerization of beta-D-mannuronic acid (M) to alpha-L-guluronic acid (G) in the commercially important polysaccharide alginate. The reaction product of recombinantly produced AlgE4 is predominantly characterized by an alternating sequence distribution of the M and G residues (MG blocks). AlgE4 was purified after intracellular overexpression in Escherichia coli, and the activity was shown to be optimal at pH values between 6.5 and 7.0, in the presence of 1-3 mM Ca2+, and at temperatures near 37 degrees C. Sr2+ was found to substitute reasonably well for Ca2+ in activation, whereas Zn2+ strongly inhibited the activity. During epimerization of alginate, the fraction of GMG blocks increased linearly as a function of the total fraction of G residues and comparably much faster than that of MMG blocks. These experimental data could not be accounted for by a random attack mechanism, suggesting that the enzyme either slides along the alginate chain during catalysis or recognizes a pre-existing G residue as a preferred substrate in its consecutive attacks.  (+info)

Conversion of dTDP-4-keto-6-deoxyglucose to free dTDP-4-keto-rhamnose by the rmIC gene products of Escherichia coli and Mycobacterium tuberculosis. (3/698)

dTDP-rhamnose is made from glucose-1-phosphate and dTTP by four enzymes encoded by rmIA-D. An Escherichia coli rmIC mutant was constructed and a crude enzyme extract prepared from it did not produce dTDP-4-keto-rhamnose, in contrast to a crude enzyme extract prepared from a wild-type E. coli strain where small amounts of this intermediate were found after incubation with dTDP-glucose in the absence of NADPH. These results showed that dTDP-4-keto-rhamnose, the product of RmIC, exists as a free intermediate. Further, the Mycobacterium tuberculosis rmIC gene was expressed and incubation of the resulting purified M. tuberculosis RmIC enzyme with dTDP-4-keto-6-deoxyglucose resulted in the conversion of approximately 7% of dTDP-4-keto-6-deoxyglucose to dTDP-4-keto-rhamnose. The enzyme also allowed for the incorporation of two deuterium atoms from deuterium oxide solvent into dTDP-4-keto-glucose. Thus the rmIC gene encodes dTDP-4-keto-6-deoxyglucose epimerase capable of epimerizing at both C-3' and C-5'; this enzyme produces free dTDP-4-keto-rhamnose but the equilibrium of the 4-keto sugar nucleotides lies strongly on the side of the gluco configuration.  (+info)

The A modules of the Azotobacter vinelandii mannuronan-C-5-epimerase AlgE1 are sufficient for both epimerization and binding of Ca2+. (4/698)

The industrially important polysaccharide alginate is composed of the two sugar monomers beta-D-mannuronic acid (M) and its epimer alpha-L-guluronic acid (G). In the bacterium Azotobacter vinelandii, the G residues originate from a polymer-level reaction catalyzed by one periplasmic and at least five secreted mannuronan C-5-epimerases. The secreted enzymes are composed of repeats of two protein modules designated A (385 amino acids) and R (153 amino acids). The modular structure of one of the epimerases, AlgE1, is A1R1R2R3A2R4. This enzyme has two catalytic sites for epimerization, each site introducing a different G distribution pattern, and in this article we report the DNA-level construction of a variety of truncated forms of the enzyme. Analyses of the properties of the corresponding proteins showed that an A module alone is sufficient for epimerization and that A1 catalyzed the formation of contiguous stretches of G residues in the polymer, while A2 introduces single G residues. These differences are predicted to strongly affect the physical and immunological properties of the reaction product. The epimerization reaction is Ca2+ dependent, and direct binding studies showed that both the A and R modules bind this cation. The R modules appeared to reduce the Ca2+ concentration needed for full activity and also stimulated the reaction rate when positioned both N and C terminally.  (+info)

Mutations in the human UDP-N-acetylglucosamine 2-epimerase gene define the disease sialuria and the allosteric site of the enzyme. (5/698)

Sialuria is a rare inborn error of metabolism characterized by cytoplasmic accumulation and increased urinary excretion of free N-acetylneuraminic acid (NeuAc, sialic acid). Overproduction of NeuAc is believed to result from loss of feedback inhibition of uridinediphosphate-N-acetylglucosamine 2-epimerase (UDP-GlcNAc 2-epimerase) by cytidine monophosphate-N-acetylneuraminic acid (CMP-Neu5Ac). We report the cloning and characterization of human UDP-GlcNAc 2-epimerase cDNA, with mutation analysis of three patients with sialuria. Their heterozygote mutations, R266W, R266Q, and R263L, indicate that the allosteric site of the epimerase resides in the region of codons 263-266. The heterozygous nature of the mutant allele in all three patients reveals a dominant mechanism of inheritance for sialuria.  (+info)

UDP-GlcNAc 2-epimerase: a regulator of cell surface sialylation. (6/698)

Modification of cell surface molecules with sialic acid is crucial for their function in many biological processes, including cell adhesion and signal transduction. Uridine diphosphate-N-acetylglucosamine 2-epimerase (UDP-GlcNAc 2-epimerase) is an enzyme that catalyzes an early, rate-limiting step in the sialic acid biosynthetic pathway. UDP-GlcNAc 2-epimerase was found to be a major determinant of cell surface sialylation in human hematopoietic cell lines and a critical regulator of the function of specific cell surface adhesion molecules.  (+info)

A novel NDP-6-deoxyhexosyl-4-ulose reductase in the pathway for the synthesis of thymidine diphosphate-D-fucose. (7/698)

The serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b) consists of D-fucose and L-rhamnose. Thymidine diphosphate (dTDP)-D-fucose is the activated nucleotide sugar form of D-fucose, which has been identified as a constituent of structural polysaccharides in only a few bacteria. In this paper, we show that three dTDP-D-fucose synthetic enzymes are encoded by genes in the gene cluster responsible for the synthesis of serotype b-specific polysaccharide in A. actinomycetemcomitans. The first and second steps of the dTDP-D-fucose synthetic pathway are catalyzed by D-glucose-1-phosphate thymidylyltransferase and dTDP-D-glucose 4,6-dehydratase, which are encoded by rmlA and rmlB in the gene cluster, respectively. These two reactions are common to the well studied dTDP-L-rhamnose synthetic pathway. However, the enzyme catalyzing the last step of the dTDP-D-fucose synthetic pathway has never been reported. We identified the fcd gene encoding a dTDP-4-keto-6-deoxy-D-glucose reductase. After purifying the three enzymes, their enzymatic activities were analyzed by reversed-phase high performance liquid chromatography. In addition, nuclear magnetic resonance analysis and gas-liquid chromatography analysis proved that the fcd gene product converts dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose. Moreover, kinetic analysis of the enzyme indicated that the Km values for dTDP-4-keto-6-deoxy-D-glucose and NADPH are 97.3 and 28.7 microM, respectively, and that the enzyme follows the sequential mechanism. This paper is the first report on the dTDP-D-fucose synthetic pathway and dTDP-4-keto-6-deoxy-D-glucose reductase.  (+info)

Decreased availability of GDP-L-fucose in a patient with LAD II with normal GDP-D-mannose dehydratase and FX protein activities. (8/698)

Leukocyte adhesion deficiency type II (LAD II) is caused by a disorder in the metabolism of GDP-L-fucose, which causes hypofucosylation of glycoconjugates. This study analyzes a newly identified LAD II patient who shows the same severe hypofucosylation of glycoconjugates as the other described patients. However, in vitro assays of cytosolic extracts from leukocytes and fibroblasts of the patient demonstrated a normal GDP-L-fucose biosynthesis from GDP-D-mannose. Analysis of the two enzymes involved in the pathway, GDP-D-mannose 4,6-dehydratase and FX protein, revealed normal numbers of transcripts without any detectable mutations within the coding regions of either gene. In contrast to previously published observations [Sturla et al. (1998) FEBS Lett. 429, 274-278], the major pathway of GDP-L-fucose synthesis can be normal in LAD II.  (+info)

rat GALM/Galactose Mutarotase gene cDNA, cloning vector & expression plasmid, mutiple tags. Optimized for high expression in mammalian cells. Save up to 60%.
2002 (English)In: Handbook of glycosyltransferases and related genes / [ed] N. Taniguchi, K. Honke, M. Fukuda, Tokyo: Springer , 2002, 403-409 p.Chapter in book (Other academic) ...
THE JOURNAL OF BIOLOGICAL CHEMISTRY 2005 by The American Society for Biochemistry and Molecular Biology Inc Vol 280 No 23 Issue of June 10 pp 21900 2…
Carbohydrate Epimerases: Enzymes that catalyze the epimerization of chiral centers within carbohydrates or their derivatives. EC 5.1.3.
galM_1; aldose 1-epimerase,Aldose 1-epimerase,galactose-1-epimerase,galactose mutarotase,Aldose 1-epimerase; K01785 aldose 1-epimerase [EC:5.1.3.3] ...
Phosphorylation of oligosaccharides of the lysosomal enzyme arylsulphatase A (ASA), which accumulate in the secretions of cells that mis-sort most of the newly synthesized lysosomal enzymes due to a deficiency of mannose 6-phosphate receptors, was found to be site specific. ASA residing within the secretory route of these cells contains about one third of the incorporated [2-3H]mannose in phosphorylated oligosaccharides. Oligosaccharides carrying two phosphate groups are almost 2-fold less frequent than those with one phosphate group and only a few of the phosphate groups are uncovered. Addition of a KDEL (Lys-Asp-Glu-Leu) retention signal prolongs the residence time of ASA within the secretory route 6-fold, but does not result in more efficient phosphorylation. In contrast, more than 90% of the [2-3H]mannose incorporated into secreted ASA (with or without a KDEL retention signal) is present in phosphorylated oligosaccharides. Those with two phosphate groups are almost twice as frequent as those ...
Shop L-fucose mutarotase ELISA Kit, Recombinant Protein and L-fucose mutarotase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
In enzymology, an aldose 1-epimerase (EC 5.1.3.3) is an enzyme that catalyzes the chemical reaction alpha-D-glucose ⇌ {\displaystyle \rightleftharpoons } beta-D-glucose Hence, this enzyme has one substrate, alpha-D-glucose, and one product, beta-D-glucose. This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and derivatives. The systematic name of this enzyme class is aldose 1-epimerase. Other names in common use include mutarotase, and aldose mutarotase. This enzyme participates in glycolysis and gluconeogenesis. As of late 2007, 23 structures have been solved for this class of enzymes, with PDB accession codes 1L7J, 1L7K, 1LUR, 1MMU, 1MMX, 1MMY, 1MMZ, 1MN0, 1NS0, 1NS2, 1NS4, 1NS7, 1NS8, 1NSM, 1NSR, 1NSS, 1NSU, 1NSV, 1NSX, 1NSZ, 1SNZ, 1SO0, and 1YGA. Bentley R; Bhate DS (1960). "Mutarotase from Penicillium notatum. I. Purification, assay, and general properties of the enzyme" (PDF). J. Biol. Chem. 235 (5): 1219-1224. PMID ...
Human GLCE full-length ORF ( NP_056369.1, 1 a.a. - 617 a.a.) recombinant protein with GST-tag at N-terminal. (H00026035-P01) - Products - Abnova
Numerous hits in gapped BLAST to ribulose-5-phosphate 3-epimerases; e.g. residues 3-205 are 29% similar to (AE000716) ribulose-5-phosphate 3-epimerase of Aquifex aeolicus; residues 7-198 are 26% similar to RPE_SPIOL; and residues 32-198 are 29% similar to RPE_MYCTU ...
J:185112 Park D, Choi D, Lee J, Lim DS, Park C, Male-like sexual behavior of female mouse lacking fucose mutarotase. BMC Genet. 2010;11:62 ...
Dr. Rebecca L. Takahashi has a 5.0/5 rating from patients. Visit RateMDs for Dr. Rebecca L. Takahashi reviews, contact info, practice history, affiliated hospitals & more.
avec le Ray Hahn Band en 1946 Speedy West ! voila un pionnier ! la Zique quil a pondu avec Jimmy Bryant na jamais t s gal e ni m me vraiment repris depuis
AlgE1, AlgE5 and AlgE6 are members of a family of mannuronan C-5 epimerases encoded by the bacterium Azotobacter vinelandii, and are active in the biosynthesis of alginate, where they catalyse the post-polymerization conversion of β-D-mannuronic acid (M) residues into α-L-guluronic acid residues (G). All enzymes show preference for introducing G-residues neighbouring a pre-existing G. They also have the capacity to convert single M residues flanked by G, thus condensing G-blocks to form almost homopolymeric guluronan. Analysis of the length and distribution of G-blocks based on specific enzyme degradation combined with size-exclusion chromatography, electrospray ionization MS, HPAEC-PAD (high-performance anion-exchange chromatography and pulsed amperometric detection), MALDI (matrix-assisted laser-desorption ionization)-MS and NMR revealed large differences in block length and distribution generated by AlgE1 and AlgE6, probably reflecting their different degree of processivity. When acting ...
In order to overproduce D-xylose isomerase, the Escherichia coli D-xylose isomerase (D-xylose ketol-isomerase, EC 5.3.1.5) gene (xylA) was fused to ${\lambda}P_{L}$ promoter. The promoterless xylA gene containing the ribosome binding site and coding region for D-xylose isomerase was cloned into a ...
The development of lymphoid organs depends on cross talk between hematopoietic cells and mesenchymal stromal cells and on vascularization of the lymphoid primordia. These processes are orchestrated by cytokines, chemokines, and angiogenic factors that require tight spatiotemporal regulation. Heparan sulfate (HS) proteoglycans are molecules designed to specifically bind and regulate the bioactivity of soluble protein ligands. Their binding capacity and specificity are controlled by modification of the HS side chain by HS-modifying enzymes. Although HS proteoglycans have been implicated in the morphogenesis of several organ systems, their role in controlling lymphoid organ development has thus far remained unexplored. In this study, we report that modification of HS by the HS-modifying enzyme glucuronyl C5-epimerase (Glce), which controls HS chain flexibility, is required for proper lymphoid organ development. Glce(-/-) mice show a strongly reduced size of the fetal spleen as well as a spectrum of ...
Complete information for GNE gene (Protein Coding), Glucosamine (UDP-N-Acetyl)-2-Epimerase/N-Acetylmannosamine Kinase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Exhibits fucose binding activity and racemase and epimerase activity, acting on carbohydrates and derivatives. Involved in several processes, including female mating behavior; fucose metabolic process; and negative regulation of neuron differentiation. Orthologous to human FUOM (fucose mutarotase ...
1997-2006 Healthboard.com. Healthboard.com is a purely informational website, and should not be used as a substitute for professional legal, medical or technical advice. ...
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...
Shop L-ribulose-5-phosphate 4-epimerase ELISA Kit, Recombinant Protein and L-ribulose-5-phosphate 4-epimerase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
D-xylose isomerase (XI) is capable of sugar isomerization and slow conversion of some monosaccharides into their C2-epimers. We present X-ray and neutron ...
GALE antibody [N2C3] (UDP-galactose-4-epimerase) for WB. Anti-GALE pAb (GTX114419) is tested in Human samples. 100% Ab-Assurance.
MetabolismCentral intermediary metabolismAmino sugarsglucosamine-6-phosphate deaminase (TIGR00502; EC 3.5.99.6; HMM-score: 33.2) ...
Dr. Naoto Takahashi is currently affiliated to Third Department of Internal Medicine, Akita University School of Medicine, Japan, continuing research in the specialize..
Alginate is a family of industrially important polysaccharides composed of irregular sequences of 1-4 linked β-D-mannuronic acid (M) and α-L-guluronic acid (G). They are widely used industrially as iscosifiers and gelling agents. Medical applications include utilization as dental impression materials, wound dressings and as an encapsulation matrix for cell transplants in the treatment of various diseases. Some alginates are immunogenic or have anti-tumor activity.. Commercial alginates are extracted from brown seaweeds, but the polymer is also produced by members of the bacterial genera Pseudomonas and Azotobacter. Probably in all species the alginate is first synthesized as polymannuronic acid, and then the guluronic acid moieties are introduced at the postpolymerization level by the action of mannuronan C-5- epimerases. Azotobacter vinelandii encodes a family of 7 secreted, Ca2+ -dependent mannuronan C-5-epimerases, AlgE1-7, which are composed of varying numbers of two types of structural ...
GNE myopathy, previously known as Hereditary Inclusion Body Myopathy (HIBM), or Nonaka Myopathy, is an autosomal recessive myopathy with onset in early adulthood characterized by progressive muscle atrophy and weakness. The causative gene, GNE, encodes for the bifunctional enzyme UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) that catalyzes the rate-limiting step in the biosynthesis of sialic acid (Neu5Ac). The subsequent impairment of Neu5Ac production is presumed to cause decreased sialylation of GNE myopathy muscle glycoproteins, resulting in muscle deterioration. In this protocol, we will clinically evaluate patients with GNE myopathy. To date, the amount of prospectively collected and published natural history data on GNE myopathy has been minimal due to the rare nature of this disease. This natural history study seeks to further characterize the phenotype, progression and complications of the disease. Additionally, the study is designed to identify endpoints and ...
GNE myopathy, also known as Hereditary Inclusion Body Myopathy (HIBM) is an autosomal recessive myopathy with onset in early adulthood characterized by progressive muscle weakness. The causative gene, GNE, codes for the bifunctional enzyme UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) that catalyzes the first two steps in the biosynthesis of sialic acid (SA). The subsequent paucity of SA production is presumed to cause decreased sialylation of GNE myopathy muscle glycoproteins, resulting in muscle deterioration. To date, the amount of prospectively collected and published natural history data on GNE myopathy has been minimal due to the rare nature of this disease. This natural history study seeks to further characterize the rate of progression of the disease and how it relates to age of onset. Additionally, the study is designed to elucidate functional outcome measures (endpoints) for future therapeutic trials, and correlate serum biomarkers and muscle magnetic resonance ...
In enzymology, a xylose isomerase (EC 5.3.1.5) is an enzyme that catalyzes the interconversion of D-xylose and D-xylulose. This enzyme belongs to the family of isomerases, specifically those intramolecular oxidoreductases interconverting aldoses and ketoses. The isomerase has now been observed in nearly a hundred species of bacteria. Xylose-isomerases are also commonly called fructose-isomerases due to their ability to interconvert glucose and fructose. The systematic name of this enzyme class is D-xylose aldose-ketose-isomerase. Other names in common use include D-xylose isomerase, D-xylose ketoisomerase, and D-xylose ketol-isomerase. The activity of D-xylose isomerase was first observed by Mitsuhashi and Lampen in 1953 in the bacterium Lactobacillus pentosus. Artificial production through transformed E.coli have also been successful. In 1957, the D-xylose isomerase activity on D-glucose conversion to D-fructose was noted by Kooi and Marshall. It is now known that isomerases have broad ...
Component of a complex that catalyzes the oxidation of glycolate to glyoxylate (PubMed:4557653, PubMed:8606183). Is required for E.coli to grow on glycolate as a sole source of carbon (PubMed:8606183). Is also able to oxidize D-lactate ((R)-lactate) with a similar rate (PubMed:4557653). Does not link directly to O(2), and 2,6-dichloroindophenol (DCIP) and phenazine methosulfate (PMS) can act as artificial electron acceptors in vitro, but the physiological molecule that functions as primary electron acceptor during glycolate oxidation is unknown (PubMed:4557653).
Heparan sulfate (HS) and heparin are linear polysaccharide chains covalently O-linked to serine residues within the core proteins, so called HS proteoglycans (PGs) or heparin PG. HSPGs are produced by almost all mammalian cells and known to play important roles in developmental processes, physiological and pathological conditions; whereas heparin PG is produced by mast cells and best known as an anticoagulant in clinic.Biosynthesis of HS/heparin occurs in Golgi compartment and involves many enzymes, one of which is glucuronyl C5-epimerase (Hsepi) that catalyzes the conversion of D-glucuronic acid (GlcA) to L-iduronic acid (IdoA). Heparanase is an enzyme involved in metabolism of HS; it cleaves the linkage between GlcA and glucosamine residues in HS/heparin chains. Heparanase is expressed essentially by all cells and found up-regulated in many metastatic tumors.This thesis focuses on the structure and functions of HS/heparin through studies on the implications of Hsepi and heparanase. My study ...
We have generated two transgenic mice strains (one is overexpressing the mutated key enzyme of the sialic acid biosynthesis, which leads to high sialic acid levels and one has a defect in the sialic acid biosynthesis). Both strains will be compared with wild-type animals. We plan to analyse O-GlcNAc, sialic acid, sialic acid binding proteins and sialic acid-dependent differentiation markers in all organs over the whole lifespan and quantify age-dependent muscle performance in vivo. The outcome of metabolic sialic acid engineering will be analysed in embryonic stem cells (differentiation) and neuronal cells (neurite outgrowth e.g. regeneration). We also plan to analyse the involvement of sialylation and O-GlcNAcylation on the function of endothelial cells. After metabolic engineering we will analyse their barrier capacity and age-related impact on neuronal cells by real-time cell analysis. Since high levels of glucose induce glycation of proteins, we will analyse the function of an artificial ...
We have generated two transgenic mice strains (one is overexpressing the mutated key enzyme of the sialic acid biosynthesis, which leads to high sialic acid levels and one has a defect in the sialic acid biosynthesis). Both strains will be compared with wild-type animals. We plan to analyse O-GlcNAc, sialic acid, sialic acid binding proteins and sialic acid-dependent differentiation markers in all organs over the whole lifespan and quantify age-dependent muscle performance in vivo. The outcome of metabolic sialic acid engineering will be analysed in embryonic stem cells (differentiation) and neuronal cells (neurite outgrowth e.g. regeneration). We also plan to analyse the involvement of sialylation and O-GlcNAcylation on the function of endothelial cells. After metabolic engineering we will analyse their barrier capacity and age-related impact on neuronal cells by real-time cell analysis. Since high levels of glucose induce glycation of proteins, we will analyse the function of an artificial ...
1FSF: Structural flexibility, an essential component of the allosteric activation in Escherichia coli glucosamine-6-phosphate deaminase.
1JT9: On the role of the conformational flexibility of the active-site lid on the allosteric kinetics of glucosamine-6-phosphate deaminase.
Triosephosphate isomerase antibody, C-term (triosephosphate isomerase 1) for IHC-P, WB. Anti-Triosephosphate isomerase pAb (GTX89594) is tested in Human, Mouse samples. 100% Ab-Assurance.
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Striving to create factories measuring several dozen mm wide and several mm deep. When we can see things which we have never been able to see before, and create things we have never been able to create before, cell-in-micro-factories will integrate these optical manufacturing technologies. These factories, smaller by far than anything that has come before, are Professor Takahashis own original idea. The smallest factories which exist today are "desktop micro-factories," which consist of machine tools such as micro-lathes. Cell-in-micro-factories, measuring just several dozen millimeters wide by several millimeters deep, are to contain the most advanced optical technologies, performing everything from measurement, processing, and handling to conveyance and defect detection. The objects they manufacture will measure less than 1 millimeter. When asked where his creativity springs from, Professor Takahashi answers, "I come from Kansai, so I love comedy. Comedy consists of gaps, right? I think ...
Harvard was the first institution of higher education in the United States to address worker equity issues when the University instituted its Wage and Benefit Parity Policy (WBPP) in 2002.
Affiliation:医科歯科大,助教授, Research Field:Surgical dentistry,外科・放射線系歯学, Keywords:口腔癌,LAK細胞,養子免疫療法,HLA,CD80,DQB1,LAK,DPB1,DRB1,インターロイキン2, # of Research Projects:15, # of Research Products:0
Studied to be used in hospitals and physiotherapy clinics, Medisound 3000 has technical and software-management features developed to meet the needs of any medical rehabilitation center ...
Buy our Recombinant Human Triosephosphate isomerase protein. Ab88134 is a full length protein produced in Saccharomyces cerevisiae and has been validated in…
Saccharomyces cerevisiae strains expressing D-xylose isomerase (XI) produce some of the highest reported ethanol yields from D-xylose. Unfortunately, most bacterial XIs that have been expressed in S. cerevisiae are either not functional, require additional strain modification, or have low affinity for D-xylose. This study analyzed several XIs from rumen and intestinal microorganisms to identify enzymes with improved properties for engineering S. cerevisiae for D-xylose fermentation. Four XIs originating from rumen and intestinal bacteria were isolated and expressed in a S. cerevisiae CEN.PK2-1C parental strain primed for D-xylose metabolism by over expression of its native D-xylulokinase. Three of the XIs were functional in S. cerevisiae, based on the strains ability to grow in D-xylose medium. The most promising strain, expressing the XI mined from Prevotella ruminicola TC2-24, was further adapted for aerobic and fermentative growth by serial transfers of D-xylose cultures under aerobic, and followed
Looking for online definition of ribulose-phosphate 3-epimerase in the Medical Dictionary? ribulose-phosphate 3-epimerase explanation free. What is ribulose-phosphate 3-epimerase? Meaning of ribulose-phosphate 3-epimerase medical term. What does ribulose-phosphate 3-epimerase mean?
In order for an accidentally generated string of letters to convey a meaningful message, it needs to satisfy three very stringent conditions, each more difficult than the last: first, the letters need to be arranged into meaningful words; second, the sequence of words has to conform to the rules of syntax; and finally, the sequence of words has to make sense at the semantic level: in other words, it needs to express a meaningful proposition. For a string of letters generated at random to meet all of these conditions would indeed be fantastically improbable. But heres the thing: living things dont need to satisfy any of these conditions. Yes, it is true that all living things possess a genetic code. But it is quite impossible for this code to generate anything like nonsense words like "sdfuiop", and additionally, there is nothing in the genome which is remotely comparable to the rules of syntax, let alone the semantics of a meaningful proposition. The sequence of amino acids in a protein needs ...
Structure of L-xylulose-5-phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold
Gentaur molecular products has all kinds of products like :search , Nordic Immunological Lab \ rabbit IgG against bakers yeast Triosephosphate isomerase, conjugated with Biotin \ NE155/Bio for more molecular products just contact us
Lactococcus lactis subsp. lactis (Lactobacillus xylosus) strain NRRL B-4449xylose regulatory protein (xylR), xylose isomerase (xylA), xylulokinase(xylB), mutarotase (xylM), and xyloside transporter (xynT) genes, completecds; and beta-1,4-xylosidase (xynB) gene, partial ...
8xia: X-ray analysis of D-xylose isomerase at 1.9 A: native enzyme in complex with substrate and with a mechanism-designed inactivator.
van Tilbeurgh, H., J. Jenkins, M. Chiadmi, J. Janin, S. J. Wodak, N. T. Mrabet, and A. M. Lambeir, Protein engineering of xylose (glucose) isomerase from Actinoplanes missouriensis. 3. Changing metal specificity and the pH profile by site-directed mutagenesis., Biochemistry, vol. 31, issue 24, pp. 5467-71, 1992 Jun 23. ...
van Tilbeurgh, H., J. Jenkins, M. Chiadmi, J. Janin, S. J. Wodak, N. T. Mrabet, and A. M. Lambeir, Protein engineering of xylose (glucose) isomerase from Actinoplanes missouriensis. 3. Changing metal specificity and the pH profile by site-directed mutagenesis., Biochemistry, vol. 31, issue 24, pp. 5467-71, 1992 Jun 23. ...
Triose Phosphate Isomerase, Abundant Glycolytic Enzyme; MRNA Half-life Is Regulated By Iron Availability; Transcription Is Controlled By Activators Reb1p, Gcr1p, And Rap1p Through Binding Sites In The 5 Non-coding Region; Inhibition Of Tpi1p Activity By PEP (phosphoenolpyruvate) Stimulates Redox Metabolism In Respiring Cells; E104D Mutation In Human TPI Causes A Rare Autosomal Disease
Cell Wall and Capsule - no subcategoryUDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis Glucosamine-6-phosphate deaminase (EC 3.5.99.6) ...
Ichinose, M., Miki, K., Tatematsu, M., Mizuno, T., Mutai, M., Furihata, C., Ichihara, Y., Ishihara, T., Tanji, M., Oka, H., Hinohara, Y., Takahashi, T., Kageyama, T. & Takahashi, K., 9 15 1988, : : Biochemical and Biophysical Research Communications. 155, 2, p. 670-677 8 p.. 研究成果: ジャーナルへの寄稿 › 記事 ...
Im not quite sure why it has taken me so long to get around recording my own thoughts on through a quiet window? Knowing that the book was in offing the 1 news information network celebrating works rumiko takahashi.
Vente E liquide cbd avec terpenes ou e liquide cbd plus fort - CBD légal - E liquide cbd avec terpenes : e liquide cbd plus fort Les produits alimentaires méntionnés sur la e liquide cbd 2018 cigarette électronique pourrait-elle
4-5 Novembre 2015 Palais des Congrès, Montréal, Quebec, Canada NOUVEAU! NEW! Concentré ressources. Innovation centrée. Waste & Recycling Expo Canada offre une plate-forme inégalée d établir et de développer
1 ]Dong C, Beis K, Giraud MF, Blankenfeldt W, Allard S, Major LL, Kerr ID, Whitfield C, Naismith JH. A structural perspective on the enzymes that convert dTDP-d-glucose into dTDP-l-rhamnose. Biochem Soc Trans. 2003 Jun;31(Pt 3):532-6. PMID 12773151 ...
Affiliation:北海道大学,医学研究院,講師, Research Field:General medical chemistry,Pathological medical chemistry,Tumor biology and related fields,Tumor biology, Keywords:転写,RNAポリメラーゼII,発現制御,腫瘍,転写制御,がん,転写因子,ユビキチン,転写伸長因子,腫瘍性疾患, # of Research Projects:9, # of Research Products:70, Ongoing Project:新規の転写伸長制御因子Med26を標的とした腫瘍治療シーズ開発基盤の確立
Sunturnbrew is a American Barleywine style beer brewed by Nøgne Ø - Det Kompromissløse Bryggeri A/S in Grimstad, Norway. 3.81 average with 243 ratings, reviews and opinions.
4-O-beta-D-mannopyranosyl-N-acetyl-D-glucosamine + phosphate = N-acetyl-D-glucosamine + alpha-D-mannose 1-phosphate [RN:R10829 ...
We present a comprehensive report of two siblings with hereditary inclusion body myopathy (HIBM). The clinical features and histological characteristics of the muscle biopsies showed the typical pattern of predominantly distal vacuolar myopathy with quadriceps sparing. This was confirmed by muscle MRI. PNA lectin staining showed an increased signal at the sarcolemma in patient muscle sections compared to control muscle, indicating reduced sialylation of glycoconjugates. Mutation analysis revealed compound heterozygous mutations in the GNE gene, encoding the key enzyme in sialic acid synthesis UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase: a missense mutation (c.2086G > A; p.V696M) previously described in HIBM patients of Indian origin, and a novel frame shift mutation (c.1295delA; p.K432RfsX17) leading to a premature stopcodon. These findings confirmed the diagnosis of HIBM on the histological, molecular and biochemical level ...
Recombinant Peptidylprolyl Isomerase B (Cyclophilin B) (PPIB) Peptide. Species: Human. Source: Escherichia coli (E. coli). Order product ABIN934947.
TY - JOUR. T1 - Structural basis for substrate specificity in phosphate binding (β/α)8-barrels. T2 - D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12. AU - Chan, Kui K.. AU - Fedorov, Alexander A.. AU - Fedorov, Elena V.. AU - Almo, Steven C.. AU - Gerlt, John A.. PY - 2008/9/9. Y1 - 2008/9/9. N2 - Enzymes that share the (β/α)8-barrel fold catalyze a diverse range of reactions. Many utilize phosphorylated substrates and share a conserved C-terminal (β/α)2-quarter barrel subdomain that provides a binding motif for the dianionic phosphate group. We recently reported functional and structural studies of D-ribulose 5-phosphate 3-epimerase (RPE) from Streptococcus pyogenes that catalyzes the equilibration of the pentulose 5-phosphates D-ribulose 5-phosphate and D-xylulose 5-phosphate in the pentose phosphate pathway [J. Akana, A. A. Fedorov, E. Fedorov, W. R. P. Novack, P. C. Babbitt, S. C. Almo, and J. A. Gerlt (2006) Biochemistry 45, 2493-2503]. We now report functional and ...
The SCOP classification for the Triosephosphate isomerase (TIM) superfamily including the families contained in it. Additional information provided includes InterPro annotation (if available), Functional annotation, and SUPERFAMILY links to genome assignments, alignments, domain combinations, taxonomic visualisation and hidden Markov model information.
Company profile & key executives for Housing Takahashi KK (0658203D:-) including description, corporate address, management team and contact info.
Markram H, Muller E, Ramaswamy S, Reimann MW, Abdellah M, Sanchez CA, Ailamaki A, Alonso-Nanclares L, Antille N, Arsever S, Kahou GA, Berger TK, Bilgili A, Buncic N, Chalimourda A, Chindemi G, Courcol JD, Delalondre F, Delattre V, Druckmann S, Dumusc R, Dynes J, Eilemann S, Gal E, Gevaert ME, Ghobril JP, Gidon A, Graham JW, Gupta A, Haenel V, Hay E, Heinis T, Hernando JB, Hines M, Kanari L, Keller D, Kenyon J, Khazen G, Kim Y, King JG, Kisvarday Z, Kumbhar P, Lasserre S, Le Be JV, Magalhães BR, Merchan-Perez A, Meystre J, Morrice BR, Muller J, Muñoz-Cespedes A, et al. (2015) [PubMed ...
Markram H, Muller E, Ramaswamy S, Reimann MW, Abdellah M, Sanchez CA, Ailamaki A, Alonso-Nanclares L, Antille N, Arsever S, Kahou GA, Berger TK, Bilgili A, Buncic N, Chalimourda A, Chindemi G, Courcol JD, Delalondre F, Delattre V, Druckmann S, Dumusc R, Dynes J, Eilemann S, Gal E, Gevaert ME, Ghobril JP, Gidon A, Graham JW, Gupta A, Haenel V, Hay E, Heinis T, Hernando JB, Hines M, Kanari L, Keller D, Kenyon J, Khazen G, Kim Y, King JG, Kisvarday Z, Kumbhar P, Lasserre S, Le Bé JV, Magalhães BR, Merchán-Pérez A, Meystre J, Morrice BR, Muller J, Muñoz-Céspedes A, Muralidhar S, Muthurasa K, Nachbaur D, Newton TH, Nolte M, Ovcharenko A, Palacios J, Pastor L, Perin R, Ranjan R, Riachi I, Rodríguez JR, Riquelme JL, Rössert C, Sfyrakis K, Shi Y, Shillcock JC, Silberberg G, Silva R, Tauheed F, Telefont M, Toledo-Rodriguez M, Tränkler T, Van Geit W, Díaz JV, Walker R, Wang Y, Zaninetta SM (2015) [PubMed ...
Recombinant human RPE protein, fused to His-tag at N-terminus,was expressed in E. coli and purified byusing conventional chromatography techniques.
CP001606.PE120 Location/Qualifiers FT CDS complement(138087..138875) FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Balat_0124" FT /product="NAD-dependent epimerase/dehydratase" FT /note="COG0702 Predicted nucleoside-diphosphate-sugare FT pimerases" FT /db_xref="EnsemblGenomes-Gn:Balat_0124" FT /db_xref="EnsemblGenomes-Tr:ACS47085" FT /protein_id="ACS47085.1" FT /translation="MKPTHVLVVGASGSIGRHAVEKARAAGYRVRALVRDPSRIHFGCG FT VEVVQGDLTSVESMRQALDGIDGIVFTHGSNGGPTLTETVDYGAVRNALEALDGRPARI FT ALMTSIGVTNMDNDYNRSTEAHDWKRHSERLVRASGNEYTIVRPGWFDMEGADEHQLKF FT EQGDRRDPMGPQDGSAARRQVAQTLVDALGCKEADHKTLELIDVAGTAQTDAELASMFA FT ALQPDTGLDGVLDRDNFPECTQPKRVREQIARIETMRAEQ" MKPTHVLVVG ASGSIGRHAV EKARAAGYRV RALVRDPSRI HFGCGVEVVQ GDLTSVESMR 60 QALDGIDGIV FTHGSNGGPT LTETVDYGAV RNALEALDGR PARIALMTSI GVTNMDNDYN 120 RSTEAHDWKR HSERLVRASG NEYTIVRPGW FDMEGADEHQ LKFEQGDRRD PMGPQDGSAA 180 RRQVAQTLVD ALGCKEADHK TLELIDVAGT AQTDAELASM FAALQPDTGL DGVLDRDNFP 240 ECTQPKRVRE QIARIETMRA EQ 262 ...
北中 順惠 / Nobue Kitanaka:1 北中 純一 / Junichi Kitanaka:1 加山 優 / Masaru Kayama:1 杉森 啓伸 / Hironobu Sugimori:1 渡部 要 / Kaname Watabe:2 久保 仁志 / Hitoshi Kubo:2 高橋 仁 / Hitoshi Takahashi:2 田中 康一 / Koh-ichi Tanaka:3 西山 信好 / Nobuyoshi Nishiyama:3 竹村 基彦 / Motohiko Takemura:1 ...
I have found someone! Thanks to your excellent site, I have found 3 different ladies whom I am currently exploring possibilities with. Thanks for a wonderful service! Steve ...
This study demonstrates, for the first time, an essential function of IdoA in early embryonic development and cell migration in vivo. The spatio-temporal expression of Dse in the Xenopus embryo suggested a role of DS-epi1 in ectoderm and NC development. The blockage of epimerase activity and IdoA biosynthesis upon the knockdown of DS-epi1 did not affect the allocation of neural and epidermal fates or the formation of NC progenitors. However, DS-epi1 deficiency altered the expression of neural-plate-border- and NC-specific transcription factors and decreased the extent of NC cell migration, which led to defects in craniofacial skeleton, melanocyte and dorsal fin formation. The functional links between DS-epi1 and EMT and between DS-epi1 cell adhesion on fibronectin, as established in this study for normal NC development, might have implications for neurocristopathies and cancer.. Our study demonstrates that, in Xenopus embryos, DS-epi1 is important for the formation of isolated IdoA moieties ...
Exchange of small molecules between cells through intercellular junctions is a widespread phenomenon implicated in many physiological and developmental processes. This type of intercellular communication can restore the activity of low-density lipoprotein (LDL) receptors in mammalian cells that are deficient in the enzyme UDP-Gal/UDP-GalNAc 4-epimerase. Pure cultures of the 4-epimerase mutant are unable to synthesize normal carbohydrate chains on LDL receptors and many other glycoproteins and therefore do not express LDL receptor activity. When these cells are cocultivated with cells expressing normal 4-epimerase activity, the structure and function of LDL receptors are restored to normal by the transfer of this enzymes products through intercellular junctions. The formation of functional junctions does not require normal glycosylation of membrane proteins. Because many convenient assays and selections for LDL receptor activity are available, this mutant can provide a powerful new tool for ...
James Stewardson Research and Welfare Trust, The - documenting the race against time to save the lives of a small number of children, we are creating public awareness and calling for support. ...
dTDP-β-L-rhamnose = dTDP-6-deoxy-β-L-mannose. Other name(s): dTDP-4-keto-L-rhamnose reductase; reductase, thymidine diphospho-4-ketorhamnose; dTDP-4-ketorhamnose reductase; TDP-4-keto-rhamnose reductase; thymidine diphospho-4-ketorhamnose reductase; dTDP-6-deoxy-L-mannose:NADP+ 4-oxidoreductase; dTDP-6-deoxy-β-L-mannose:NADP+ 4-oxidoreductase. Systematic name: dTDP-β-L-rhamnose:NADP+ 4-oxidoreductase. Comments: In the reverse direction, reduction on the 4-position of the hexose moiety takes place only while the substrate is bound to another enzyme that catalyses epimerization at C-3 and C-5; the complex has been referred to as dTDP-L-rhamnose synthase.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, PDB, CAS registry number: 37250-64-9. References:. 1. Melo, A. and Glaser, L. The mechanism of 6-deoxyhexose synthesis. II. Conversion of deoxythymidine diphosphate 4-keto-6-deoxy-D-glucose to deoxythymidine diphosphate L-rhamnose. J. Biol. Chem. 243 (1968) 1475-1478. [PMID: ...
China N-Acetyl-D-Glucosamine, Find details about China N-Acetyl-D-Glucosamine, Glucosamine from N-Acetyl-D-Glucosamine - Yangzhou Rixing Bio-Tech Co., Ltd.
Glucose 6 phosphate isomerase小鼠单克隆抗体可与小鼠, 人样本反应并经WB, IP, ELISA, IHC, Flow Cyt, ICC/IF实验严格验证并得到6个独立的用户反馈。
Background: E. coli O157:H7 is one of the intestinal pathogens which causes serious lesion in gastrointestinal system. Detection of this bacteria that able to produce toxin and is the major responsible for hospital infection, usually done by culture on sorbitol-MacConkey agar which is time-consuming test. The aim of this study ...
For my location and needs, the TOA 150 works better than I ever anticipated. Viewing conditions in the deep South are rarely optimal. Ive been through a number of OTAs looking for one with visual and DSLR Astrophotography performance. OTAs include a number of 6, 8, 9.25, 11, 12 and 14 inch SCTs. Also 2, 3, 4, 5 and 6 inch refractors. The best refractor before the TOA was a Takahashi FS-152. The TOA is solidly built, has awesome optics and a great camera angle adapter. The focuser is fine and is only bested by a high end FeatherTouch. For DSLR imaging this scope has to be approaching perfection. Very easy to use and has no discernible color. Even in poor seeing the results are very good. The only negative would be the counter-weight collar. Attaching it is optional but if you choose to use it another 10 or so pounds is added to the scope weight. The objective is heavy on this scope (more quality and sturdy construction in the lens cell where you want it) and the counterweight centers the OTA a ...
Page 36 of 37 - New Takahashi FC-100DL - posted in Refractors : Just picked this up off of A-mart. What a stunner. Views are textbook. 20mm Ethos on M42 was breathtaking. cheers Do you find the OE focuser copes with the 21s weight OK?
... - For customers seeking comprehensive skeletal support Contributes to the normal functioning of the bones and muscles Convenient EasyGest capsules for faster digestion Manufactured in the UK to strict GMP standards
dTDP-3-amino-2,3,6-trideoxy-4-keto-D-glucose/dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose/dTDP-2,6-dideoxy-D-kanosamine transaminase [EC:2.6.1.106 2.6.1 ...
India Pale Ale is a American IPA style beer brewed by Nøgne Ø - Det Kompromissløse Bryggeri A/S in Grimstad, Norway. 3.92 average with 235 ratings, reviews and opinions.
Ito Yoshihiro , Li Jing-Song , Takahashi Takashi , IMANISHI Yukio , OKABAYASHI Yoshinori , KIDO Yoshiaki , KASUGA Masato The journal of biochemistry 121(3), 514-520, 1997-03-01 医中誌Web 参考文献58件 被引用文献9件 ...
Ebmont Fx3 in Telugu - యొక్క ఉపయోగాలు, మోతాదు, దుష్ప్రభావాలు, ప్రయోజనాలు, పరస్పర చర్యలు మరియు హెచ్చరికను కనుగొనండి - Ebmont Fx3 yokka upayogaalu, mothaadu, dushprabhaavaalu, prayojanaalu, praspara charyalu mariyu hechcharika
Ex-England striker took his goal tally into double figures as he sealed victory over the Swans who will feel harshly done by with Kyle Naughtons dismissal
Recently, the overproduction of Mycobacterium tuberculosis diaminopimelic acid (DAP) epimerase MtDapF in Escherichia coli using a novel codon alteration cloning strategy and the characterization of the purified enzyme was reported. In the present study, the effect of sulphydryl alkylating agents on the in vitro activity of M. tuberculosis DapF was tested. The complete inhibition of the enzyme by 2-nitro-5-thiocyanatobenzoate, 5,5-dithio-bis(2-nitrobenzoic acid) and 1,2-benzisothiazolidine-3-one at nanomolar concentrations suggested that these sulphydryl alkylating agents modify functionally significant cysteine residues at or near the active site of the epimerase. Consequently, the authors extended the characterization of MtDapF by studying the role of the two strictly conserved cysteine residues. The putative catalytic residues Cys87 and Cys226 of MtDapF were replaced individually with both serine and alanine. Residual epimerase activity was detected for both the serine replacement mutants ...
ribose-5-phosphate isomerage B (RpiB):Presented here is a series of crystal structures solved by the Seattle Structural Genomics Center for Infectious Disease (SSGCID) of ribose-5-phosphate isomerase B, or RpiB, from the pathogenic fungus, Coccidioides immitis. This parasite, which resides in the soil in certain parts of the western hemisphere, causes coccidioidomycosis, also known as Valley Fever. The disease is difficult to diagnose as it causes masses which mimics a lung tumor. Ribose-5-phosphate isomerase is an enzyme that catalyzes the conversion between ribose-5-phosphate and ribulose-5-phosphate. This family of enzymes naturally occurs in two distinct classes, RpiA and RpiB, which play, among others, an important role in the pentose phosphate pathway, which converts a type of glucose into other molecules. Although RpiB occurs predominantly in bacteria, the RpiB from this fungal pathogen contains high structural similarity to other known RpiB structures despite modest sequence similarity. The C.
TY - JOUR. T1 - Active-Site Glu165 Activation in Triosephosphate Isomerase and Its Deprotonation Kinetics. AU - Deng, Hua. AU - Dyer, R. Brian. AU - Callender, Robert. PY - 2019/5/16. Y1 - 2019/5/16. N2 - Triosephosphate isomerase (TIM) catalyzes the interconversion between dihydroxyacetone phosphate (DHAP) and d-glyceraldehyde 3-phosphate (GAP) via an enediol(ate) intermediate. The active-site residue Glu165 serves as the catalytic base during catalysis. It abstracts a proton from C1 carbon of DHAP to form the reaction intermediate and donates a proton to C2 carbon of the intermediate to form product GAP. Our difference Fourier transform infrared spectroscopy studies on the yeast TIM (YeTIM)/phosphate complex revealed a C=O stretch band at 1706 cm-1 from the protonated Glu165 carboxyl group at pH 7.5, indicating that the pKa of the catalytic base is increased by ,3.0 pH units upon phosphate binding, and that the Glu165 carboxyl environment in the complex is still hydrophilic in spite of the ...
Triosephosphate isomerase (TPI) deficiency is an autosomal recessive disorder caused by various mutations in the gene encoding the key glycolytic enzyme TPI. A drastic decrease in TPI activity and an increased level of its substrate, dihydroxyacetone phosphate, have been measured in unpurified cell extracts of affected individuals. These observations allowed concluding that the different mutations in the TPI alleles result in catalytically inactive enzymes. However, despite a high occurrence of TPI null alleles within several human populations, the frequency of this disorder is exceptionally rare. In order to address this apparent discrepancy, we generated a yeast model allowing us to perform comparative in vivo analyses of the enzymatic and functional properties of the different enzyme variants. We discovered that the majority of these variants exhibit no reduced catalytic activity per se. Instead, we observed, the dimerization behavior of TPI is influenced by the particular mutations investigated, and
RIchard Dawson wrote - When I first met Cara, at the coffee shop in our university, I didnt ask her why she walked with a cane and a limp. Hereditary Inclusion Body Myopathy (HIBM) is a rare genetic disorder that strikes healthy adults in their 20s. Muscles progressively weaken, leading to severe disability within 10-15 years. Most patients are eventually confined to a wheelchair. As Cara and I became friends, I noticed that she never left her apartment without a leg brace. I learned about the confusion surrounding HIBM: Cara first knew something was wrong only when she began to unexpectedly fall while dancing. Even then, years of misdiagnosis followed until she was finally told she had HIBM in 2007. Ive witnessed the progression. By the time classes ended and I moved back to the States, she had adopted a second brace in order to provide her the stability to walk. My reaction was one of confusion and fear- terrified that things would progress, uncertain for my new friends future; and to a
Three stereoisomeric inhibitors of Pin1: (2R,5S)-, (2S,5R)- and (2S,5S)-Ac-pSer-Ψ[(Z)CH = C]-pipecolyl(Pip)-2-(2-naphthyl)ethylamine 1, that mimic L-pSer-D-Pro, D-pSer-L-Pro, and D-pSer-D-Pro amides respectively, were synthesized by a 13-step route. The newly formed stereogenic centers in the pipecolyl ring were introduced by Luche reduction, followed by stereospecific [2,3]-Still-Wittig rearrangement. The (Z)- to (E)-alkene ratio in the rearrangements were consistently 5.5 to 1. The stereochemistry at the original Ser α-carbon controlled the stereochemistry of the Luche reduction, but it did not affect the stereochemical outcome of the rearrangement, which consistently gave the (Z)-alkene. The epimerized by-product, (2S,5S)-10, resulting from the work-up after Na/NH3 debenzylation of (2S,5R)-9, was carried on to the (2S,5S)-1 isomer. Compound (2S,5S)-10 was resynthesized from the Luche reduction by-product, (2R,3R)-3, and the stereochemistry was confirmed by comparison of the optical ...
CP001022.PE374 Location/Qualifiers FT CDS_pept 400861..401859 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Exig_0378" FT /product="UDP-glucose 4-epimerase" FT /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM: FT NAD-dependent epimerase/dehydratase; short-chain FT dehydrogenase/reductase SDR; 3-beta hydroxysteroid FT dehydrogenase/isomerase; polysaccharide biosynthesis FT protein CapD; dTDP-4-dehydrorhamnose reductase; Male FT sterility domain; KEGG: bld:BLi04283 hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:Exig_0378" FT /db_xref="EnsemblGenomes-Tr:ACB59862" FT /db_xref="GOA:B1YIH9" FT /db_xref="InterPro:IPR001509" FT /db_xref="InterPro:IPR005886" FT /db_xref="InterPro:IPR036291" FT /db_xref="UniProtKB/TrEMBL:B1YIH9" FT /protein_id="ACB59862.1" FT /translation="MAVLVVGGAGYIGSHAVYQLVDAGQDVVVIDHLKSGHREAVHPKA FT RFYEGDIRDRAFLDTVFEKETIDQVVHFAAFSLVGESMEHPLAYFDNNVYGTQVLLEAM FT MAHDVKQIVFSSTAATYGEQEQMPILETATTNPTNAYGETKLMMEKMMRWCETAYGLNY FT ...
23. Faster Cyclization than Bridging Prefers the Formation of Pd6L3 Prisms Consisting of Porphyrin-based Tetratopic Ligands under Kinetic Contro. X. Zhang, S. Takahashi, K. Aratsu, T. Kojima, H. Sato, and S. Hiraoka*, submitted.22.&nbs
Front-end circuit with deep-submicron FD-SOI Hirokazu Ikeda [email protected] Institute of space and astronautical science Japan aerospace exploration agency. H.Ikeda, K.Hirose, H.Hayakawa, Y.Kasaba, T.Takashima, T.Takahashi, H.Tomita JAXA. Slideshow 3331730 by kylene
Jessica Vetters (UGent) , Mary van Helden (UGent) , Sigrid Wahlen (UGent) , Simon Tavernier (UGent) , Arne Martens (UGent) , Farzaneh Fayazpour (UGent) , Karl Vergote (UGent) , Manon Vanheerswynghels (UGent) , Kim Deswarte (UGent) , Justine Van Moorleghem (UGent) , et al. ...
Wolters Kluwer Health may email you for journal alerts and information, but is committed to maintaining your privacy and will not share your personal information without your express consent. For more information, please refer to our Privacy Policy ...
This enzyme participates in the biosynthetic pathway for UDP-alpha-D- ManNAc(3)NAcA (UDP-2,3-diacetamido-2,3-dideoxy-alpha-D-mannuronic acid), an important precursor of B-band lipopolysaccharide ...
New Zealand Pharmaceuticals assigns to Altamira Bio its assets related to the development of N-acetyl-D-mannosamine (ManNAc) for the treatment of… Read more ». ...
... carbohydrate epimerases MeSH D08.811.399.894.500.700 --- UDP-glucose 4-epimerase MeSH D08.811.464.257.050 --- acetyl-coa ... carbohydrate dehydrogenases MeSH D08.811.682.047.150.225 --- fructuronate reductase MeSH D08.811.682.047.150.250 --- galactose ...
The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase ... Dickensen F.; Williamson D. H. (1956). "Pentose phosphate isomerase and epimerase from animal tissues". Biochem. J. 64 (3): 567 ... the conversion of carbon dioxide and water into carbohydrates. RPIA is essential in the cycle, as Ru5P generated from R5P is ... RPIA converts Ru5P to R5P which then is converted by ribulose-phosphate 3-epimerase to xylulose-5-phosphate (figure 3). The end ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... The systematic name of this enzyme class is maltose 1-epimerase. Shirokane Y, Suzuki M (1995). "A novel enzyme, maltose 1- ... In enzymology, a maltose epimerase (EC 5.1.3.21) is an enzyme that catalyzes the chemical reaction alpha-maltose ⇌ {\ ... epimerase from Lactobacillus brevis IFO 3345". FEBS Lett. 367 (2): 177-9. doi:10.1016/0014-5793(95)00524-D. PMID 7796915. ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and their ... The systematic name of this enzyme class is cellobiose 2-epimerase. Enzymes like these can produce a more rapid syndrome that ... In enzymology a cellobiose epimerase (EC 5.1.3.11) is an enzyme that catalyzes the chemical reaction cellobiose ⇌ {\ ...
This enzyme belongs to the isomerase family, specifically those racemases and epimerases which act on carbohydrates and their ... Phosphopentose epimerase (also known as ribulose-phosphate 3-epimerase and ribulose 5-phosphate 3-epimerase)(EC 5.1.3.1) is a ... D-ribulose-5-P 3-epimerase, D-xylulose-5-phosphate 3-epimerase, and pentose-5-phosphate 3-epimerase. This enzyme participates ... phosphoketopentose 3-epimerase, xylulose phosphate 3-epimerase, phosphoketopentose wpimerase, ribulose 5-phosphate 3-epimerase ...
... is caused a lack of the enzyme uridine diphosphate galactose-4-epimerase which breaks down a byproduct of galactose. This type ... Carbohydrates account for a major portion of the human diet. These carbohydrates are composed of three principal ... Inborn errors of carbohydrate metabolism are inborn error of metabolism that affect the catabolism and anabolism of ... The metabolic pathway glycolysis is used by cells to break down carbohydrates like glucose (and various other simple sugars) in ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... In enzymology, an aldose 1-epimerase (EC 5.1.3.3) is an enzyme that catalyzes the chemical reaction alpha-D-glucose ⇌ {\ ... The systematic name of this enzyme class is aldose 1-epimerase. Other names in common use include mutarotase, and aldose ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... Other names in common use include polyglucuronate 5-epimerase, dermatan-sulfate 5-epimerase, urunosyl C-5 epimerase, and ... In enzymology, a chondroitin-glucuronate 5-epimerase (EC 5.1.3.19) is an enzyme that catalyzes the chemical reaction ... Assay and properties of the uronosyl C-5 epimerase". Biochem. J. 201 (3): 489-93. PMC 1163673 . PMID 7092807. Molecular and ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... Other names in common use include acylglucosamine 2-epimerase, and N-acetylglucosamine 2-epimerase. This enzyme participates in ... In enzymology, a N-acylglucosamine 2-epimerase (EC 5.1.3.8) is an enzyme that catalyzes the chemical reaction N-acyl-D- ... V. N-Acyl-D-glucosamine 2-epimerase". J. Biol. Chem. 240: 1531-1536. PMID 14285488. Molecular and Cellular Biology portal. ...
... the 1970 Nobel Prize in Chemistry for his discovery of sugar nucleotides and their role in the biosynthesis of carbohydrates. ... The enzyme UDP-glucose 4-epimerase (EC 5.1.3.2), also known as UDP-galactose 4-epimerase or GALE, is a homodimeric epimerase ... UW entry on Epimerase Deficiency Galactosemia OMIM entries on Epimerase Deficiency Galactosemia UDPgalactose 4-Epimerase at the ... Liu Y, Vanhooke JL, Frey PA (June 1996). "UDP-galactose 4-epimerase: NAD+ content and a charge-transfer band associated with ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... The systematic name of this enzyme class is UDP-glucosamine 4-epimerase. MALEY F, MALEY GF (1959). "The enzymic conversion of ... In enzymology, an UDP-glucosamine 4-epimerase (EC 5.1.3.16) is an enzyme that catalyzes the chemical reaction UDP-glucosamine ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... cytidine diphosphodideoxyglucose epimerase, cytidine diphosphoparatose epimerase, and cytidine diphosphate paratose-2-epimerase ... It is also incorrectly known as CDP-abequose epimerase, and CDP-D-abequose 2-epimerase. This enzyme participates in starch and ... Other names in common use include CDP-paratose epimerase, cytidine diphosphoabequose epimerase, ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... UDP-galacturonate 4-epimerase, uridine diphosphoglucuronate epimerase, and UDP-D-galacturonic acid 4-epimerase. This enzyme ... The systematic name of this enzyme class is UDP-glucuronate 4-epimerase. Other names in common use include uridine diphospho-D- ... galacturonic acid, UDP glucuronic epimerase, uridine diphosphoglucuronic epimerase, ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... UDP arabinose epimerase, uridine 5'-diphosphate-D-xylose 4-epimerase, and UDP-D-xylose 4-epimerase. This enzyme participates in ... In enzymology, an UDP-arabinose 4-epimerase (EC 5.1.3.5) is an enzyme that catalyzes the chemical reaction UDP-L-arabinose ⇌ {\ ... The systematic name of this enzyme class is UDP-L-arabinose 4-epimerase. Other names in common use include uridine ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... Other names in common use include uridine diphosphoglucuronate 5'-epimerase, UDP-glucuronic acid 5'-epimerase, and C-5-uronosyl ... In enzymology, an UDP-glucuronate 5'-epimerase (EC 5.1.3.12) is an enzyme that catalyzes the chemical reaction UDP-glucuronate ... I. Uridine diphosphate-D-glucuronic acid-5-epimerase". J. Biol. Chem. 237: 638-642. PMID 14450717. Molecular and Cellular ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... Other names in common use include UDP acetylglucosamine epimerase, uridine diphosphoacetylglucosamine epimerase, uridine ... In enzymology, an UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) is an enzyme that catalyzes the chemical reaction UDP-N- ... The systematic name of this enzyme class is UDP-N-acetyl-D-glucosamine 4-epimerase. ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... In enzymology, a glucose-6-phosphate 1-epimerase (EC 5.1.3.15) is an enzyme that catalyzes the chemical reaction alpha-D- ... Wurster B, Hess B (1972). "Glucose-6-phosphate-1-epimerase from baker's yeast. A new enzyme". FEBS Lett. 23 (3): 341-344. doi: ... The systematic name of this enzyme class is D-glucose-6-phosphate 1-epimerase. This enzyme participates in glycolysis / ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... epimerase, uridine diphospho-N-acetylglucosamine 2'-epimerase, and uridine diphosphate-N-acetylglucosamine-2'-epimerase. This ... The UDP-N-acetylglucosamine 2-epimerase from rat liver displays both epimerase and kinase activity. As of late 2007, 4 ... In microorganisms this epimerase is involved in the synthesis of the capsule precursor UDP-ManNAcA. An inhibitor of the ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... In enzymology, an ADP-L-glycero-D-manno-heptose 6-epimerase (EC 5.1.3.20) is an enzyme that catalyzes the chemical reaction ADP ... The systematic name of this enzyme class is ADP-L-glycero-D-manno-heptose 6-epimerase. This enzyme participates in ... "The Mechanism of the Reaction Catalyzed by ADP-β-L-glycero-D-manno-heptose 6-Epimerase". J. Am. Chem. Soc. 126: 8878-9. doi: ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... The systematic name of this enzyme class is GDP-mannose 3,5-epimerase. Other names in common use include GDP-D-mannose:GDP-L- ... galactose epimerase, guanosine 5'-diphosphate D-mannose:guanosine 5'-diphosphate, and L-galactose epimerase. This enzyme ... In enzymology, a GDP-mannose 3,5-epimerase (EC 5.1.3.18) is an enzyme that catalyzes the chemical reaction GDP-mannose ⇌ {\ ...
It belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and derivatives. ... Mechanism of Ribulose 5-Phosphate 4-Epimerase in active site Aldol and dehydration mechanims L-Ribulose 5-phosphate 4-epimerase ... Other names in common use include phosphoribulose isomerase, ribulose phosphate 4-epimerase, L-ribulose-phosphate 4-epimerase, ... In enzymology, a L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) is an enzyme that catalyzes the interconversion of ribulose 5- ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... The systematic name of this enzyme class is L-ribulose-5-phosphate 3-epimerase. Other names in common use include L-xylulose 5- ... In enzymology, a L-ribulose-5-phosphate 3-epimerase (EC 5.1.3.22) is an enzyme that catalyzes the chemical reaction L-ribulose ... phosphate 3-epimerase, UlaE, and SgaU. This enzyme participates in ascorbate and aldarate metabolism. Yew WS, Gerlt JA (2002 ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... Other names in common use include acylglucosamine-6-phosphate 2-epimerase, and acylglucosamine phosphate 2-epimerase. This ... In enzymology, a N-acylglucosamine-6-phosphate 2-epimerase (EC 5.1.3.9) is an enzyme that catalyzes the chemical reaction N- ... N-Acyl-D-glucosamine 6-phosphate 2-epimerase". J. Biol. Chem. 240: 1525-1530. PMID 14285487. Molecular and Cellular Biology ...
This enzyme belongs to the family of isomerases, specifically those racemases and epimerases acting on carbohydrates and ... 5-epimerase, TDP-4-ketorhamnose 3,5-epimerase, dTDP-4-dehydro-6-deoxy-D-glucose 3,5-epimerase, and TDP-4-keto-L-rhamnose-3,5- ... The systematic name of this enzyme class is dTDP-4-dehydro-6-deoxy-D-glucose 3,5-epimerase. Other names in common use include ... In enzymology, a dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) is an enzyme that catalyzes the chemical reaction dTDP-4- ...
In the rate-limiting step of the pathway, UDP-GlcNAc is converted into ManNAc by UDP-GlcNAc 2-epimerase, encoded by the ... terminal monosaccharides of carbohydrate chains that are attached to glycoproteins and glycolipids (glycans). ManNAc is the ... The UDP-GlcNAc 2-epimerase kinase is the rate limiting step in sialic acid biosynthesis. If the enzyme does not work ... Keppler, O; Hinderlich, S; Langner, J; Schwartz-Albiez, R; Reutter, W; Pawlita, M (1999). "UDP-GlcNAc 2-epimerase: a regulator ...
Metabolism: carbohydrate metabolism · fructose and galactose enzymes. Fructose. Hepatic fructokinase · Aldolase B · Triokinase ... Galactokinase · Galactose-1-phosphate uridylyltransferase/UDP galactose epimerase. Aldose reductase. Lactose. Lactose synthase ...
... a carbohydrate esterase family 6 domain; (iii) a family 40 carbohydrate-binding module; (iv) two adjacent, fully duplicated, ... D-glucosamine 2-epimerase; and (iv) a N-acetylneuraminate epimerase/sodium:sialic acid symporter-fusion inner-membrane protein ... six carbohydrate binding modules containing proteins, and four carbohydrate esterases (Supplementary Table S2). ... T. maritimum has been reported to be unable to degrade most simple and more complex carbohydrates (Wakabayashi et al., 1986; ...
Enzymes that catalyze the epimerization of chiral centers within carbohydrates or their derivatives. EC 5.1.3. ... Carbohydrate Epimerases. Subscribe to New Research on Carbohydrate Epimerases Enzymes that catalyze the epimerization of chiral ... centers within carbohydrates or their derivatives. EC 5.1.3.. Also Known As: Epimerases, Carbohydrate; Isomerases, Carbohydrate ... Carbohydrate Epimerases*UDP acetylglucosamine-2-epimerase: 14. *UDPglucose 4-Epimerase: 8. *N-acyl-D-glucosamine 2-epimerase: 4 ...
... glucose epimerase in carbohydrate metabolism of Arabidopsis, The Plant Journal" on DeepDyve, the largest online rental service ... The role of UDP‐glucose epimerase in carbohydrate metabolism of Arabidopsis. The role of UDP‐glucose epimerase in carbohydrate ... The role of UDP‐glucose epimerase in carbohydrate metabolism of Arabidopsis. Dörmann, Peter; Benning, Christoph ... "The role of UDP‐glucose epimerase in carbohydrate metabolism of Arabidopsis." The Plant Journal 13.5 (1998): 641-652.. EndNote ...
Carbohydrate metabolism. Ligand. NAD. Enzyme and pathway databases. Reactome - a knowledgebase of biological pathways and ... Probable UDP-arabinose 4-epimerase 3 (UEL-3), Probable UDP-arabinose 4-epimerase 2 (UEL-2), Probable UDP-arabinose 4-epimerase ... Probable UDP-arabinose 4-epimerase 2Add BLAST. 391. Proteomic databases. PaxDb, a database of protein abundance averages across ... Belongs to the NAD(P)-dependent epimerase/dehydratase family.Curated. Keywords - Domaini. Signal-anchor, Transmembrane, ...
Carbohydrate metabolism. Ligand. Metal-binding, Zinc. Enzyme and pathway databases. UniPathway: a resource for the exploration ... L-ribulose-5-phosphate 4-epimerase UlaF (ulaF). This subpathway is part of the pathway L-ascorbate degradation, which is itself ... sp,B2TY70,ULAF_SHIB3 L-ribulose-5-phosphate 4-epimerase UlaF OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) OX= ... L-ribulose-5-phosphate 4-epimerase UlaFUniRule annotation. Manual assertion according to rulesi ...
Carbohydrate metabolism. Ligand. NAD. Enzyme and pathway databases. BioCyc Collection of Pathway/Genome Databases ... Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 (UGE3), Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4 ... epimerase 1 (UGE1), UDP-arabinose 4-epimerase 1 (MUR4), Probable UDP-arabinose 4-epimerase 3 (At4g20460), Putative UDP- ... arabinose 4-epimerase 4 (At5g44480), Putative UDP-arabinose 4-epimerase 2 (At2g34850) ...
Furthermore, mutations in human genes encoding the glycosyltransferases, epimerases, and sulfotransferases responsible for the ... carbohydrate sulfotransferase 14; decorin; chondroitin sulfate; dermatan sulfate; dermatan sulfate epimerase; dermatan 4-O- ... Furthermore, mutations in human genes encoding the glycosyltransferases, epimerases, and sulfotransferases responsible for the ... Keywords: biglycan; carbohydrate sulfotransferase 14; decorin; chondroitin sulfate; dermatan sulfate; dermatan sulfate ...
Carbohydrate Epimerases); EC 5.3.1.- (Aldose-Ketose Isomerases); EC 5.3.1.12 (glucuronate isomerase). ... Carboidratos Epimerases/gen tica. Escherichia coli/metabolismo. Fruturonato Redutase/gen tica. Hidroliases/gen tica. peron. ... EC 1.1.- (Carbohydrate Dehydrogenases); EC 1.1.1.57 (Fructuronate Reductase); EC 3.2.1.- (Galactosidases); EC 3.2.1.23 (beta- ... 0 (Hexuronic Acids); 0 (Uronic Acids); EC 1.1.- (Carbohydrate Dehydrogenases); EC 1.1.1.57 (Fructuronate Reductase); EC 4.2.1 ...
DR GO; GO:0004034; F:aldose 1-epimerase activity; IEA:UniProtKB-EC. DR GO; GO:0030246; F:carbohydrate binding; IEA:InterPro. DR ... DE SubName: Full=Aldose 1-epimerase {ECO:0000313,EMBL:PFG93790.1}; DE SubName: Full=Predicted aldose-1-epimerase {ECO:0000313, ... DR CDD; cd09022; Aldose_epim_Ec_YihR; 1. DR Gene3D; 2.70.98.10; -; 1. DR InterPro; IPR008183; Aldose_1/G6P_1-epimerase. DR ... GO; GO:0005975; P:carbohydrate metabolic process; IEA:InterPro. ...
Carbohydrate epimerases are enzymes that catalyze an inversion of stereochemistry at a stereogenic center in a sugar. This ... Carbohydrate epimerases are enzymes that catalyze an inversion of stereochemistry at a stereogenic center in a sugar. This ... Carbohydrates / chemistry*. Catalysis. Molecular Structure. Oxidation-Reduction. Racemases and Epimerases / chemistry*, ...
5.1 Racemases and epimerases. 5.1.3 Acting on carbohydrates and derivatives. 5.1.3.15 glucose-6-phosphate 1-epimerase. ... Carbohydrate metabolism. 00010 Glycolysis / Gluconeogenesis. Os08t0241600-01 (Os08g0241600). Enzymes [BR:dosa01000]. 5. ...
Carbohydrate Epimerases / isolation & purification Actions. * Search in PubMed * Search in MeSH * Add to Search ... Chemical and stereochemical actions of UDP-galactose 4-epimerase. Frey PA, Hegeman AD. Frey PA, et al. Acc Chem Res. 2013 Jul ... Insights into role of the hydrogen bond networks in substrate recognition by UDP-GalNAc 4-epimerases. Bhatt VS, Guan W, Xue M, ... UDP-galactose 4-epimerase activities toward UDP-Gal and UDP-GalNAc play different roles in the development of Drosophila ...
ADP-L-glycero-D-mannoheptose-6-epimerase * Carbohydrate Epimerases * SurA protein, E coli ...
Racemases and epimerases;. Acting on carbohydrates and derivatives. Sysname. CDP-3,6-dideoxy-D-glucose 2-epimerase. ... cytidine diphosphoparatose epimerase;. cytidine diphosphate paratose-2-epimerase;. CDP-abequose epimerase (incorrect);. CDP-D- ... CDP-paratose 2-epimerase;. CDP-paratose epimerase;. cytidine diphosphoabequose epimerase;. cytidine diphosphodideoxyglucose ...
Carbohydrate metabolism; hexose metabolism.. * Sequence similarities. Belongs to the aldose epimerase family. ...
... carbohydrate metabolism; FT GO_process: GO:0006118 - electron transport" FT /db_xref="EnsemblGenomes-Gn:RHA1_ro11067" FT /db_ ... ribulose-phosphate 3-epimerase activity; GO_function: FT GO:0004789 - thiamin-phosphate diphosphorylase activity; FT GO_ ... carbohydrate metabolism; FT GO_process: GO:0006207 - de novo pyrimidine base FT biosynthesis; GO_process: GO:0009228 - ... carbohydrate metabolism; GO_process: FT GO:0006355 - regulation of transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn ...
Carbohydrate Epimerases · Cloning, Molecular · DNA, Bacterial · Genes, Bacterial · Lactobacillus · Magnetic Resonance ... Carbohydrate Epimerases, EC 5.1.3; DNA, Bacterial; Phosphotransferases, EC 2.7; Plasmids; Repressor Proteins; xylose isomerase ...
"The role of UDP-glucose epimerase in carbohydrate metabolism of Arabidopsis.". Doermann P., Benning C.. Plant J. 13:641-652( ... Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 (UGE3), Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4 ... epimerase 1 (UGE1), UDP-arabinose 4-epimerase 1 (MUR4), Probable UDP-arabinose 4-epimerase 3 (At4g20460), Putative UDP- ... "The role of UDP-glucose epimerase in carbohydrate metabolism of Arabidopsis.". Doermann P., Benning C.. Plant J. 13:641-652( ...
View all proteins of this organism that are known to be involved in the pathway galactose metabolism and in Carbohydrate ... UDP-glucose 4-epimerase activity Source: MGI ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a direct assay for the ... UDP-glucose 4-epimeraseBy similarity. Manual assertion inferred from sequence similarity toi ... Belongs to the NAD(P)-dependent epimerase/dehydratase family.Curated. Phylogenomic databases. evolutionary genealogy of genes: ...
View all proteins of this organism that are known to be involved in the pathway galactose metabolism and in Carbohydrate ... UDP-glucose 4-epimerase (EC:5.1.3.2*Search proteins in UniProtKB for this EC number. ... Belongs to the NAD(P)-dependent epimerase/dehydratase family.Curated. Phylogenomic databases. evolutionary genealogy of genes: ... sp,Q9KDV3,GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C ...
View all proteins of this organism that are known to be involved in the pathway galactose metabolism and in Carbohydrate ... UDP-glucose 4-epimerase activity Source: GO_Central ,p>Inferred from Biological aspect of Ancestor,/p> ,p>A type of ... UDP-glucose 4-epimerase (EC:5.1.3.2*Search proteins in UniProtKB for this EC number. ... Belongs to the NAD(P)-dependent epimerase/dehydratase family.Curated. Phylogenomic databases. evolutionary genealogy of genes: ...
View all proteins of this organism that are known to be involved in the pathway galactose metabolism and in Carbohydrate ... Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1. PEA ... Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1. PEA ... UDP-glucose 4-epimerase (EC:5.1.3.2*Search proteins in UniProtKB for this EC number. ...
This reaction is part of the pathway that allows the usage of sialic acid as a carbohydrate source [PMID: 10419949]. ... Putative N-acetylmannosamine-6-phosphate epimerase (IPR007260). Short name: NanE Overlapping homologous superfamilies *Ribulose ... This family represents a putative epimerase that converts N-acetylmannosamine-6-phosphate (ManNAc-6-P) to N-acetylglucosamine-6 ... Cloning, sequence, and transcriptional regulation of the operon encoding a putative N-acetylmannosamine-6-phosphate epimerase ( ...
"RmlC, a C3 and C5 carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.". ... "RmlC, a C3 and C5 carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.". ... "RmlC, a C3 and C5 carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.". ... "RmlC, a C3 and C5 carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.". ...
A structural classification of carbohydrate epimerases: From mechanistic insights to practical applications.. *Stevie Van ...
  • Phosphopentose epimerase belongs to two protein families of increasing hierarchy. (wikipedia.org)
  • Then, the available transcriptomics and proteomics data was used to characterize the mRNA and protein levels of I. scapularis major carbohydrate metabolic pathway components in response to A. phagocytophilum infection of tick tissues and cultured cells. (frontiersin.org)
  • Many eukaryotic proteins also have carbohydrate molecules attached to them in a process called glycosylation, which can promote protein folding and improve stability as well as serving regulatory functions. (wikipedia.org)
  • Furthermore, mutations in human genes encoding the glycosyltransferases, epimerases, and sulfotransferases responsible for the biosynthesis of DS chains cause connective tissue disorders including Ehlers-Danlos syndrome and spondyloepimetaphyseal dysplasia with joint laxity characterized by skin hyperextensibility, joint hypermobility, and tissue fragility, and by severe skeletal disorders such as kyphoscoliosis, short trunk, dislocation, and joint laxity. (mdpi.com)
  • To conserve cellular resources, expression of most of the hundreds of carbohydrate catabolism genes is induced only when the corresponding carbohydrate is present in the growth medium. (asmscience.org)
  • "Carbohydrate utilization in Streptococcus thermophilus: characterization of the genes for aldose 1-epimerase (mutarotase) and UDPglucose 4-epimerase. (tcdb.org)
  • Although substrate-specific carbohydrate transporters and hydrolases were regulated at the transcriptional level, genes encoding regulatory proteins CcpA, Hpr, HprK/P, and EI were consistently highly expressed. (pnas.org)
  • Based on these observations, we examined mutations in seven NTHI strain 2019 genes involved in carbohydrate and lipooligosaccharide biosynthesis. (asm.org)
  • NTHI strain 2019 with mutations in genes encoding phosphoglucomutase ( pgm ), UDP-galactose-4-epimerase, and two other NTHI sialyltransferases ( lic3A and lsgB ) produced biofilms that were equivalent to or larger than the biofilms produced by the parent strain. (asm.org)
  • The enzymes involved in the seven major carbohydrate metabolic pathways glycolysis, gluconeogenesis, pentose phosphate, tricarboxylic acid cycle (TCA), glyceroneogenesis, and mitochondrial oxidative phosphorylation and β-oxidation were identified. (frontiersin.org)
  • The metabolic pathway glycolysis is used by cells to break down carbohydrates like glucose (and various other simple sugars) in order to extract energy from them. (wikipedia.org)
  • Further, it was demonstrated that the activity of the precursor-producing enzyme UDP-N-acetylglucosamine 4-epimerase, converting UDP-N-acetylglucosamine into UDP-N-acetylgalactosamine, is responsible for the presence of N-acetylgalactosamine in the EPS repeating units of both strains. (hud.ac.uk)
  • Alterations in glycogen synthesis were observed for the sakA and mpkC deletion mutants, which also displayed alterations in carbohydrate exposure on the cell wall. (asm.org)
  • in addition glycogen is the storage form of carbohydrates in humans. (wikipedia.org)
  • Here, remote homology is reported between the OGTs and a large group of diverse sugar processing enzymes, including proteins with known structure such as glycogen phosphorylase, UDP-GlcNAc 2-epimerase, and the glycosyl transferase MurG. (nih.gov)
  • This is consistent with the notion that both enzymes belong to a superfamily of epimerases/aldolases that catalyze carbon-carbon bond cleavage reactions via a metal-stabilized enolate intermediate. (wikipedia.org)
  • Nondigestible oligosaccharides (NDO) consist primarily of plant carbohydrates that are resistant to enzymatic degradation and are not absorbed in the upper intestinal tract. (pnas.org)
  • The conservation of this element and an active site, often with an Asn-Ser-Tyr-Lys tetrad, provides a platform for enzymatic activities encompassing several EC classes, including oxidoreductases, epimerases and lyases. (diva-portal.org)
  • R. I. Ortiz-Basurto, P. Williams, M. P. Belleville, and T. Doco, "Presence of rhamnogalacturonan II in the juices produced by enzymatic liquefaction of Agave pulquero stem ( Agave mapisaga )," Carbohydrate Polymers , vol. 77, no. 4, pp. 870-875, 2009. (hindawi.com)
  • The activity of UDP-N-acetylglucosamine 4-epimerase was higher in both S. thermophilus strains than in a non-EPS-producing control strain. (hud.ac.uk)
  • The transport and catabolic machinery involved in carbohydrate utilization by Lactobacillus acidophilus was characterized genetically by using whole-genome cDNA microarrays. (pnas.org)
  • We used a comparative genomics approach to reconstruct carbohydrate utilization pathways and transcriptional regulons in 10 Bifidobacterium genomes. (frontiersin.org)
  • The inferred metabolic regulons provide new insights on diverse carbohydrate utilization networks in bifidobacteria that can be employed in metabolic modeling, phenotype prediction and the rational development of novel prebiotics. (frontiersin.org)
  • Cloning, sequence, and transcriptional regulation of the operon encoding a putative N-acetylmannosamine-6-phosphate epimerase (nanE) and sialic acid lyase (nanA) in Clostridium perfringens. (ebi.ac.uk)
  • Sialic acids are the negatively charged, terminal monosaccharides of carbohydrate chains that are attached to glycoproteins and glycolipids (glycans). (wikipedia.org)
  • First, the retro-aldol cleavage mechanism is analogous to the reaction catalyzed by L-fuculose-phosphate aldolase which has high levels of sequence similarity with L-ribulose-5-phosphate 4-epimerase. (wikipedia.org)
  • L-Ribulose-5-phosphate 4-epimerase and L-fuculose-1-phosphate (L-Fuc1P) aldolase are evolutionarily related enzymes that display 26% sequence identity and a very high degree of structural similarity. (wikipedia.org)