A genus of the family POXVIRIDAE, subfamily CHORDOPOXVIRINAE, comprising poxviruses infecting sheep, goats, and cattle. Transmission is usually mechanical by arthropods, but also includes contact, airborne routes, and non-living reservoirs (fomites).
A species of CAPRIPOXVIRUS causing a cattle disease occurring in Africa.
Virus diseases caused by the POXVIRIDAE.
The study of the structure, growth, function, genetics, and reproduction of viruses, and VIRUS DISEASES.
A family of double-stranded DNA viruses infecting mammals (including humans), birds and insects. There are two subfamilies: CHORDOPOXVIRINAE, poxviruses of vertebrates, and ENTOMOPOXVIRINAE, poxviruses of insects.
Ordered compilations of item descriptions and sufficient information to afford access to them.
A poxvirus infection of cattle characterized by the appearance of nodules on all parts of the skin.
A subfamily of the family POXVIRIDAE, containing eight genera comprising all the vertebrate poxviruses.
An infectious dermatitis of sheep and goats, affecting primarily the muzzle and lips. It is caused by a poxvirus and may be transmitted to man.
Diseases of the domestic or wild goat of the genus Capra.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.
International collective of humanitarian organizations led by volunteers and guided by its Congressional Charter and the Fundamental Principles of the International Red Cross Movement, to provide relief to victims of disaster and help people prevent, prepare for, and respond to emergencies.
The systematic arrangement of entities in any field into categories classes based on common characteristics such as properties, morphology, subject matter, etc.
One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.
The guidelines and policy statements set forth by the editor(s) or editorial board of a publication.
Indolesulfonic acid used as a dye in renal function testing for the detection of nitrates and chlorates, and in the testing of milk.
A plant genus of the family ORCHIDACEAE that is the source of the familiar flavoring used in foods and medicines (FLAVORING AGENTS).
A plant genus of the family Paeoniaceae, order Dilleniales, subclass Dilleniidae, class Magnoliopsida. These perennial herbs are up to 2 m (6') tall. Leaves are alternate and are divided into three lobes, each lobe being further divided into three smaller lobes. The large flowers are symmetrical, bisexual, have 5 sepals, 5 petals (sometimes 10), and many stamens.
A species of ORTHOPOXVIRUS causing infections in humans. No infections have been reported since 1977 and the virus is now believed to be virtually extinct.
Somalia is located on the east coast of Africa on and north of the Equator and, with Ethiopia, Eritrea, Djibouti, and Kenya, is often referred to as the Horn of Africa. It comprises Italy's former Trust Territory of Somalia and the former British Protectorate of Somaliland. The capital is Mogadishu.
A live VACCINIA VIRUS vaccine of calf lymph or chick embryo origin, used for immunization against smallpox. It is now recommended only for laboratory workers exposed to smallpox virus. Certain countries continue to vaccinate those in the military service. Complications that result from smallpox vaccination include vaccinia, secondary bacterial infections, and encephalomyelitis. (Dorland, 28th ed)
An acute, highly contagious, often fatal infectious disease caused by an orthopoxvirus characterized by a biphasic febrile course and distinctive progressive skin eruptions. Vaccination has succeeded in eradicating smallpox worldwide. (Dorland, 28th ed)
A disorder characterized by incomplete arousals from sleep associated with behavior suggesting extreme fright. This condition primarily affects children and young adults and the individual generally has no recall of the event. Episodes tend to occur during stage III or IV. SOMNAMBULISM is frequently associated with this condition. (Adams et al., Principles of Neurology, 6th ed, p391)
A genus of POXVIRIDAE, subfamily CHORDOPOXVIRINAE, infecting humans. Transmission is by direct contact among children, by sexual contact among young adults, or by fomites. MOLLUSCUM CONTAGIOSUM VIRUS is the type species.
A genus of the family POXVIRIDAE, subfamily CHORDOPOXVIRINAE, causing tumors in primates. The type species is YABA MONKEY TUMOR VIRUS.
A genus of the family POXVIRIDAE, subfamily CHORDOPOXVIRINAE, which infect ungulates and may infect humans. ORF VIRUS is the type species.
A species of the genus POTYVIRUS that affects many species of Prunus. It is transmitted by aphids and by infected rootstocks.
Any of the ruminant mammals with curved horns in the genus Ovis, family Bovidae. They possess lachrymal grooves and interdigital glands, which are absent in GOATS.
Diseases of domestic and mountain sheep of the genus Ovis.
The type species of ORTHOPOXVIRUS, related to COWPOX VIRUS, but whose true origin is unknown. It has been used as a live vaccine against SMALLPOX. It is also used as a vector for inserting foreign DNA into animals. Rabbitpox virus is a subspecies of VACCINIA VIRUS.
The measurement of infection-blocking titer of ANTISERA by testing a series of dilutions for a given virus-antiserum interaction end-point, which is generally the dilution at which tissue cultures inoculated with the serum-virus mixtures demonstrate cytopathology (CPE) or the dilution at which 50% of test animals injected with serum-virus mixtures show infectivity (ID50) or die (LD50).
The lone species of the genus Asfivirus. It infects domestic and wild pigs, warthogs, and bushpigs. Disease is endemic in domestic swine in many African countries and Sardinia. Soft ticks of the genus Ornithodoros are also infected and act as vectors.
A sometimes fatal ASFIVIRUS infection of pigs, characterized by fever, cough, diarrhea, hemorrhagic lymph nodes, and edema of the gallbladder. It is transmitted between domestic swine by direct contact, ingestion of infected meat, or fomites, or mechanically by biting flies or soft ticks (genus Ornithodoros).
An ancient country in western Asia, by the twentieth century divided among the former USSR, Turkey, and Iran. It was attacked at various times from before the 7th century B.C. to 69 B.C. by Assyrians, Medes, Persians, the Greeks under Alexander, and the Romans. It changed hands frequently in wars between Neo-Persian and Roman Empires from the 3d to 7th centuries and later under Arabs, Seljuks, Byzantines, and Mongols. In the 19th century Armenian nationalism arose but suffered during Russo-Turkish hostilities. It became part of the Soviet Republic in 1921, with part remaining under Turkey. (Webster's New Geographical Dictionary, 1988)
A species of SWINE, in the family Suidae, comprising a number of subspecies including the domestic pig Sus scrofa domestica.

Long term immunity in African cattle vaccinated with a recombinant capripox-rinderpest virus vaccine. (1/31)

Cattle were vaccinated with a recombinant capripox-rinderpest vaccine designed to protect cattle from infection with either rinderpest virus (RPV) or lumpy skin disease virus (LSDV). Vaccination did not induce any adverse clinical responses or show evidence of transmission of the vaccine virus to in-contact control animals. Approximately 50% of the cattle were solidly protected from challenge with a lethal dose of virulent RPV 2 years after vaccination while at 3 years approx. 30% were fully protected. In the case of LSDV, all of 4 vaccinated cattle challenged with virulent LSDV at 2 years were completely protected from clinical disease while 2 of 5 vaccinated cattle were completely protected at 3 years. The recombinant vaccine showed no loss of potency when stored lyophylized at 4 degrees C for up to 1 year. These results indicate that capripoxvirus is a suitable vector for the development of safe, effective and stable recombinant vaccines for cattle.  (+info)

The genomes of sheeppox and goatpox viruses. (2/31)

Sheeppox virus (SPPV) and goatpox virus (GTPV), members of the Capripoxvirus genus of the Poxviridae, are etiologic agents of important diseases of sheep and goats in northern and central Africa, southwest and central Asia, and the Indian subcontinent. Here we report the genomic sequence and comparative analysis of five SPPV and GTPV isolates, including three pathogenic field isolates and two attenuated vaccine viruses. SPPV and GTPV genomes are approximately 150 kbp and are strikingly similar to each other, exhibiting 96% nucleotide identity over their entire length. Wild-type genomes share at least 147 putative genes, including conserved poxvirus replicative and structural genes and genes likely involved in virulence and host range. SPPV and GTPV genomes are very similar to that of lumpy skin disease virus (LSDV), sharing 97% nucleotide identity. All SPPV and GTPV genes are present in LSDV. Notably in both SPPV and GTPV genomes, nine LSDV genes with likely virulence and host range functions are disrupted, including a gene unique to LSDV (LSDV132) and genes similar to those coding for interleukin-1 receptor, myxoma virus M003.2 and M004.1 genes (two copies each), and vaccinia virus F11L, N2L, and K7L genes. The absence of these genes in SPPV and GTPV suggests a significant role for them in the bovine host range. SPPV and GTPV genomes contain specific nucleotide differences, suggesting they are phylogenetically distinct. Relatively few genomic changes in SPPV and GTPV vaccine viruses account for viral attenuation, because they contain 71 and 7 genomic changes compared to their respective field strains. Notable genetic changes include mutation or disruption of genes with predicted functions involving virulence and host range, including two ankyrin repeat proteins in SPPV and three kelch-like proteins in GTPV. These comparative genomic data indicate the close genetic relationship among capripoxviruses, and they suggest that SPPV and GTPV are distinct and likely derived from an LSDV-like ancestor.  (+info)

Development of a dual recombinant vaccine to protect small ruminants against peste-des-petits-ruminants virus and capripoxvirus infections. (3/31)

A recombinant capripoxvirus vaccine containing a cDNA of the peste-des-petits-ruminants virus (PPRV) fusion protein gene was constructed. A quick and efficient method was used to select a highly purified recombinant virus clone. A trial showed that a dose of this recombinant as low as 0.1 PFU protected goats against challenge with a virulent PPRV strain.  (+info)

Evaluation of lumpy skin disease virus, a capripoxvirus, as a replication-deficient vaccine vector. (4/31)

Lumpy skin disease virus (LSDV), a capripoxvirus with a host range limited to ruminants, was evaluated as a replication-deficient vaccine vector for use in non-ruminant hosts. By using the rabies virus glycoprotein (RG) as a model antigen, it was demonstrated that recombinant LSDV encoding the rabies glycoprotein (rLSDV-RG) was able to express RG in both permissive (ruminant) and non-permissive (non-ruminant) cells. The recombinant LSDV, however, replicated to maturity only in permissive but not in non-permissive cells. Recombinant LSDV-RG was assessed for its ability to generate immunity against RG in non-ruminant hosts (rabbits and mice). Rabbits inoculated with rLSDV-RG produced rabies virus (RV) neutralizing antibodies at levels twofold higher than those reported by the WHO to be protective. BALB/c mice immunized with rLSDV-RG elicited levels of RV-specific cellular immunity (T-cell proliferation) comparable with those of mice immunized with a commercial inactivated rabies vaccine (Verorab; Pasteur Merieux). Most importantly, mice immunized with rLSDV-RG were protected from an aggressive intracranial rabies virus challenge.  (+info)

Modulation of macrophage functions by sheeppox virus provides clues to understand interaction of the virus with host immune system. (5/31)

BACKGROUND: Poxviruses encode a range of immunomodulatory genes to subvert or evade the challenges posed by the innate and adaptive immune responses. However, the inactivated poxviruses possessed immunostimulating capacity and were used as a prophylactic or metaphylactic application that efficiently reduced susceptibility to infectious diseases in different species. This fact is intensively studied in different genera of poxviruses. However, little is known about the basic mechanisms adopted by sheeppox virus (SPPV). SPPV causes an acute disease of sheep that recently, has been observed to reinfect its host in spite of vaccination. RESULTS: By injecting inactivated or attenuated sheeppox virus SPPV vaccine in adult male Swiss mice, SPPV was found to reduce macrophages' functions in a local event that occurs at the site of application 12 h after vaccine administration as indicated by increased level of IL-10 and decreased level of SOD from cultured peritoneal macrophages. In contrast increased levels of IL-12, and SOD activity from cultured splenic macrophages, lymphocyte response to PHA-P, and in-vivo response to T-dependant Ag were detected. These effects were observed in both attenuated and inactivated SPPV, but more prominent in attenuated one. CONCLUSION: The results of this study help to elucidate, the phenomenon of existence natural SPPV infections in sheep instead of vaccination and the basic mechanisms responsible for the immunostimulating capacity of sheeppox virus. Locally, SPPV shows evidence for an immune escape mechanism that alleviates the host's immune response. Later and systemically, the virus protects the host from any fatal consequences of the immune system suppression.  (+info)

Immunohistochemical evaluation of inflammatory infiltrate in the skin and lung of lambs naturally infected with sheeppox virus. (6/31)

The present study describes immunophenotypic characteristics of inflammatory infiltrate in the skin and lung of lambs naturally infected with sheeppox virus (SPV). Three lambs revealed typical cutaneous and pulmonary lesions of sheeppox. Histologically, cutaneous and pulmonary lesions consisted of hyperplastic and/or degenerative changes in the epithelium with mononuclear cells, neutrophils, and typical sheeppox cells (SPCs), which had a vacuolated nucleus and marginated chromatin with occasional granular intracytoplasmic inclusions. The inflammatory infiltrate in pox lesions in both skin and lung was characterized by the presence of MHC II+ dendritic cells, CD4+, CD8+, gammadelta+ T cells, IgM+ cells, and CD21+ cells. Loss of expression of MHC I and MHC II antigens was observed in the affected areas of skin and lung. SPCs, stained with anti-SPV antibody, were also positive for CD14 and CD172A, antigens expressed on monocytes and macrophages. CD14 and CD172A negative SPCs were considered to be SPV infected degenerated epithelial cells or fibroblasts.  (+info)

Genome Annotation Transfer Utility (GATU): rapid annotation of viral genomes using a closely related reference genome. (7/31)

BACKGROUND: Since DNA sequencing has become easier and cheaper, an increasing number of closely related viral genomes have been sequenced. However, many of these have been deposited in GenBank without annotations, severely limiting their value to researchers. While maintaining comprehensive genomic databases for a set of virus families at the Viral Bioinformatics Resource Center http://www.biovirus.org and Viral Bioinformatics - Canada http://www.virology.ca, we found that researchers were unnecessarily spending time annotating viral genomes that were close relatives of already annotated viruses. We have therefore designed and implemented a novel tool, Genome Annotation Transfer Utility (GATU), to transfer annotations from a previously annotated reference genome to a new target genome, thereby greatly reducing this laborious task. RESULTS: GATU transfers annotations from a reference genome to a closely related target genome, while still giving the user final control over which annotations should be included. GATU also detects open reading frames present in the target but not the reference genome and provides the user with a variety of bioinformatics tools to quickly determine if these ORFs should also be included in the annotation. After this process is complete, GATU saves the newly annotated genome as a GenBank, EMBL or XML-format file. The software is coded in Java and runs on a variety of computer platforms. Its user-friendly Graphical User Interface is specifically designed for users trained in the biological sciences. CONCLUSION: GATU greatly simplifies the initial stages of genome annotation by using a closely related genome as a reference. It is not intended to be a gene prediction tool or a "complete" annotation system, but we have found that it significantly reduces the time required for annotation of genes and mature peptides as well as helping to standardize gene names between related organisms by transferring reference genome annotations to the target genome. The program is freely available under the General Public License and can be accessed along with documentation and tutorial from http://www.virology.ca/gatu.  (+info)

Sheeppox virus kelch-like gene SPPV-019 affects virus virulence. (8/31)

Sheeppox virus (SPPV), a member of the Capripoxvirus genus of the Poxviridae, is the etiologic agent of a significant disease of sheep in the developing world. Genomic analysis of pathogenic and vaccine capripoxviruses identified genes with potential roles in virulence and host range, including three genes with similarity to kelch-like genes of other poxviruses and eukaryotes. Here, a mutant SPPV with a deletion in the SPPV-019 kelch-like gene, DeltaKLP, was derived from the pathogenic strain SPPV-SA. DeltaKLP exhibited in vitro growth characteristics similar to those of SPPV-SA and revertant virus (RvKLP). DeltaKLP-infected cells exhibited a reduction in Ca(2+)-independent cell adhesion, suggesting that SPPV-019 may modulate cellular adhesion. When inoculated in sheep by the intranasal or intradermal routes, DeltaKLP was markedly attenuated, since all DeltaKLP-infected lambs survived infection. In contrast, SPPV-SA and RvKLP induced mortality approaching 100%. Lambs inoculated with DeltaKLP exhibited marked reduction or delay in fever response, gross lesions, viremia, and virus shedding compared to parental and revertant viruses. Together, these findings indicate that SPPV-019 is a significant SPPV virulence determinant in sheep.  (+info)

ELISA kit for the detection of antibodies against capripoxviruses including lumpy skin disease virus (LSDV), sheeppox virus (SPPV) and goatpox virus (GTPV).
The aim of this work was to evaluate the immunogenicity and neutralizing activity of sheep pox virus (SPPV; genus Capripoxvirus, family Poxviridae) structural proteins as candidate subunit vaccines to control sheep pox disease. SPPV structural proteins were identified by sequence homology with proteins of vaccinia virus (VACV) strain Copenhagen. Four SPPV proteins (SPPV-ORF 060, SPPV-ORF 095, SPPV-ORF 117, and SPPV-ORF 122), orthologs of immunodominant L1, A4, A27, and A33 VACV proteins, respectively, were produced in Escherichia coli. Western blot analysis revealed the antigenic and immunogenic properties of SPPV-060, SPPV-095, SPPV-117 and SPPV-122 proteins when injected with adjuvant into experimental rabbits. Virus-neutralizing activity against SPPV in lamb kidney cell culture was detected for polyclonal antisera raised to SPPV-060, SPPV-117, and SPPV-122 proteins. To our knowledge, this is the first report demonstrating the virus-neutralizing activities of antisera raised to SPPV-060, SPPV-117, and
The gene Q13L coding for the Capripoxvirus group specific structural protein P32 was expressed in Escherichia coli using plasmid pGEX-2T as a fusion protein with glutathione-s-transferase and purified on glutathione sepharose affinity chromatography column. The protein was then employed for diagnosis of sheeppox, goatpox and lumpyskin disease, by a latex agglutination test (LAT) using the purified P32 antigen and guinea pig detector antiserum raised against the P32 antigen. The LAT and virus neutralization test (VNT) were used to screen one hundred livestock field sera for antibodies to Capripoxvirus, in comparison the LAT was simpler, rapid and 23% more sensitive than the VNT. In addition the LAT was found to be specific for Carpripoxvirus because it did not pick antibodies to Orthopoxvirus and Parapoxvirus. The LA test can be taken for a simple and quick diagnostic tool for primary screening of Carpripoxvirus infection and will reduce the reliance of diagnostic laboratories ...
Clone REA103 recognizes human CD185, which is a 42 kDa G-protein-coupled chemokine receptor and is also known as CXCR5, monocyte-derived receptor 15 (MDR15), or Burkitt lymphoma receptor-1 (BLR1). BLR-1 was originally identified on cells of Burkitt´s lymphoma and B cells. B cell attracting chemokine 1 (BCA-1), also known as B-lymphocyte chemoattractant (BLC) or CXCL13, is the ligand of CD185. It is further expressed on central memory CD4 T cells, T folicular helper cells, and on a migratory population of skin-derived dendritic cells. Additional information: Clone REA103 displays negligible binding to Fc receptors. - Suomi
Upon activation by stromal cell derived factor 1 alpha (SDF1 alpha), the G-protein-coupled chemokine receptor, CXCR4, generates signals that eventually lead to...
Looking for online definition of LSDV or what LSDV stands for? LSDV is listed in the Worlds largest and most authoritative dictionary database of abbreviations and acronyms
Simply ask us ! One of the most interesting features of EVAgs catalogue is its flexibility, please do not hesitate to contact us by using our contact form. We can add to the catalogue tailor-made products on demand, as well as access to plateforms, or services. With the large panel of virology laboratories in our consortium, there are good chances that we would have what you are looking for. If you are interested in acquiring cell-lines, please visit this page: access-cell-lines.. If you are interested in acquiring insect vectors, please visit this page: access-insect-vectors.. ...
url=http://www.apotikerfarma.com]obat aborsi[/url] cytotec misoprostol asli paling manjur menggugurkan kandungan paling aman dan ampuh untuk usia 1 2 3 4 5 bulan tanpa harus melakukan kuret lagi. Cara pemesanan yang paling simple dan metode pengiriman yang cepat dan masalah anda akan terselesaikan dengan bantuan konsultasi team medis kami. Jelas beda dengan obat herbal, karena [url=http://www.apotikerfarma.com]obat aborsi[/url] dengan cytotec misoprostol asli pfizer menuntaskan kandungan hanya dengan waktu 3 jam.. ...
url=http://www.apotikerfarma.com]obat aborsi[/url] cytotec misoprostol asli paling manjur menggugurkan kandungan paling aman dan ampuh untuk usia 1 2 3 4 5 bulan tanpa harus melakukan kuret lagi. Cara pemesanan yang paling simple dan metode pengiriman yang cepat dan masalah anda akan terselesaikan dengan bantuan konsultasi team medis kami. Jelas beda dengan obat herbal, karena [url=http://www.apotikerfarma.com]obat aborsi[/url] dengan cytotec misoprostol asli pfizer menuntaskan kandungan hanya dengan waktu 3 jam.. ...
Anticipating Biosecurity Challenges of the Global Expansion of High Containment Biological Laboratories, Istanbul, Turkey 11-13 July 2011 Risk based design of facilities for high consequence animal pathogens Uwe Müller-Doblies Dr med.vet. MRCVS Dipl ECVPH Pirbright Laboratory, Institute for Animal Health UK Institute for Animal Health Pirbright Laboratory Institute for Animal Health BBSRC Pirbright Site 11 10 8 9 clean 2 Institute for Animal Health Large Animal Facilities 11 10 8 9 3 Institute for Animal Health IAH Pirbright Laboratory (2014) 1. 2. 3. 4. 5. 6. FMDV SVDV Marek’s Disease AHSV LSDV Sheep & Goat Pox Virus 7. ASFV 8. PPRV 9. RPV 10. BTV & 4 Institute for Animal Health Risk based design of facilities for high consequence animal pathogens 12 July 2011 1. Controls: compliance based versus risk based? 2. Working towards a target risk design 3. How to communicate risk based controls 5 Institute for Animal Health COUNCIL DIRECTIVE 90/679/EEC of 26 November 1990 protection of ...
Organised by FAO and EuFMD this is a pilot of the Lumpy Skin Disease Preparedness virtual learning course.. This is an online tutored course that aims to provide participants with an understanding of lumpy skin disease (LSD) diagnosis, outbreak investigation and control. The course involves a combination of live webinars and self-directed interactive online modules, and course materials have been developed in collaboration with the Friedrich Loeffler Institut (FLI) in Germany.. More information is available from FAO here. This 4-week online training course is available in English and Russian language. The Russian version will be run from 20th October. Self -registration is possible for interested participants at the links below.. FAO Lumpy Skin Disease Preparedness in English: register here. FAO Lumpy Skin Disease Preparedness in Russian: register here. ...
BOVINE skin diseases such as lumpy skin disease can greatly affect cattle as well as cattle ranches income and national economies through reduced production and performance.. They also cause irreparable damage to the hide.. The hide of a cattle (dehwe), forms the important outer covering surface of the animal. While it is mainly protective and sensory in function, it is also valued for the manufacture of an array of items, including indigenous cultural material such as drums, shields, mats, other musical instruments, nhavas, etc.. Currently communal cattle owners in Mutoko, under Chief Kagandes jurisdiction in the Charewa area of Mutoko, have unfortunately alerted me to yet another disease outbreak, this time diagnosed as lumpy skin disease. Mutoko lies north-east of Zimbabwe and encompasses the areas of Mudzonga, Makosa, Katsande, Sugwe, Nyamakope, Makaha and the Mutemwa areas, where the disease is currently prevalent.. Given that up to three of cattle infected by lumpy skin disease can die ...
Lumpy skin disease (LSD) is a highly infectious disease of cattle caused by a virus of the Capripoxvirus genus in the family Poxviridae. The disease is a major concern for the dairy industry in Saudi Arabia. In this study, an outbreak of LSD in cattle herds was detected in Saudi Arabia in 2016. LSD outbreak was investigated in five regions of Saudi Arabia: Al‐Hassa, Al‐Sharqia, Al‐Qassim, Riyadh a ...
The Food and Agricultural Organization (FAO) has called for broader cattle vaccination to keep lumpy skin disease under control in Eastern Europe and the Balkans.
Grundig vaksinering av besetningen kombinert med å avlive syke dyr, er like effektivt som å avlive hele besetningen. I dag krever EUs lovverk at hele besetninger avlives dersom lumpy skin disease er påvist.. Vaksinasjon er mest effektivt hvis det gjennomføres før viruset kommer inn i en region eller et land.. Les mer på EFSAs sider ,. 09.08.2016 ...
കന്നുകാലികളിൽ പടരുന്ന ലംപി സ്കിൻ ഡിസീസ് (ചർമ മുഴ രോഗം) എറണാകുളം ജില്ലയിലെ കിഴക്കൻ മേഖലയിലെ കൂടുതൽ പശുക്കളിൽ കണ്ടെത്തി. മൂവാറ്റുപുഴ, കോതമംഗലം,.Lumpy Skin Disease in Cows
n a highly infectious disease of African cattle that is caused by a poxvirus (genus Capripoxvirus), is marked by mild fever, loss of weight, and the development of inflammatory nodules in the skin and mucous membranes tending to become necrotic…
MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWGPSQSRLLKSQERSGVSTFWK 1 - 70 KPSSSSSSSSSPSSSSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHE 71 - 140 KGLVLQELKVEPDNSSQATGEGCGHRLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFRKMESYLKQQQ 141 - 210 LCDVILIVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKED 211 - 280 TIENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEF 281 - 350 LLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAFIRLPLLPPQILADLENHALF 351 - 420 KNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNNKGATTIEKYDLRTNLWIQAG 421 - 490 MMNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGLGVTVLEGPIYAVGG 491 - 560 HDGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNGKLYSVGGRDGSSCLSSMEYYDPHTNKWNMC 561 - 630 APMCKRRGGVGVATCDGFLYAVGGHDAPASNHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGD 631 - 700 RLYAVGGYDGQTYLNTMESYDPQTNEWTQMASLNIGRAGACVVVIKQP 701 - 748 ...
Introduction. Poxviruses are a large family of complex, highly epitheliotropic deoxyribonucleic acid (DNA) viruses that cause cutaneous and systemic diseases in humans, birds and both free-ranging and domestic mammals. Most members of the family Poxviridae cause mild, localised skin disease from which the term pox derives. Severe systemic disease may be caused by some poxviruses including sheeppox virus, fowlpox virus, ectromelia virus, monkeypox virus and the now eradicated human smallpox virus (variola virus). Economically important pox-viral diseases include: lumpy skin disease, which causes severe epidemics in cattle in southern Africa; sheeppox and goatpox, which cause serious losses in Africa, but are absent in southern Africa; and orf, which is a significant disease in sheep and goats worldwide. A few poxviruses cause hyperplastic or neoplastic conditions such as molluscum contagiosum in humans and horses, and Shopes fibroma of rabbits. Whilst many poxviruses are host specific, some ...
A Gel-based PCR Method to Differentiate Sheeppox Vrus Field Isolates from Vaccine Strain. Tesfaye Rufael Chibssa1,2,3, Reingard Grabherr2, Angelika Loitsch4, Tirumala Bharani K. Settypalli1,Eeva Tuppurainen5, Nick Nwankpa6, Karim Tounkara6, Hafsa Madani7, Amel Omani7, Mariane Diop8,Giovanni Cattoli1, Adama Diallo8,9 and Charles Euloge Lamien1. 1Animal Production and Health Laboratory, Joint FAO/IAEA Agricultural and Biotechnology laboratory, Division of Nuclear Techniques in Food and Agriculture, Department of Nuclear Sciences and Applications, International Atomic Energy Agency, Wagramer Strasse 5, P.O. Box 100, A1400 Vienna, Austria. 2Institute of Biotechnology, University of Natural Resources and Life Sciences (BOKU), Muthgasse 18, 1190 Vienna, Austria. 3National Animal Health Diagnostic and Investigation Center (NAHDIC), P.O Box, 04, Sebeta, Ethiopia.4Institute for Veterinary Disease Control, Austrian Agency for Health and Food Safety (AGES), Modling, Austria. 5Capripoxvirus Reference ...
2012 Moeller RB: Disorders of sheep and goats, , Kirkbrides Diagnosis of Abortion and Neonatal Loss in Animals. 49-85.. 2008 Moeller RB: Cowpox, Scott Haskell, (ed), 5 Minute Veterinary Consultant - Ruminants, Ames, Iowa. 264.. 2008 Moeller RB: Sheep and Goat Pox, Scott Haskell, (ed), 5 Minute Veterinary Consultant - Ruminants, Ames, Iowa. 828.. 2008 Moeller RB: Foot and Mouth Disease, Scott Haskell, (ed), 5 Minute Veterinary Consultant - Ruminants, Ames, IA. 382.. 2008 Moeller RB: Lumpy Skin Disease, Scott Haskell, (ed), 5 Minute Veterinary Consultant - Ruminants, Ames, Iowa. 490.. ...
A method for preventing lesions caused by a virus of the Herpesviridae or Poxviridae family, comprising topically applying a composition consisting essentially of a C1 to C3 monohydroxy alcohol or a C
If someone finds his/her copyrighted content published on this site/blog and wants it to be removed, please CONTACT US and tell in detail about what material should be removed/credited to, along with DETAILS of your webpage/source from which it has been taken and your copyright authority over the material ...
View mouse Klhl40 Chr9:121777607-121783818 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
View mouse Klhl42 Chr6:147091379-147112778 with: phenotypes, sequences, polymorphisms, proteins, references, function, expression
Rapid and Sensitive Detection of Salmonella spp. by Using a Loop-Mediated Isothermal Amplification Assay in Duck Carcass Sample - loop-mediated isothermal amplification;Salmonella spp.;screening;duck;
Read Detection of hepatitis C virus by an improved loop-mediated isothermal amplification assay, Archives of Virology on DeepDyve, the largest online rental service for scholarly research with thousands of academic publications available at your fingertips.
TEL :. +86 153 6067 3248 (Intl). US Toll free: 855 777 3210 EU Toll free: 800 3272 9252 Korea Toll free: 001 800 3272 9252 (Telecom ...
J. P. Navarro, Knepper, R., Liming, L., Dahan, M., Lifka, D., and Stewart, C. A., The Community Software Repository from XSEDE, in PEARC17: Proceedings of the Practice and Experience in Advanced Research Computing 2017 on Sustainability, Success and Impact08/2017, New Orleans, 2017. ...
Our group The Non-Vesicular Disease Reference Laboratory Group brings together all the reference laboratories working on non-vesicular diseases at Pirbright. These diseases include bluetongue (BT), African horse sickness, African swine fever, morbilliviruses (peste des petits ruminants and rinderpest - which was declared eradicated in May 2011), and capripox viruses (lumpy skin disease and sheep and goat pox).
A Loop-Mediated Isothermal Amplification Assay and Sample Preparation Procedure for Sensitive Detection of Xanthomonas fragariae in Strawberry. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
This study was designed to optimize and apply the use of loop-mediated isothermal amplification (LAMP) as an alternative to conventional polymerase chain reaction (PCR) for the detection of herpesvirus of turkeys (HVT) (FC 126 strain) in vaccinated and non-vaccinated poultry in Nigeria
español: asnillo, balomaga, detiene bueyes, espinilla, gatilla, gatuna, gatuña, hierba toro, peine de asno, quiebra arados, abreojo, abreojos, abrojo, abrojos, anonis, balomaca, balomada, brumaga, camerio, carretón de la vega, cornicrabas, detiene buei, detienebuey, detiene buey, esbolomaga, garduña, gartuña, gata, gateña, gatiña, gatillas, gatillos, gatina, gatita, gatuñas, goldarrán, goldarrón, grumagas, grumuaca, gurumaca, hierba de la estranguria, hijasdeputa, miarcas, mielca de gitano, molomaga, mormaga, parabuey, para-buey, peina de asno, pie de asno, quiebraarado, quiebraarados, quiebra-arados, quiebraardos, quiebrarados, rémora, rumaga, tentabuey, uña de gato, uña de gatos, uñaengato, uñagata, uña gata, uña gato, uñalgata, uñas de gato, uñas gatas, yerba de la estranguria, yerba que impide el arado, yerba ...
The British Medical Journal has issued a clarion call to all who want to ward off heart disease: Forget the statins and bring back the bacon (or at least the full-fat yogurt). Saturated fat is not the widow-maker it's been made out to be, writes British cardiologist Aseem Malhotra in a stinging...
The chicken pox virus can infect anybody, but it commonly targets children. Most reported cases occur in children under the age of 10. Heres more.
Sea lice is a common name for a large number of species of marine ectoparasitic copepods, many of which are widespread and important disease ...
Here is my thumbnail summary of what Dr. Sox wrote in describing how the population medicine approach would work.The major important diseases would be identified as would methods for their prevention. With that knowledge in hand , then funds could be transferred across patients and disease processes so that the maximal overall health benefit could be achieved.In this process it might well be that sometimes funds would be diverted away from the testing and treatment of some so that the preventive measures could be funded and then in a few generations the benefit would be fully realized.He is explicit regarding the fact that in the short run some people would be harmed although he does not seem to explain why it would be only the short run as would not new preventative measures always be formulated and have funds diverted to their execution.The population medicine advocates claim the approaching of each patient strictly as a individual is obsolete and are promoting a statistical medicine that ...
Hello, I am in a terrible state of distress after 8 long months of dealing with a viral infection called Molloscum Contagiosum. It is a pox virus and it looks…
Parapoxvirus, is commonly referred to as farmyard pox and is mostly expressed in hoofed animals. The virus belongs to the Poxviridae family. This infection is identified by scabby lesions that can be seen on the muzzle, lips, face, ears or on the velvet of the Red deer (Cervus elaphus). This virus is zoonotic, meaning infectious diseases of animals that can be transmitted to humans. Humans vulnerable to infection include farmers, butchers, and veterinarians. This virus occurs worldwide. In 1987, deaths[clarification needed] occurred on two Red Deer farms in New Zealand where secondary bacterial infections were seen alongside the lesions. In these particular cases, morbidity rates reached 100%. Parapoxvirus belongs to the family of viruses named Poxviridae, a group one family of double stranded DNA viruses. More specifically Parapoxvirus is classified into the subfamily of Chordopoxvirinae. Other Chordopoxvirinae genuses include; Orthopoxvirus, Avipoxvirus, Capripoxvirus, Leporipoxvirus, ...
Cow Pox viral disease of dairy animals It is caused by Orthopox virus having a place with family Poxviridae. Orhtopox infections are comparable.
When a person becomes the victim of chicken pox, he gets rid of this disease within 10-15 days. Marks of chicken pox left behind the disease disappear after 5-6 months.
What Does Chicken Pox Look Like | Day 1 To 12 What Does Chicken Pox Look Like Find out what does chicken pox look like, I had two over a weekend!
Dr. Clive Gay. Dr. Gay through his leadership of the Colleges Field Disease Investigation Unit has provided solutions for many important diseases of livestock. These solutions are the result of Dr. Gays efforts in connecting on farm disease investigations with the research laboratory.. ...
Methicillin-resistant Staphylococcus aureus (MRSA) has become one of the most prevalent pathogens responsible for nosocomial infections throughout the world. As clinical MRSA diagnosis is concerned, current diagnostic methodologies are restricted by significant drawbacks and novel methods are required for MRSA detection. This study aimed at developing a simple loop-mediated isothermal amplification (LAMP) assay targeting on orfX for the rapid detection of methicillin-resistance Staphylococcus aureus (MRSA). The protocol was designed by targeting orfX, a highly conserved open reading frame in S. aureus. One hundred and sixteen reference strains, including 52 Gram-positive and 64 Gram-negative isolates, were included for evaluation and optimization of the orfX-LAMP assay. This assay had been further performed on 667 Staphylococcus (566 MRSA, 25 MSSA, 53 MRCNS and 23 MSCNS) strains and were comparatively validated by PCR assay using primers F3 and B3, with rapid template DNA processing, simple equipments
ABSTRACT. Antiviral effects of a synthetic Aluminum-Magnesium Silicate (AMS) were tested on Fowl Pox Virus (FPV). Five batches of the Nigerian brand of FPV vaccine were used as sources of the virus. The reconstituted vaccines were mixed with The Synthetic AMS on equal volume to weight basis and incubated at room temperature for one hour. They were centrifuged for 10 minutes at 2000 revolutions per minute. The incubation and centrifugation were repeated on a portion of each vaccine supernatant. The two sets of supernatants were tested by the Modified Passive Haemagglutination test, for FPV titres. Portions of the vaccines, not incubated with the AMS, were served as controls. Fowl Pox Virus titres of the vaccines increased from a mean of 2.8 ± 1.10 to 11.2 ± 4.38 when incubated with the AMS once. When incubation with the AMS was repeated, the titres reduced (P< 0.05) to zero in each sample.. 1. INTRODUCTION. Fowl Pox Virus belongs to the Avipoxviridae viral family [1]. The disease it causes is a ...
The cantaloupe is popularly known as melon or muskmelon. This is a fruit with orange flesh, with seeds in the middle and a lumpy skin that appears to be netted. It is considered to be sweet and succulent with a pleasant aroma. This cantaloupe is very healthy for your body for you can gain nutritional advantages from it. ...
The Federal Government has described as fake and sinister the report that the outbreak of Monkey Pox in some parts of the country resulted from the alleged free medical care by the government in the affected areas. In a statement issued in Abuja on Sunday, the Minister of Information and Culture, Alhaji Lai Mohammed, said…
This sounds like the plot line of a horror/sci-fi movie: A freshwater parasite slips through the skin and into the bloodstream. Once inside, the invader lives and breeds undetected for a decade or more, feasting on nutrients in the blood and fueling a debilitating and sometimes life-threatening illness in millions of people around the world. Except this is the true biological tale of the schistosome, a parasitic worm that has infected an estimated 200 million people.
Aarogya.com is Leading comprehensive health portal. This site has covered almost all the medical specialties and give useful information on various diseases.
Like a plot twist in a bad Syfy network movie, the Centers for Disease Control and Prevention announced on Tuesday that vials labeled
Merck & Co., Inc., Kenilworth, NJ, USA is a global healthcare leader working to help the world be well. From developing new therapies that treat and prevent disease to helping people in need, we are committed to improving health and well-being around the world. The Merck Manual was first published in 1899 as a service to the community. The legacy of this great resource continues as the Merck Manual in the US and Canada and the MSD Manual outside of North America. Learn more about our commitment to Global Medical Knowledge.. ...
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
The worlds first wiki where authorship really matters. Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts.
hello , i am 22yrs old . I had chiken pox since many years ago , it was nearly in 2002 or 2004 . At that time i was having really many chicken pox on my full body . But now my question is do you think...
My four year old recently caught chicken pox (two weeks before we went to Disneyland!). As shes my third child, I had a pretty good idea of how to keep her comfortable. I did Google for advice, and s...
"Capripoxvirus". viralzone.expasy.org. Retrieved 2017-11-03. "Sheeppox and Goatpox - Integumentary System - Merck Veterinary ... This virus is in the family Poxviridae and genus Capripoxvirus. Sheeppox virus (SPV) is the most severe of all the animal pox ...
Genus Capripoxvirus. *Genus Centapoxvirus. *Genus Cervidpoxvirus. *Genus Crocodylidpoxvirus. *Genus Leporipoxvirus. *Genus ...
Capripoxvirus virions are different than orthopoxvirus virions in that they have a more oval profile, as well as larger lateral ... The capripoxvirus genus consists of LSDV, as well as sheeppox virus, and goatpox virus. CaPV infections are usually host ... It is a member of the capripoxvirus genus of Poxviridae. Capripoxviruses (CaPVs) represent one of eight genera within the ...
The last common ancestor of the Capripoxvirus and Suipoxvirus diverged 111 ± 29,000 years ago. A Bayesian study of Orthopox ... Capripoxvirus Goatpox virus Lumpy skin disease virus Sheeppox virus Genus: Cervidpoxvirus Mule deerpox virus Genus: ...
Capripoxvirus, Leporipoxvirus, Suipoxvirus and Yatapoxvirus genera cluster together: Capripoxvirus and Suipoxvirus share a ... The last common ancestor of the Capripoxvirus and Suipoxvirus diverged 111,000 ± 29,000 years ago. An isolate from a fish - ... Avipoxvirus, Capripoxvirus, Cervidpoxvirus, Orthopoxvirus, Suipoxvirus, Yatapoxvirus and one Entomopox genus ( ... Chordopoxvirinae Avipoxvirus Capripoxvirus Centapoxvirus Cervidpoxvirus Crocodylidpoxvirus Leporipoxvirus Macropopoxvirus ...
Buttersvirus Bymovirus Caeruleovirus Cafeteriavirus Caligrhavirus Camvirus Canoevirus Capillovirus Capistrivirus Capripoxvirus ...
... capripoxvirus MeSH B04.280.650.160.150.500 - lumpy skin disease virus MeSH B04.280.650.160.500 - leporipoxvirus MeSH B04.280. ... capripoxvirus MeSH B04.909.204.783.160.150.500 - lumpy skin disease virus MeSH B04.909.204.783.160.500 - leporipoxvirus MeSH ...
Capripoxvirus, Leporipoxvirus, Molluscipoxvirus, Orthopoxvirus, Parapoxvirus, Suipoxvirus and Yatapoxvirus Vertebrates are the ...
"Capripoxvirus". Veterinary and Agrochemical Research Centre. "The Molecular Epidemiology of capripoxvirus in Sub-Saharan Africa ... Capripoxvirus Goatpox virus Lumpy skin disease virus Sheeppox virus Viruses in Capripoxvirus are enveloped, with brick-shaped ... All Capripoxvirus species tend to be spread by means of insect vector. Sheeppox and goatpox are also transmissible by aerosol ... All Capripoxvirus DNA are double-stranded with lengths of around 150 kbp. Strains from goatpox and sheeppox share at least 147 ...
"Capripoxvirus". Veterinary and Agrochemical Research Centre. "The Molecular Epidemiology of capripoxvirus in Sub-Saharan Africa ... Capripoxvirus Goatpox virus Lumpy skin disease virus Sheeppox virus Viruses in Capripoxvirus are enveloped, with brick-shaped ... All Capripoxvirus species tend to be spread by means of insect vector. Sheeppox and goatpox are also transmissible by aerosol ... All Capripoxvirus DNA are double-stranded with lengths of around 150 kbp. Strains from goatpox and sheeppox share at least 147 ...
Use of the Capripoxvirus homologue of Vaccinia virus 30kDa RNA polymerase subunit (RPO30) gene as a novel diagnostic and ...
"Capripoxvirus" taxonomic term. The additional filters enable you with creating a sub-selection of items of this list. The ...
Capripoxvirus / Lumpy skin disease 2 (3). *PCR Triplex Kit (LSD DIVA). *PCR Triplex Kit (CPV) ...
... antigen preparations considerably improved the sensitivity of the AGID test as a diagnostic test for capripoxvirus antibody ... Studies on the Major Common Precipitating Antigen of Capripoxvirus * R. P. Kitching, J. M. Hammond and D. N. Black ... antigen preparations considerably improved the sensitivity of the AGID test as a diagnostic test for capripoxvirus antibody ...
Genus Capripoxvirus. *Genus Centapoxvirus. *Genus Cervidpoxvirus. *Genus Crocodylidpoxvirus. *Genus Leporipoxvirus. *Genus ...
Capripoxvirus. Genus. Cervidpoxvirus. Genus. Leporipoxvirus. Genus. Molluscipoxvirus. Genus. Orthopoxvirus. Genus. Parapoxvirus ...
Then Tr.P32 was purified by Ni-NTA affinity chromatography under denaturing condition and used to develop a Capripoxvirus ... "Development and Evaluation of an Indirect Capripox Virus ELISA Based on Truncated P32 Protein expressed in E.coli". سامانه ... Then Tr.P32 was purified by Ni-NTA affinity chromatography under denaturing condition and used to develop a Capripoxvirus ... Development and Evaluation of an Indirect Capripox Virus ELISA Based on Truncated P32 Protein expressed in E.coli. ...
"Capripoxvirus". viralzone.expasy.org. Retrieved 2017-11-03. "Sheeppox and Goatpox - Integumentary System - Merck Veterinary ... This virus is in the family Poxviridae and genus Capripoxvirus. Sheeppox virus (SPV) is the most severe of all the animal pox ...
Capripoxvirus. sheeppox virus. Vertebrates. Leporipoxvirus. myxoma virus. Vertebrates. Suipoxvirus. swinepox virus. Vertebrates ...
Norian R, Afzal Ahangaran N, Vashovi H R, Azadmehr A. Evaluation of Humoral and Cell-mediated Immunity of Two Capripoxvirus ... Evaluation of Humoral and Cell-mediated Immunity of Two Capripoxvirus Vaccine Strains against Lumpy Skin Disease Virus ...
Capripoxvirus-vectored vaccines against livestock diseases in Africa.. Boshra H, Truong T, Nfon C, Gerdts V, Tikoo S, Babiuk LA ... Review: Capripoxvirus Diseases: Current Status and Opportunities for Control.. Tuppurainen ESM, Venter EH, Shisler JL, Gari G, ... A lumpy skin disease virus deficient of an IL-10 gene homologue provides protective immunity against virulent capripoxvirus ... Extended sequencing of vaccine and wild-type capripoxvirus isolates provides insights into genes modulating virulence and host ...
These poxviruses include the following genera and examples: Avipoxvirus (fowlpox); Capripoxvirus (sheep pox, goatpox, and ...
The threats posed by the poxvirus have been effectively dealt with, leading to the eradication of the diseases caused by the virus. Smallpox had already been eradicated from most countries in Europe and the US by 1940s but it still posed a serious threat in the Indian subcontinent and much of Africa in the 1960s. The World Health Organization (WHO) decided to take strong actions for the eradication of the disease and listed smallpox on the top of the list for eradication in 1967. The WHO smallpox eradication unit was set up in the same year. After years of effort and investment into the eradication of smallpox, the last cases of variola major occured in the Indian subcontinent in 1975 while the last case of variola minor occured in Somalia in 1977. The last cases of smallpox occured in a Birmigam laboratory in 1979. Smallpox had been fought, and fought successfully. Smallpox has been eradicated globally but there are concerns about the potential use of variola virus as a weapon of terror. As a ...
The last common ancestor of the Capripoxvirus and Suipoxvirus diverged 111 ± 29,000 years ago. A Bayesian study of Orthopox ... Capripoxvirus Goatpox virus Lumpy skin disease virus Sheeppox virus Genus: Cervidpoxvirus Mule deerpox virus Genus: ...
Categories: Capripoxvirus Image Types: Photo, Illustrations, Video, Color, Black&White, PublicDomain, CopyrightRestricted 24 ...
Compositions comprising one or more isolated nucleic acid molecules that encode an immunogen in combination with one or more of CTACK protein, TECK protein, MEC protein and functional fragments thereof and/or an isolated nucleic acid molecule that encodes an protein selected from the group consisting of: CTACK, TECK, MEC and functional fragments thereof are disclosed. Methods of inducing an immune response, including methods of inducing mucosal immune responses, in an individual against an immunogen, using such compositions are disclosed.
Technical Abstract: Sheeppox virus (SPPV) is a member of the Capripoxvirus (CaPV) genus of the Poxviridae family. Members of ...
Capripoxvirus/classifica o. Capripoxvirus/gen tica. DNA Viral/qu mica. DNA Viral/isolamento & purifica o. Ectima Contagioso/ ... Capripoxvirus/gen tica. Capripoxvirus/patogenicidade. Bovinos. Creatinina/sangue. DNA Viral. Fal ncia Hep tica/sangue. Fal ncia ... Capripoxvirus/gen tica. Capripoxvirus/ultraestrutura. Infec es por Poxviridae/veterin ria. Doen as dos Ovinos/patologia. Doen ... Capripoxvirus/gen tica. Bovinos. Doen as dos Bovinos/diagn stico. Doen as dos Bovinos/virologia. DNA Viral/gen tica. Feminino. ...
Protection of sheep against Rift Valley fever virus and sheep poxvirus with a recombinant capripoxvirus vaccine. ...
Lumpy Skin Disease (LSD) is caused by the lumpy skin disease virus (i.e. capripoxvirus, poxviridae). The disease affects mainly ...
15 . Greth, A., Gourreau, J. M. Vassart, M. Ba-Uy, N. Wyers, M. and Lefevre, P. C. Capripoxvirus disease in an Arabian Oryx ( ... 7. Electron Microscopy (EM) EM revealed a typical capripoxvirus in one of the dermal biopsies (Fig.7). The EM procedure is ... sub-acute or inapparent infectious disease of cattle caused by a single strain of capripox virus known as Neethling virus. It ...
Capripoxvirus,/i, (CaPV) DNA in clinical samples. A real-time PCR high-resolution melt assay was performed to genotype CaPVs. ... A quantitative real-time PCR method was used to detect Capripoxvirus (CaPV) DNA in clinical samples. A real-time PCR high- ... A. Greth, J. M. Gourreau, M. Vassart, Nguyen-Ba-Vy, M. Wyers, and P. C. Lefevre, "Capripoxvirus disease in an Arabian oryx ( ... V. M. Carn, "Control of capripoxvirus infections," Vaccine, vol. 11, no. 13, pp. 1275-1279, 1993. View at: Publisher Site , ...
... genus Capripoxvirus, family Poxviridae) structural proteins as candidate subunit vaccines to control sheep pox disease. SPPV ... The aim of this work was to evaluate the immunogenicity and neutralizing activity of sheep pox virus (SPPV; genus Capripoxvirus ...
Mechanical transmission of capripox virus and African swine fever virus by Stomoxys calcitrans. Res Vet Sci (1987) 43(1):109-12 ...
Protection of sheep against Rift Valley fever virus and sheep poxvirus with a recombinant capripoxvirus vaccine. Clin Vaccine ... The experiments reported during the workshop suggest that capripoxvirus-vectored vaccines can provide protection against RVFV ... It is hypothesized that multivalent capripoxvirus-based vector vaccines would be cost-effective, and their bivalent nature ... would make them attractive for inclusion in routine capripoxvirus immunization programs, thereby increasing immunity against ...
Capripoxvirus (including goatpox virus, lumpy skin disease virus); Leporipoxvirus; Suipoxvirus; Molluscipoxvirus; and ...
Protection of sheep against Rift Valley fever virus and sheep poxvirus with a recombinant capripoxvirus vaccine. Clin. Vaccine ...
It is caused by lumpy skin disease virus (LSDV), a virus from the family Poxviridae, genus Capripoxvirus. Sheeppox virus and ...
A comparison of the genome organization of capripoxvirus with that of the orthopoxviruses. P D Gershon, D M Ansell, D N Black ...
  • Capripoxvirus is a genus of viruses in the subfamily Chordopoxvirinae and the family Poxviridae. (wikipedia.org)
  • Group: dsDNA Order: Chitovirales Family: Poxviridae Sub-Family: Chordopoxvirinae Genus: Capripoxvirus Goatpox virus Lumpy skin disease virus Sheeppox virus Viruses in Capripoxvirus are enveloped, with brick-shaped geometries. (wikipedia.org)
  • This virus is in the family Poxviridae and genus Capripoxvirus. (wikipedia.org)
  • Sheeppox virus (SPPV) is a member of the Capripoxvirus (CaPV) genus of the Poxviridae family. (usda.gov)
  • Lumpy Skin Disease (LSD) is caused by the lumpy skin disease virus (i.e. capripoxvirus, poxviridae). (fao.org)
  • The causative agent is a member of the Capripoxvirus genus in the Poxviridae family [ 1 ]. (hindawi.com)
  • genus Capripoxvirus , family Poxviridae ) structural proteins as candidate subunit vaccines to control sheep pox disease. (mdpi.com)
  • It is caused by lumpy skin disease virus (LSDV), a virus from the family Poxviridae, genus Capripoxvirus. (foodsafetynews.com)
  • Sheep and goat pox (SGP) is a highly contagious disease caused by a virus in the family Poxviridae and genus Capripoxvirus . (asmscience.org)
  • Lumpy skin disease (LSD) is a serious pox disease of cattle caused by LSD virus of the genus Capripoxvirus , subfamily Chordopoxvirinae and family Poxviridae . (wur.nl)
  • They are members of the Poxviridae , genus Capripoxvirus and were believed to be strains of the same virus, but genetic sequencing has shown they are closely related separate viruses. (pirbright.ac.uk)
  • Lumpy skin disease (LSD) is a transboundary cattle disease caused by a Capripoxvirus of the family Poxviridae . (biomedcentral.com)
  • The etiological agent of LSD is a double stranded DNA Capripoxvirus which belongs to the family Poxviridae [ 1 , 2 ]. (biomedcentral.com)
  • it is caused by a capripoxvirus that belongs to the family poxviridae. (liverpool.ac.uk)
  • Sheeppox virus (SPPV) is classified in the Capripoxvirus genus of the Poxviridae family of viruses, which include the closely related Goatpox virus (GTPV) and Lumpy Skin Disease virus (LSDV). (uconn.edu)
  • Lumpy skin disease virus (LSDV) is closely related to two other viruses in the genus Capripoxvirus , sheeppox and goatpox viruses [ 5 ]. (biomedcentral.com)
  • Genera Subfamily Chordopoxvirinae Orthopoxvirus Parapoxvirus Avipoxvirus Capripoxvirus Leporipoxvirus Suipoxvirus Molluscipoxvirus Yatapoxvirus Subfamily Entomopoxvirinae Entomopoxvirus A Entomopoxvirus B Entomopoxvirus C Poxviruses (members of the family Poxviridae) can infect as a family both vertebrate and invertebrate animals. (statemaster.com)
  • in order to study the importance of an intact thymidine kinase (tk) gene for the vaccine strain of a southern african capripoxvirus, namely, lumpy skin disease virus (lsdv) (type sa-neethling), a tk disruption recombinant was generated expressing the escherichia coli beta-galactosidase (lacz) reporter gene. (liverpool.ac.uk)
  • Conclusions Results show that the detection of capripoxvirus specific antibodies in milk samples using the commercially available ELISA from IDvet is feasible and can represent a helpful tool for LSDV monitoring programs. (ac.rs)
  • This has been shown to occur not only in the laboratory between strains of orthopoxvirus and between strains of leporipoxvirus, but also in the field between strains of capripoxvirus. (barnardhealth.us)
  • Lumpy skin disease, caused by species Lumpy skin disease virus of the genus Capripoxvirus, is a disease of cattle, buffalo, and occasionally other wild species of hoofstock, characterized by the eruption of multiple, well-circumscribed skin nodules, accompanied by fever, ventral edema, and generalized lymphadenopathy. (momscorner4kids.com)
  • The last common ancestor of the Capripoxvirus and Suipoxvirus diverged 111 ± 29,000 years ago. (wikipedia.org)
  • Norian R, Afzal Ahangaran N, Vashovi H R, Azadmehr A. Evaluation of Humoral and Cell-mediated Immunity of Two Capripoxvirus Vaccine Strains against Lumpy Skin Disease Virus. (org.ir)
  • LUMPY skin disease (LSD) is a notifiable disease of cattle which is caused by a capripoxvirus. (momscorner4kids.com)
  • Protection of sheep against Rift Valley fever virus and sheep poxvirus with a recombinant capripoxvirus vaccine. (nih.gov)
  • A G-protein-coupled chemokine receptor: A putative insertion site for a multi-pathogen recombinant capripoxvirus vaccine strategy. (bireme.br)
  • Capripoxvirus strains are often recognized by how the main target host responds. (wikipedia.org)
  • As with the orthopoxviruses, polyclonal sera are equally reactive with homologous and heterologous strains of capripoxvirus. (barnardhealth.us)
  • Extended sequencing of vaccine and wild-type capripoxvirus isolates provides insights into genes modulating virulence and host range. (nih.gov)
  • All members of the capripoxvirus genus also cross-protect, and although differences have been identified between the viral polypeptides of different isolates, these have not yet been used to distinguish between them. (barnardhealth.us)
  • Isolates of capripoxvirus collected in Kenya over a 30 year period cannot be distinguished by comparing the genome fragments generated by Hind]]] restriction endonuclease digestion. (barnardhealth.us)
  • We have compared detailed physical maps of the genomes of four capripoxvirus isolates, representing four capripoxvirus genome types. (microbiologyresearch.org)
  • Of the three assays that showed the most promise, one had a superior ability to differentiate between capripoxvirus infected and uninfected sheep, goats, and cattle, with diagnostic sensitivity and specificity ranging between 98-100%, but it was unable to detect antibodies reliably in vaccinated animals. (mla.com.au)
  • Then Tr.P32 was purified by Ni-NTA affinity chromatography under denaturing condition and used to develop a Capripoxvirus specific ELISA. (agrijournals.ir)
  • Background The detection of antibodies against capripoxvirus has become easier with a commercially available ELISA validated for serum and plasma. (ac.rs)
  • The Capripoxvirus (CaPV) has a large double-stranded DNA genome and a restricted host-range. (bvsalud.org)
  • A quantitative real-time PCR method was used to detect Capripoxvirus (CaPV) DNA in clinical samples. (hindawi.com)
  • The use of [ 35 S]methionine-labelled antigen preparations considerably improved the sensitivity of the AGID test as a diagnostic test for capripoxvirus antibody detection. (microbiologyresearch.org)
  • All Capripoxvirus species tend to be spread by means of insect vector. (wikipedia.org)
  • Generally, capripoxvirus infections are host specific in nature and occasionally infect more than one species. (bireme.br)
  • It is caused by lumpy skin diseases virus of capripoxvirus. (springjournals.net)
  • Application des techniques utilisées en pathologie pour étudier la pathogenèse des maladies émergentes ou ne provenant pas du Canada, comme le virus de Nipah, le virus de la fièvre de la Vallée du Rift, le virus de la grippe, le virus de la maladie hémorragique du lapin et le virus Ebola. (gc.ca)
  • Capripoxvirus G-protein-coupled chemokine receptor : a host-range gene suitable for virus animal origin discrimination. (cirad.fr)
  • 2002). However, little is known about the role these genes play in Capripoxvirus pathogenesis. (uconn.edu)
  • Modification of two capripoxvirus quantitative real-time PCR assays to improve diagnostic sensitivity and include beta-actin as an internal positive control. (bireme.br)
  • Chand, Puran (1992) Molecular and Immunological Characterisation of a Major Envelope Protein of Capripoxvirus Doctoral thesis, University of Surrey. (surrey.ac.uk)
  • Capripoxvirus is characterized by the development of pox lesions on the skin. (wikipedia.org)