A peptide hormone that lowers calcium concentration in the blood. In humans, it is released by thyroid cells and acts to decrease the formation and absorptive activity of osteoclasts. Its role in regulating plasma calcium is much greater in children and in certain diseases than in normal adults.
Calcitonin gene-related peptide. A 37-amino acid peptide derived from the calcitonin gene. It occurs as a result of alternative processing of mRNA from the calcitonin gene. The neuropeptide is widely distributed in neural tissue of the brain, gut, perivascular nerves, and other tissue. The peptide produces multiple biological effects and has both circulatory and neurotransmitter modes of action. In particular, it is a potent endogenous vasodilator.
Cell surface proteins that bind calcitonin and trigger intracellular changes which influence the behavior of cells. Calcitonin receptors outside the nervous system mediate the role of calcitonin in calcium homeostasis. The role of calcitonin receptors in the brain is not well understood.
Cell surface proteins that bind CALCITONIN GENE-RELATED PEPTIDE with high affinity and trigger intracellular changes which influence the behavior of cells. CGRP receptors are present in both the CENTRAL NERVOUS SYSTEM and the periphery. They are formed via the heterodimerization of the CALCITONIN RECEPTOR-LIKE PROTEIN and RECEPTOR ACTIVITY-MODIFYING PROTEIN 1.
A receptor protein that is associated with RECEPTOR ACTIVITY-MODIFYING PROTEINS. When bound to RECEPTOR ACTIVITY-MODIFYING PROTEIN 1 it forms the CALCITONIN GENE-RELATED RECEPTOR. When bound to RECEPTOR ACTIVITY-MODIFYING PROTEIN 2 or RECEPTOR ACTIVITY-MODIFYING PROTEIN 3 it forms the ADRENOMEDULLIN RECEPTOR.
A family of proteins that bind to CELL SURFACE RECEPTORS and alter their specificity, signaling mechanism, or mode of intracellular transport.
A receptor activity-modifying protein that is a subunit of specific G-PROTEIN COUPLED RECEPTORS. The CALCITONIN GENE-RELATED PEPTIDE RECEPTOR is formed from a dimer of this protein and CALCITONIN RECEPTOR-LIKE PROTEIN, while an isoform of the ISLET AMYLOID POLYPEPTIDE RECEPTOR is formed from this protein dimerizing with the CALCITONIN RECEPTOR.
A 52-amino acid peptide with multi-functions. It was originally isolated from PHEOCHROMOCYTOMA and ADRENAL MEDULLA but is widely distributed throughout the body including lung and kidney tissues. Besides controlling fluid-electrolyte homeostasis, adrenomedullin is a potent vasodilator and can inhibit pituitary ACTH secretion.
Fish of the genera ONCORHYNCHUS and Salmo in the family SALMONIDAE. They are anadromous game fish, frequenting the coastal waters of both the North Atlantic and Pacific. They are known for their gameness as a sport fish and for the quality of their flesh as a table fish. (Webster, 3d ed).
A receptor activity-modifying protein that heterodimerizes with CALCITONIN RECEPTOR-LIKE PROTEIN to form the ADRENOMEDULLIN RECEPTOR. In addition, an isoform of the ISLET AMYLOID POLYPEPTIDE RECEPTOR is formed from this protein dimerizing with the CALCITONIN RECEPTOR.
A receptor activity-modifying protein that heterodimerizes with CALCITONIN RECEPTOR-LIKE PROTEIN to form the ADRENOMEDULLIN RECEPTOR. In addition, an isoform of the ISLET AMYLOID POLYPEPTIDE RECEPTOR is formed from this protein dimerizing with the CALCITONIN RECEPTOR.
G-protein coupled receptors that are formed through the dimerization of the CALCITONIN RECEPTOR with a RECEPTOR ACTIVITY-MODIFYING PROTEIN. Their affinity for ISLET AMYLOID POLYPEPTIDE is dependent upon which of several receptor activity-modifying protein subtypes they are bound to.
An eleven-amino acid neurotransmitter that appears in both the central and peripheral nervous systems. It is involved in transmission of PAIN, causes rapid contractions of the gastrointestinal smooth muscle, and modulates inflammatory and immune responses.
G-protein-coupled cell surface receptors for ADRENOMEDULLIN. They are formed by the heterodimerization of CALCITONIN RECEPTOR-LIKE PROTEIN and either RECEPTOR ACTIVITY-MODIFYING PROTEIN 2 or RECEPTOR ACTIVITY-MODIFYING PROTEIN 3.
A carcinoma composed mainly of epithelial elements with little or no stroma. Medullary carcinomas of the breast constitute 5%-7% of all mammary carcinomas; medullary carcinomas of the thyroid comprise 3%-10% of all thyroid malignancies. (From Dorland, 27th ed; DeVita Jr et al., Cancer: Principles & Practice of Oncology, 3d ed, p1141; Segen, Dictionary of Modern Medicine, 1992)
An alkylamide found in CAPSICUM that acts at TRPV CATION CHANNELS.
Tumors or cancer of the THYROID GLAND.
Peptides released by NEURONS as intercellular messengers. Many neuropeptides are also hormones released by non-neuronal cells.
A diverticulum from the fourth pharyngeal pouch of an embryo, regarded by some as a rudimentary fifth pharyngeal pouch and by others as a lateral thyroid primordium. The ultimobranchial bodies of lower vertebrates contain large amounts of calcitonin. In mammals the bodies fuse with the thyroid gland and are thought to develop into the parafollicular cells. (Stedman, 25th ed)
Common name for an order (Anguilliformes) of voracious, elongate, snakelike teleost fishes.
A disease marked by repeated episodes of increased bone resorption followed by excessive attempts at repair, resulting in weakened, deformed bones of increased mass. The resultant architecture of the bone assumes a mosaic pattern in which the fibers take on a haphazard pattern instead of the normal parallel symmetry.
Surgical removal of the thyroid gland. (Dorland, 28th ed)
A polypeptide hormone (84 amino acid residues) secreted by the PARATHYROID GLANDS which performs the essential role of maintaining intracellular CALCIUM levels in the body. Parathyroid hormone increases intracellular calcium by promoting the release of CALCIUM from BONE, increases the intestinal absorption of calcium, increases the renal tubular reabsorption of calcium, and increases the renal excretion of phosphates.
A synthetic pentapeptide that has effects like gastrin when given parenterally. It stimulates the secretion of gastric acid, pepsin, and intrinsic factor, and has been used as a diagnostic aid.
An adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH.
Agents causing contraction of the pupil of the eye. Some sources use the term miotics only for the parasympathomimetics but any drug used to induce miosis is included here.
A highly vascularized endocrine gland consisting of two lobes joined by a thin band of tissue with one lobe on each side of the TRACHEA. It secretes THYROID HORMONES from the follicular cells and CALCITONIN from the parafollicular cells thereby regulating METABOLISM and CALCIUM level in blood, respectively.
Cell surface receptors that bind peptide messengers with high affinity and regulate intracellular signals which influence the behavior of cells.
A pancreatic beta-cell hormone that is co-secreted with INSULIN. It displays an anorectic effect on nutrient metabolism by inhibiting gastric acid secretion, gastric emptying and postprandial GLUCAGON secretion. Islet amyloid polypeptide can fold into AMYLOID FIBRILS that have been found as a major constituent of pancreatic AMYLOID DEPOSITS.
A strain of albino rat used widely for experimental purposes because of its calmness and ease of handling. It was developed by the Sprague-Dawley Animal Company.
Bone loss due to osteoclastic activity.
Neurons which conduct NERVE IMPULSES to the CENTRAL NERVOUS SYSTEM.
Classic quantitative assay for detection of antigen-antibody reactions using a radioactively labeled substance (radioligand) either directly or indirectly to measure the binding of the unlabeled substance to a specific antibody or other receptor system. Non-immunogenic substances (e.g., haptens) can be measured if coupled to larger carrier proteins (e.g., bovine gamma-globulin or human serum albumin) capable of inducing antibody formation.
The semilunar-shaped ganglion containing the cells of origin of most of the sensory fibers of the trigeminal nerve. It is situated within the dural cleft on the cerebral surface of the petrous portion of the temporal bone and gives off the ophthalmic, maxillary, and part of the mandibular nerves.
A basic element found in nearly all organized tissues. It is a member of the alkaline earth family of metals with the atomic symbol Ca, atomic number 20, and atomic weight 40. Calcium is the most abundant mineral in the body and combines with phosphorus to form calcium phosphate in the bones and teeth. It is essential for the normal functioning of nerves and muscles and plays a role in blood coagulation (as factor IV) and in many enzymatic processes.
Reduction of the blood calcium below normal. Manifestations include hyperactive deep tendon reflexes, Chvostek's sign, muscle and abdominal cramps, and carpopedal spasm. (Dorland, 27th ed)
A large multinuclear cell associated with the BONE RESORPTION. An odontoclast, also called cementoclast, is cytomorphologically the same as an osteoclast and is involved in CEMENTUM resorption.
A highly basic, 28 amino acid neuropeptide released from intestinal mucosa. It has a wide range of biological actions affecting the cardiovascular, gastrointestinal, and respiratory systems and is neuroprotective. It binds special receptors (RECEPTORS, VASOACTIVE INTESTINAL PEPTIDE).
Sensory ganglia located on the dorsal spinal roots within the vertebral column. The spinal ganglion cells are pseudounipolar. The single primary branch bifurcates sending a peripheral process to carry sensory information from the periphery and a central branch which relays that information to the spinal cord or brain.
The calcium salt of gluconic acid. The compound has a variety of uses, including its use as a calcium replenisher in hypocalcemic states.
Partial proteins formed by partial hydrolysis of complete proteins or generated through PROTEIN ENGINEERING techniques.
Slender processes of NEURONS, including the AXONS and their glial envelopes (MYELIN SHEATH). Nerve fibers conduct nerve impulses to and from the CENTRAL NERVOUS SYSTEM.
Agents that inhibit BONE RESORPTION and/or favor BONE MINERALIZATION and BONE REGENERATION. They are used to heal BONE FRACTURES and to treat METABOLIC BONE DISEASES such as OSTEOPOROSIS.
The relationship between the dose of an administered drug and the response of the organism to the drug.
The 5th and largest cranial nerve. The trigeminal nerve is a mixed motor and sensory nerve. The larger sensory part forms the ophthalmic, mandibular, and maxillary nerves which carry afferents sensitive to external or internal stimuli from the skin, muscles, and joints of the face and mouth and from the teeth. Most of these fibers originate from cells of the TRIGEMINAL GANGLION and project to the TRIGEMINAL NUCLEUS of the brain stem. The smaller motor part arises from the brain stem trigeminal motor nucleus and innervates the muscles of mastication.
A mammalian neuropeptide of 10 amino acids that belongs to the tachykinin family. It is similar in structure and action to SUBSTANCE P and NEUROKININ B with the ability to excite neurons, dilate blood vessels, and contract smooth muscles, such as those in the BRONCHI.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
A hydroxylated form of the imino acid proline. A deficiency in ASCORBIC ACID can result in impaired hydroxyproline formation.
Members of the class of compounds composed of AMINO ACIDS joined together by peptide bonds between adjacent amino acids into linear, branched or cyclical structures. OLIGOPEPTIDES are composed of approximately 2-12 amino acids. Polypeptides are composed of approximately 13 or more amino acids. PROTEINS are linear polypeptides that are normally synthesized on RIBOSOMES.
A strain of albino rat developed at the Wistar Institute that has spread widely at other institutions. This has markedly diluted the original strain.
A 36-amino acid peptide present in many organs and in many sympathetic noradrenergic neurons. It has vasoconstrictor and natriuretic activity and regulates local blood flow, glandular secretion, and smooth muscle activity. The peptide also stimulates feeding and drinking behavior and influences secretion of pituitary hormones.
Abnormally high level of calcium in the blood.
The physiological widening of BLOOD VESSELS by relaxing the underlying VASCULAR SMOOTH MUSCLE.
A specialized CONNECTIVE TISSUE that is the main constituent of the SKELETON. The principle cellular component of bone is comprised of OSTEOBLASTS; OSTEOCYTES; and OSTEOCLASTS, while FIBRILLAR COLLAGENS and hydroxyapatite crystals form the BONE MATRIX.
Histochemical localization of immunoreactive substances using labeled antibodies as reagents.
A class of disabling primary headache disorders, characterized by recurrent unilateral pulsatile headaches. The two major subtypes are common migraine (without aura) and classic migraine (with aura or neurological symptoms). (International Classification of Headache Disorders, 2nd ed. Cephalalgia 2004: suppl 1)
Hormones released from neoplasms or from other cells that are not the usual sources of hormones.

Disruption of estrogen signaling does not prevent progesterone action in the estrogen receptor alpha knockout mouse uterus. (1/1409)

Estrogen is known to increase progesterone receptor (PR) levels in the wild-type mouse uterus, and this estrogen induction was thought to be important for progesterone action through the PR. The estrogen receptor alpha knockout (ERKO) mouse uterus was observed to express PR mRNA that cannot be induced by estrogen. Progesterone action was characterized to determine whether it was diminished in ERKO mice. The PR protein is present in the ERKO uterus at 60% of the level measured in a wild-type uterus. The PR-A and PR-B isoforms are both detected on Western blot, and the ratio of isoforms is the same in both genotypes. Although the level of PR is reduced in the ERKO uterus, the receptor level is sufficient to induce genomic responses, since both calcitonin and amphiregulin mRNAs were increased after progesterone treatment. Finally, the ERKO uterus can be induced to undergo a progesterone-dependent decidual response. Surprisingly, the decidual response is estrogen independent in the ERKO, although it remains estrogen dependent in a wild type. These results indicate that estrogen receptor alpha modulation of PR levels is not necessary for expression of the PR or genomic and physiologic responses to progesterone in the ERKO uterus.  (+info)

A prospective study of bone loss and turnover after allogeneic bone marrow transplantation: effect of calcium supplementation with or without calcitonin. (2/1409)

Transplantation of solid organs including heart, kidney, and liver is associated with rapid bone loss and increased rate of fracture; data on bone marrow transplantation recipients (BMT) are scarce. The purpose of the present study was to examine the magnitude, timing, and mechanism of bone loss following allogeneic BMT, and to study whether bone loss can be prevented by calcium with or without calcitonin. Sixty-nine patients undergoing allogeneic BMT for malignant blood diseases were enrolled into the study. Forty-four (22 women, 22 men) completed 6 months, and 36 patients 1 year follow-up. They were randomized to receive either no additional treatment (n = 22), or oral calcium 1 g twice daily for 12 months (n = 12) or the same dose of calcium plus intranasal calcitonin 400 IU/day for the first month and then 200 IU/day for 11 months (n = 10). Bone mineral density (BMD) at the lumbar spine and three femoral sites (femoral neck, trochanter, Ward's triangle) was measured by dual-energy X-ray absorptiometry (DXA). Bone turnover rate was followed with markers of bone formation and resorption (serum bone-specific alkaline phosphatase (B-ALP), type I procollagen carboxyterminal (PICP) and aminoterminal propeptide (PINP), serum type I collagen carboxyterminal telopeptide (ICTP)). Serum testosterone was assayed in men. Calcium with or without calcitonin had no effect on bone loss or bone markers; consequently the three study groups were combined. During the first 6 post-transplant months BMD decreased by 5.7% in the lumbar spine and by 6.9% to 8.7% in the three femoral sites (P < 0.0001 for all); no significant further decline occured between 6 and 12 months. Four out of 25 assessable patients experienced vertebral compression fractures. Markers of bone formation reduced: B-ALP by 20% at 3 weeks (P = 0.027), PICP by 40% (P < 0.0001) and PINP by 63% at 6 weeks (P < 0.0001), with a return to baseline by 6 months. The marker of bone resorption, serum ICTP was above normal throughout the whole observation period, with a peak at 6 weeks (77% above baseline, P < 0.0001). In male patients serum testosterone decreased reaching a nadir (57% below baseline) at 6 weeks (P = 0.0003). In conclusion, significant bone loss occurs after BMT. It results from imbalance between reduced bone formation and increased bone resorption; hypogonadism may be a contributing factor in men. Bone loss can not be prevented by calcium with or without calcitonin.  (+info)

Study of the cell biology and biochemistry of cherubism. (3/1409)

AIMS: To establish whether the multinucleate cells in lesions of patients with cherubism are also osteoclasts and if this is the case whether they were responsive to calcitonin; to carry out cytogenetic studies on two members of the same family affected by cherubism in an attempt to identify any major chromosomal defects; and to perform an in-depth modern biochemical study of four children in the same family. SUBJECTS AND METHODS: Four related children with cherubism were studied. Tissue taken from one of the children at elective decompression of an optic nerve was submitted to in vitro bone resorption studies. Cytogenetic studies were done on two of the children and biochemical studies on all four. RESULTS: The multinucleate cells in the cherubic lesions were shown to be osteoclasts since they synthesised tartrate resistant acid phosphatase, expressed the vitronectin receptor, and resorbed bone. Bone resorption by the cultured multinucleate cells was significantly inhibited by calcitonin. High resolution cytogenetic studies failed to detect any chromosomal abnormalities in two children with cherubism. The biochemistry profile of all four children with cherubism showed that serum calcium, parathyroid hormone, parathyroid related hormone, calcitonin, and alkaline phosphatase were within normal levels. Urine analysis of pyridinium and deoxypyridinium cross links, hydroxyproline, and calcium in relation to urine creatinine were measured to assess bone resorption in these children, and the values were at the upper end of the normal range in all four. CONCLUSIONS: Further studies are required to determine whether calcitonin treatment will control this grossly deforming disease until the time when the physiological changes that occur at puberty rectify the pathology. It is not recommended that biochemical markers of bone resorption are used in isolation to monitor the activity of cherubism in individuals because the results are based on a small number of children and because of reports of marked interindividual variation in the levels of these markers, particularly in children.  (+info)

Gastroenteropancreatic neuroendocrine tumor metastases to the thyroid gland: differential diagnosis with medullary thyroid carcinoma. (4/1409)

Neuroendocrine tumors (NET) of the thyroid gland are rare. Apart from medullary thyroid carcinoma (MTC), metastases of gastroenteropancreatic (GEP) NET may also occur. Features of six patients (five men, one female: age range, 39-67 years) with thyroid metastases from a GEP-NET are described. Thyroid metastases were bilateral in all patients and were associated with enlarged neck lymph nodes in five. In four cases, the thyroid tumor was either the first sign of the disease (n = 2) or was an isolated site of recurrence (n = 2). The tumors were well (n = 3) or poorly differentiated (n = 3). Five tumors for which the primary site could be determined corresponded to foregut-derived tumors (3 lungs, 1 thymus and 1 pancreatic NET). One tumor demonstrated calcitonin (CT) production as shown by immunohistochemistry and elevated plasma CT levels. However, the disease history and the clinical features strongly favored a metastasizing GEP-NET. No tumoral RET proto-oncogene mutation was found in this patient. The differential diagnosis between metastatic GEP-NET and MTC is crucial because prognosis, work-up, and treatment differ greatly.  (+info)

Roles of circulating carcinoembryonic antigen and calcitonin in diagnosis of medullary thyroid carcinoma: a comparative study. (5/1409)

Carcinoembryonic antigen (CEA) and calcitonin (CT) were simultaneously determined in sera and tumor tissues from 15 patients with medullary carcinoma of the thyroid (MCT). Serum CEA was increased in all but one patient, and CT did in all of them. Both levels were significantly related to the weight of excised tumor, but not to the presence of metastasis. Furthermore, a significant correlation was noted between the basal levels of CT and CEA. Both levels fell to normal after a radical operation had been performed. Tissue concentrations of CEA and CT in the MCT were more than 100 times those in hyperthyroidism, and the ratios of tissue over serum levels averaged 770 in CEA and 1000 in CT. In the calcium infusion test, CEA levels were not significantly changed in contrast with a distinct increase in CT levels. The results indicate that CEA and CT represent separate activities of the tumor cells, and that circulating CEA together with CT is a useful indicator in the diagnosis and follow-up of the disease.  (+info)

Glucocorticoid-induced secondary osteopenia in female rats: a time course study as compared with ovariectomy-induced osteopenia and response to salmon calcitonin. (6/1409)

Previously we reported that 8-week treatment with methylprednisolone acetate (MPA: 0.1 mg/kg, s.c., 3 days a week) of male rats caused a novel type of osteopenia whose development was prevented by salmon calcitonin (SCT) in a dose-dependent manner. In this study, to compare the MPA-inducible osteopenia with the ovariectomy (OVX)-inducible one, female rats were used instead of male rats and a time-course study of development was made. MPA treatments for 1, 2, 4 and 8 weeks histologically induced characteristic osteopenic changes in a time-dependent manner that were histomorphometrically detectable in tibiae within 4 weeks as reduced bone mass, accelerated bone resorption, and suppressed bone formation and mineralization. Node-strut analysis revealed that the connectivity of the trabecular structure remained unaffected. Such MPA-induced changes in the trabecular structure, to be defined as thinned-but-uncut, is in a good contrast with OVX-induced unthinned-but-cut structure, although the latter osteopenic changes became detectable 2 weeks earlier. Another previous finding confirmed herein was that MPA-induced osteopenia in female rats was also completely masked by SCT (10 U/kg, s.c., 5 days a week). The results indicate that the MPA-inducible secondary osteopenic model in either sex of rats would be usable for testing anti-osteopenic drugs.  (+info)

Protein kinase C antagonizes pertussis-toxin-sensitive coupling of the calcitonin receptor to adenylyl cyclase. (7/1409)

The calcitonin receptor is known to couple to Gs and Gq, activating adenylyl cyclase and phospholipase C, respectively. The observation of pertussis-toxin-sensitive responses to calcitonin suggests that the receptor is capable of coupling to Gi/o as well. However, the calcitonin-dependent activation of adenylyl cyclase in HEK-293 cells that stably express the cloned rabbit calcitonin receptor, as in many other cells that express calcitonin receptors, shows little pertussis toxin sensitivity. Calcitonin treatment of these cells stimulates protein kinase C, which is reported to antagonize the receptor-dependent activation of Gi. The possibility that protein kinase C could be antagonizing Galphai-adenylyl cyclase coupling was tested by examining the effects of protein kinase C inhibitors (chelerythrine chloride and sphingosine) or of chronic treatment with phorbol ester to deplete protein kinase C. All three treatments led to a reduction of calcitonin-induced adenylyl cyclase activity that was reversed by pertussis toxin. Inhibiting or depleting protein kinase C had no effect on the activation of adenylyl cyclase by cholera toxin, indicating that Gs and adenylyl cyclase were not affected by these treatments. Calcitonin treatment of HEK-293 cells, that stably express a myc-tagged rabbit calcitonin receptor, induced the formation of complexes of the receptor and Galphai subunits, confirming that the calcitonin receptor interacts with Gi. Thus, the calcitonin receptor can couple to Gi, but the inhibition of adenylyl cyclase by Galphai is negatively regulated by protein kinase C.  (+info)

A transient increase in renal clearance of phosphate in response to continuous infusion of salmon calcitonin in rats. (8/1409)

The effects of intravenous carrier-free salmon calcitonin on renal clearances of phosphate, calcium, magnesium, sodium and potassium were studied in male parathyroid-ectomized (PTX) and intact rats. Both natural and synthetic hormone, when infused at constant rates (0.005 approximately 0.5 MRC U/hr), produced a rapid increase (peaking at about 60-90 min) in phosphate clearance. However, the maximal increase was transient in nature in PTX rats. In intact rats, the phosphaturic response was somewhat more pronounced and the decline after the peak was rather modest. When a large amount (4 MRC U) of calcitonin was given in divided doses, the second dose produced a lesser extent of phosphaturia in both intact and PTX rats. The phosphaturic response was accompanied by an increase in sodium and potassium clearances in PTX rats and by an increase in potassium clearance in intact rats. A fall in the apparent clearance values for calcium and magnesium occurred and was maintained throughout the infusion period of hormone in both intact and PTX rats. In conclusion, PTX rats respond to the intravenous administration of salmon calcitonin with a transient phosphaturic response which is accompanied by parallel diuresis of sodium and potassium along with sustained retention of calcium and magnesium by the kidney.  (+info)

Oral calcium supplements (80 mg/kg per 24 h) were given to 23 preterm infants, and the course of serum calcium, magnesium, immunoreactive calcitonin, and gastrin was compared with a control group of 23 matched infants. In the supplemented group, serum calcium concentrations remained at the baseline level (2.31 mmol/l +/- 0.18 SD) while a fall (from 2.27 +/- 0.18 to 1.91 +/- 0.24 mmol/l) was observed at 12-16 hours of age in the control group, with 4 values , 1.75 mmol/l. There was no change in serum magnesium concentration in either group. The postnatal rise of serum immunoreactive calcitonin concentrations in the control group (from 171 +/- 135 to 493 +/- 273 pg/ml at 12-48 hours of age) was not found in the supplemented group. There was a negative correlation between serum calcium and immunoreactive calcitonin levels in the control group, but not in the supplemented group. There was no correlation between serum immunoreactive calcitonin and gastrin concentrations. These data show that oral ...
Biological activity of porcine calcitonin was most actively inactivated by the rat kidney homogenate than by other tissue homogenates. Among the various subcellular fractions of the rat kidney homogenate examined, microsome fraction was most active in the in vitro inactivation of porcine calcitonin. Inactivation of porcine calcitonin by the rat kidney microsome was dependent on pH and temperature. Inactivating activity of the rat kidney microsome was inhibited by 1 X 10(-3) M monoiodoacetate and 1 X10(-5) M p-chloromercuribenzoate. These results suggest that porcine calcitonin is probably inactivated by a SH-enzyme in the rat kidney microsomes. However, the participation of other enzymes cannot be ruled out, since the inactivating activity of the rat kidney microsome fraction is also inhibited by 1 X 10(-4) M diisopropylfuorophosphate. ...
Results There is no significant difference between two groups, in age, Sex, and symptoms. Serum and CSF procalcitonin, Leukocytosis ,15000, PMN peleocytosis of CSF and also sugarand protein of CSF were significantly higher in bacterial meningitis. Serum and CSF procalcitonin levels in control group were less than 0.5 ng/ml and ,2 ng/ml in bacterial meningitis and only one child (8.33%) in aseptic meningitis (Herpes meningoencephalitis) had serum procalcitonin more than 2 ng/ml same bacterial meningitis.. ...
Background: Anastomotic leaks in colorectal surgery results in a high morbidity and mortality rate. Serum procalcitonin levels is known as a sensitive and specific marker of sepsis and could be use as a marker for early detection of a leak allowing early intervention. It may help a clinician decide to perform a CT scan even earlier especially when the diagnosis of a leak is uncertain. The aim of this study is to determine whether serum procalcitonin is a good predictor of anastomotic leak in colorectal surgery. Methodology: Between July 2014 until October 2015, 70 patients undergoing colorectal surgery were prospectively analyzed in a single-center tertiary teaching hospital. Demographic and surgical data were obtained. Serum procalcitonin was taken before surgery and at day 3 (72 hours) postoperatively. During the postoperative period, the patients were observed in the ward for features of anastomotic leak and if present, it was managed accordingly. The primary outcome was to prospectively ...
Purpose: To correlate ultrasonographic (US) features of medullary thyroid carcinoma (MTC) with pre operative and postoperative calcitonin levels. Materials and Methods: A total of 130 thyroid nodules diagnosed as MTC were evaluated. Two radiologists retrospectively evaluated preoperative US features according to size, shape, margin, echogenicity, type of calcification, and lymph node status. Postoperative clinical and imaging followup (mean duration 31.9 22.5 months) was performed for detection of tumor recurrence. US features, presence of LN metastasis, and tumor recurrence were compared between MTC nodules with and without elevated preoperative calcitonin (|100 pg/mL). Those with normalized and nonnormalized postoperative calcitonin levels groups were also compared. Results: Common US features of MTCs were solid internal content (90.8%), irregular shape (44.6%), circumscribed margin (46.2%), and hypoechogenicity (56.2%). Comparing MTC nodules with and without elevated preoperative calcitonin levels,
Calcitonin is a circulating polypeptide that inhibits bone resorption by inducing both quiescence (Q effect) and retraction (R effect) in osteoclasts. Two structurally related members of the calcitonin gene peptide family, calcitonin gene-related peptide (CGRP) and amylin, inhibit osteoclastic bone resorption selectively via the Q effect. In the present study, we have made measurements of cell spread area in response to the application of amylin, CGRP and a peptide fragment of CGRP, CGRP-(Val8Phe37). We found that, over a wide concentration range (50 pmol/l to 2.5 mumol/l), the selective Q effect agonists did not produce an R effect. Furthermore, the peptides, when used at a 50-fold higher molar concentration than calcitonin, did not antagonize calcitonin-induced cell retraction. Additionally, experiments designed to measure changes in the intracellular free calcium concentration ([Ca2+]i) in single osteoclasts revealed that, unlike calcitonin, the non-calcitonin Q effect agonists did not produce a rise
Introduction: Chorioamnionitis is one of the most important maternal complications in the expectant management of patients with preterm premature rupture of membranes (PPROM). Procalcitonin (proCT), the precursor of the hormone calcitonin, is used to differentiate bacterial infections from...
Evaluation of: Riedel S, Melendez JH, An AT, Rosenbaum JE, Zenilman JM. Procalcitonin as a marker for the detection of bacteremia and sepsis in the emergency department. Am. J. Clin. Pathol. 135(2), 182-189 (2011). In a recent report, Riedel et al. proposed a procalcitonin cutoff of 0.1 ng/ml to rule out bacteremia in adult patients presenting to the emergency department with systemic infections. Procalcitonin levels were higher in patients with true bacteremia than in patients with negative blood cultures or bacteremia due to possible contaminants. For prediction of bacteremia, a procalcitonin level of 0.1 ng/ml had an excellent negative predictive value of 96.3%, and a good sensitivity of 75%, specificity of 70.6% and area under the curve of 0.73, but poor positive predictive value of 12.8%. Based on the results in this study, we propose that a procalcitonin value of 0.1 ng/ml or less could be used to rule out bacteremia (NPV: 96.3 ...
Cytokines, nitrite/nitrate, soluble tumor necrosis factor receptors, and procalcitonin concentrations : comparisons in patients with septic shock, cardiogenic shock, and bacterial pneumonia
The clinical utility of serum procalcitonin levels in guiding antibiotic treatment decisions in patients with sepsis remains unclear. This patient-level meta-analysis based on 11 randomized trials investigates the impact of procalcitonin-guided antibiotic therapy on mortality in intensive care unit (ICU) patients with infection, both overall and stratified according to sepsis definition, severity, and type of infection. For this meta-analysis focusing on procalcitonin-guided antibiotic management in critically ill patients with sepsis of any type, in February 2018 we updated the database of a previous individual patient data meta-analysis which was limited to patients with respiratory infections only. We used individual patient data from 11 trials that randomly assigned patients to receive antibiotics based on procalcitonin levels (the
Peptides , Calcitonin Related Peptides; Calcitonin gene-related peptide (CGRP), adrenomedullin (ADM) and amylin belong to a unique group of calcitonin-related peptide hormones important for homeostasis in diverse tissues. Calcitonin, a 32-amino acid peptide hormone, is essential for calcium balance, whereas CGRP and ADM are important for neurotransmission and cardiovascular and respiratory function. Calcitonin regulates mineral balance by controlling blood concentrations of calcium and phosphorus metabolism and can cause hypercalcemia. An increase in the serum calcium level is known to stimulate calcitonin secretion. In mammals, the major source of calcitonin is from the parafollicular or C cells in the thyroid gland, but it is also synthesized in a wide variety of other tissues, including the lung and intestinal tract. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. The calcitonin family of peptides act through G-protein protein coupled
TY - JOUR. T1 - Serum procalcitonin for differential diagnosis of acute exacerbation and bacterial pneumonia in patients with interstitial lung disease. AU - Sim, Jae Kyeom. AU - Oh, Jee Youn. AU - Lee, Eun Joo. AU - Hur, Gyu Young. AU - Lee, Seung Heon. AU - Lee, Sung Yong. AU - Lee, Sang Yeub. AU - Kim, Je Hyeong. AU - Shin, Chol. AU - Shim, Jae Jeong. AU - In, Kwang Ho. AU - Kang, Kyung Ho. AU - Min, Kyung Hoon. N1 - Funding Information: This study was supported by a grant from Korea University , Seoul, Korea ( K1326181 ). PY - 2016. Y1 - 2016. N2 - Background: Acute exacerbation and bacterial pneumonia are major life-threatening conditions in patients with interstitial lung disease (ILD). The rapid recognition of these 2 different conditions is important for their proper treatment. An elevated procalcitonin (PCT) level is commonly detected in patients with bacterial infections. This study assessed the usefulness of the serum PCT level as a biomarker for the differential diagnosis of acute ...
PCT is the prohormone of the hormone calcitonin, but PCT and calcitonin are distinct proteins. Calcitonin is exclusively produced by C-cells of the thyroid gland in response to hormonal stimuli, whereas PCT can be produced by several cell types and many organs in response to proinflammatory stimuli, in particular by bacterial products.1. In healthy people, plasma PCT concentrations are found to be below 0.1 μg/L.2 Depending on the clinical background, a PCT concentration above 0.1 μg/L can indicate clinically relevant bacterial infection, requiring antibiotic treatment.3 PCT levels rise rapidly (within 6 to 12 hours) after a bacterial infectious insult with systemic consequences. The magnitude of the increase in PCT concentration correlates with the severity of the bacterial infection.4 At a PCT concentration ,0.5 μg/L, a patient should be considered at risk of developing severe sepsis or septic shock.5,6 On the other hand, the relief of the septic infection is accompanied by a decrease in ...
Although, glucocorticoid (GC) and calcitonin-induced changes in bone repair have been studied previously, the exact effects of these on fracture healing remain controversial. Hence, the purpose of this experimental study is to determine biochemical and histological effects of locally administrated GC and systemically administrated calcitonin on the kinetics of healing response after bone marrow ablation in rats. After having undergone marrow ablation, a steroid-treated group of rats (n = 24) received a single dose of intramedullary methylprednisolone (2 mg/kg), a calcitonin-treated group (n = 24) received intermittently administrated subcutaneous salmon calcitonin (16 IU/kg), and a control group (n = 24) received intramedullary saline (25 μl). Blood samples taken on days 1, 3, 7, 9, and 15 after ablation showed an increase in serum calcium, alkaline phosphatase (ALP), and phosphate levels in the Calcitonin and Control groups. Levels of calcium and ALP peaked on day 7 after ablation. However, an
Of 80 MEN2A gene carriers (in 61 of whom carrier status was proved by DNA analysis), 66 had abnormal plasma calcitonin values and medullary thyroid carcinoma. Fourteen young carriers had normal results of plasma calcitonin tests. In 8 of these 14, thyroidectomy revealed small foci of medullary thyroid carcinoma; the remaining 6 have not yet been operated on. Of the other 220 family members, 68 were found by DNA analysis not to carry the MEN2A gene. None of these 68 subjects had medullary thyroid carcinoma or pheochromocytoma; 6 had elevated plasma calcitonin concentrations and underwent thyroidectomy but had only C-cell hyperplasia. Conclusions: ...
Fifteen eight-week-old female Sprague Dawley rats were used to determine the effects of thyrocalcitonin on osteogenic regeneration. Bone fragments of 2.8-5.3 mm were extracted from the mid-shaft of the right hind fibulae. Following surgery, seven control animals were administered saline for twenty consecutive days, whereas eight experimental animals were injected subcutaneously with 7.5 mMRC/200 g body wt of thyrocalcitonin for twenty consecutive days. After experimentation was complete, the rats were sacrificed and morphological observations were made to quantify the lengths of fibulae gaps before and after treatment. Statistical analysis indicates that bone regeneration occurs at a faster rate in those animals receiving thyrocalcitonin ...
Summary of Facts and Submissions. I. European patent application No. 82 303 667.8, relating to a human calcitonin precursor polyprotein structural gene, was published with number 0 070 675 with 17 claims. Claims 1 and 7 read as follows:. 1. A structural gene encoding a polypeptide comprising the amino acid sequence of human calcitonin, in which said polypeptide is processable to produce human calcitonin.. 7. A polypeptide containing the amino acid sequence of human calcitonin which is processable to produce human calcitonin.. II. In response to notifications issued by the Examining Division the Applicants (Appellants) filed new sets of claims on different occasions.. Finally, with a letter of 18 May 1988, a set of claims was filed whose Claim 1 reads as follows:. 1. A vector including a structural gene encoding a polypeptide comprising the amino acid sequence of human calcitonin and an additional amino acid at the C-terminus of the amino acid sequence of human calcitonin, wherein the ...
Procalcitonin (PCT) is a peptide precursor of the hormone calcitonin, the latter being involved with calcium homeostasis. It was first identified by Leonard J. Deftos and Bernard A. Roos in the 1970s. It is composed of 116 amino acids and is produced by parafollicular cells (C cells) of the thyroid and by the neuroendocrine cells of the lung and the intestine. The level of procalcitonin in the blood stream of healthy individuals is below the limit of detection (0.01 µg/L) of clinical assays. The level of procalcitonin rises in a response to a proinflammatory stimulus, especially of bacterial origin. It is therefore often classed as an acute phase reactant. In this case, it is produced mainly by the cells of the lung and the intestine.... It does not rise significantly with viral or non-infectious inflammations. With the derangements that a severe infection with an associated systemic response brings, the blood levels of procalcitonin may rise to 100 µg/L. In serum, procalcitonin has a ...
Background and Objective: Vitamin D is known to modulate thyroid neoplastic and autoimmune disease. We investigated the role of the vitamin D receptor (VDR) in normal thyroid development and function (thyrocytes and C cells). Methods: The thyroid phenotype of VDR knockout mice was studied in comparison to wild-type controls. The mice were fed a normal diet or a calcium-rich diet to circumvent effects induced by hypocalcemia. Results: Thyroid morphology was unaltered in VDR knockout mice. Also, expression of different parameters of thyrocyte function was comparable (immunohistochemistry). C cell physiology was, however, affected in the absence of the VDR, resulting in increased thyroidal calcitonin expression (immunohistochemistry), paralleled by increased serum calcitonin levels, but only in normocalcemic mice. To study a possible effect of vitamin D status on basal calcitonin levels in humans, serum calcitonin concentrations were compared between vitamin D-deficient and -sufficient patients ...
Resin peptides useful in the preparation of salmon calcitonin are disclosed along with processes for preparing the same. The invention also embraces peptides from which the resin moiety has been cleaved and which are useful in the synthesis of salmon calcitonin together with processes for preparing the cleaved peptides. In general, the processes involve the solid phase synthesis procedures.
OBJECTIVE: To examine the relationship of early serum procalcitonin (PCT) levels with the severity of post-cardiac arrest syndrome (PCAS), long-term neurological recovery and the risk of early-onset infections in patients with coma after cardiac arrest (CA) treated with therapeutic hypothermia (TH).. METHODS: A prospective cohort of adult comatose CA patients treated with TH (33°C, for 24h) admitted to the medical/surgical intensive care unit, Lausanne University Hospital, was studied. Serum PCT was measured early after CA, at two time-points (days 1 and 2). The SOFA score was used to quantify the severity of PCAS. Diagnosis of early-onset infections (within the first 7 days of ICU stay) was made after review of clinical, radiological and microbiological data. Neurological recovery at 3 months was assessed with Cerebral Performance Categories (CPC), and was dichotomized as favorable (CPC 1-2) vs. unfavorable (CPC 3-5).. RESULTS: From December 2009 to April 2012, 100 patients (median age 64 ...
Choosing to participate in a study is an important personal decision. Talk with your doctor and family members or friends about deciding to join a study. To learn more about this study, you or your doctor may contact the study research staff using the contacts provided below. For general information, Learn About Clinical Studies. ...
Sigma-Aldrich offers abstracts and full-text articles by [M Feigh, R H Nielsen, C Hansen, K Henriksen, C Christiansen, M A Karsdal].
in Pathologie Biologie (1997), 45(1), 52-6. There appears to be a consensus that 100 IU/day of nasally administered salmon calcitonin may prevent trabecular bone loss during the first years of the menopause. Strong evidence exists that half that ... [more ▼]. There appears to be a consensus that 100 IU/day of nasally administered salmon calcitonin may prevent trabecular bone loss during the first years of the menopause. Strong evidence exists that half that dose may also be sufficient to prevent trabecular bone loss and that higher doses (, or = 200 IU/day) induce a significant increase in spinal bone mineral content. Calcium supplements should be systemically administered when calcitonin is given, particularly at high doses. Rectal calcitonin seems also to be an efficient alternative in prevention of trabecular bone loss. Further studies are required to evaluate the effect of calcitonin in prevention of cortical bone loss. In established osteoporosis, calcitonin may prevent further bone loss ...
The novel inflammatory marker procalcitonin (PCT) was assessed as an index of infection in patients with febrile neutropenia. Blood samples were obtained from 115 patients with febrile neutropenia for determination of PCT levels before onset of fever and daily until the resolution of fever. The median PCT level on the first day of fever was 8.23 ng/mL in patients with bacteremia, compared with 0.86 ng/mL in patients with localized bacterial infections (P = .017). The median PCT level on the first day of fever was 2.62 ng/mL in patients with severe sepsis, compared with 0.57 ng/mL in patients with clinically localized infections (P , .001). A dramatic decrease in PCT levels was documented after resolution of the infection; PCT levels were elevated when the infection worsened. Pronounced PCT levels were also found in patients with fever of unknown origin who were responding to antimicrobial chemotherapy, compared with those not responding to treatment with antibiotics. PCT levels were particularly ...
In HAP, CAP and, to a lesser extent, AECB, but not TB, significantly elevated median PCT levels were found compared to controls. However, median PCT levels in all groups were below the recommended cut-off level of 0.5 ng·mL−1. Therefore, according to the present study, PCT concentration seems not to be particularly useful for the detection of lower respiratory tract infections e.g. CRP. Similar results were obtained by Hedlund and Hansson 21, who compared CRP and PCT levels in CAP in adults. However, Moulin etal. 22 described a superiority of PCT over CRP concentration in paediatric patients with CAP. In the recent publication of Brunkhorst et al. 23, different results, with elevated PCT levels in patients with severe pneumonia, were demonstrated. In contrast to the present study, the latter study included only patients with severe pneumonia, who were treated in the intensive care unit. This could also be a reason for the elevated PCT levels. Although diagnostic value has not been proved, PCT ...
Downlod pdf Article Sharma SK, Kumar A, Yadav B, Singh AK, Pathak R, Hussain M, Sherma A. Role of Serum Procalcitonin in Early Diagnosis of Neonatal Sepsis. National Journal of Medical and Allied Sciences 2015; 4(1):62-66. ...
We have cloned and characterized a second form of the human calcitonin receptor from T47D cells. It resembles the clone described by Gorn et al. [J. Clin. Invest. 90:1726-1735 (1992)] except that it lacks a 16-amino acid insert in the putative first intracellular loop. The insert-negative receptor appears to be the most abundant form, and it occurs at a relatively constant level in all expressing tissues. In contrast, the insert-positive receptor is found at low levels in most tissues but its expression levels appear to be much more variable. The insert-negative cDNA was stably expressed in baby hamster kidney cells. Like the endogenous T47D receptor, the recombinant receptor has an equally high affinity for salmon and porcine calcitonin but a 3-4-fold lower affinity for human calcitonin. High concentrations of calcitonin gene-related peptide, rat amylin, secretin, or vasoactive intestinal peptide do not significantly compete with calcitonin for binding to the recombinant receptor. Calcitonin ...
Definition of Procalcitonin in the Legal Dictionary - by Free online English dictionary and encyclopedia. What is Procalcitonin? Meaning of Procalcitonin as a legal term. What does Procalcitonin mean in law?
FRMC Pharmacy Director, Mike Broyles PharmD, has worked diligently for the past several years, crossing the country, educating Healthcare Representatives about Antibiotic Usage and improving patient outcomes. He recently completed a study in which he included data from over 2100 patients that had been treated at Five Rivers Medical Center. The study consisted of comparing data that was found with the patients who were treated with antibiotics prior to the use of a laboratory test called Procalcitonin (PCT) and those that were treated after the test was available. Procalcitonin (PCT) is a Peptide Precursor of the hormone Calcitonin. The level of Procalcitonin will rise in the presence of a bacterial infection. During the course of antibiotic treatment for these bacterial infections, PCT is measured to verify that the antibiotic administered is decreasing the level of PCT found circulating in the patients bloodstream. If not, Antibiotics might need to be adjusted or changed. As PCT decreases, the ...
Thank you for your interest in spreading the word about Clinical Science.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
TY - JOUR. T1 - Prostaglandin E2 enhances bradykinin-stimulated release of neuropeptides from rat sensory neurons in culture. AU - Vasko, M. R.. AU - Campbell, W. B.. AU - Waite, K. J.. PY - 1994/8/1. Y1 - 1994/8/1. N2 - Prostaglandins are known to enhance the inflammatory and nociceptive actions of other chemical mediators of inflammation such as bradykinin. One possible mechanism for this sensitizing action is that prostanoids augment the release of neuroactive substances from sensory neurons. To initially test this hypothesis, we examined whether selected prostaglandins could enhance the resting or bradykinin-evoked release of immunoreactive substance P (iSP) and/or immunoreactive calcitonin gene-related peptide (iCGRP) from sensory neurons in culture. Bradykinin alone causes a concentration-dependent increase in the release of iSP and iCGRP from isolated sensory neurons, and this action is abolished in the absence of extracellular calcium. Pretreating the neurons with PGE2 (10 nM to 1 μM) ...
The purpose of this study is to expose patients with OA to calcitonin and to determine plasma calcitonin levels after administration of 0.6 mg and 0.8 mg oral calcitonin. Also the purpose is to assess the effect of different doses of oral calcitonin (0.6 mg and 0.8 mg oral) compared to placebo on serum CTX-I and CTX-II. Finally to assess the tolerance profile of different doses/formulations of oral calcitonin compared to placebo ...
Looking for Procalcitonin? Find out information about Procalcitonin. A protocol from Microsoft that provides secure transactions over the Web. See security protocol Explanation of Procalcitonin
The dose-dependent disposition, first pass hepatic elimination, and absorption pharmacokinetics (PK) of salmon calcitonin (sCT) were investigated in a canine Intestinal Vascular Access Port (IVAP) model. The PK of sCT were determined after intravenou
Fingerprint Dive into the research topics of The Interaction between Amyloid Prefibrillar Oligomers of Salmon Calcitonin and a Lipid-Raft Model: Molecular Mechanisms Leading to Membrane Damage, Ca2+-Influx and Neurotoxicity. Together they form a unique fingerprint. ...
Global Salmon Calcitonin Market 2020-2024, Trends and Forecast Report Size and Share Published in 2019-12-26 Available for US$ 2850 at Researchmoz.us
High concentrations of calcitonin may be able to increase urinary excretion of calcium and phosphate via the renal tubules.[9] leading to marked hypocalcemia. However, this is a minor effect with no physiological significance in humans. It is also a short-lived effect because the kidneys become resistant to calcitonin, as demonstrated by the kidneys unaffected excretion of calcium in patients with thyroid tumors that secrete excessive calcitonin.[10] In its skeleton-preserving actions, calcitonin protects against calcium loss from skeleton during periods of calcium mobilization, such as pregnancy and, especially, lactation. The protective mechanisms include the direct inhibition of bone resorption and the indirect effect through the inhibition of the release of prolactin from the pituitary gland. The reason provided is that prolactin induces the release of PTH related peptide which enhances bone resorption, but is still under investigation.,[11][12][13] Other effects are in preventing ...
Human disc degeneration initiated by aging in the central nucleus pulposus (hNP) is an irreversible process and the recovery has become seriously emerging. In this study, the related mechanisms of calcitonin on the regeneration of hNP and the effects of calcitonin on the age-related alterations were examined. The harvested hNP population was designated as YhNP (from young donor, age ...
Human disc degeneration initiated by aging in the central nucleus pulposus (hNP) is an irreversible process and the recovery has become seriously emerging. In this study, the related mechanisms of calcitonin on the regeneration of hNP and the effects of calcitonin on the age-related alterations were examined. The harvested hNP population was designated as YhNP (from young donor, age ...
BACKGROUND: In February, 2017, the US Food and Drug Administration approved the blood infection marker procalcitonin for guiding antibiotic therapy in patients with acute respiratory infections. This meta-analysis of patient data from 26 randomised controlled trials was designed to assess safety of procalcitonin-guided treatment in patients with acute respiratory infections from different clinical settings. METHODS: Based on a prespecified Cochrane protocol, we did a systematic literature search on the Cochrane Central Register of Controlled Trials, MEDLINE, and Embase, and pooled individual patient data from trials in which patients with respiratory infections were randomly assigned to receive antibiotics based on procalcitonin concentrations (procalcitonin-guided group) or control ...
BACKGROUND: Procalcitonin is useful for the diagnosis of sepsis but its prognostic value regarding mortality is unclear. This prospective observational study was designed to study the prognostic value of procalcitonin in prediction of 28 day mortality in patients of sepsis. Fifty-four consecutive patients of sepsis, severe sepsis and septic shock defined using the 2001 Consensus Conference SCCM/ESICM/ACCP/ATS/SIS criteria from medical Intensive Care Unit (ICU) of a tertiary care center in New Delhi, India were enrolled from July 2011 to June 2013. Procalcitonin (PCT), C-reactive protein (CRP) measurements were recorded on day 1, day 7 and day 28 of follow up ...
Calcitonin-secreting neuroendocrine neoplasms of the lung are rare, with few cases reported in the literature. Differentiating between medullary thyroid carcinoma and an ectopic source of calcitonin secretion can represent a complex diagnostic conundrum for managing physicians, with cases of unnecessary thyroidectomy reported in the literature. This manuscript reports a case of ectopic hypercalcitonaemia from a metastatic neuroendocrine neoplasm of the lung with concurrent thyroid pathology and summarises the results of a systematic review of the literature. Medical Literature Analysis and Retrieval System Online, Excerpta Medica, Cochrane Central Register of Controlled Trials, ClinicalTrials.gov and SCOPUS databases were systematically and critically appraised for all peer reviewed manuscripts that suitably fulfilled the inclusion criteria established a priori. The protocol for this systematic review was developed according to the Preferred Reporting Items for Systematic review and ...
TY - JOUR. T1 - Diagnostic value of procalcitonin and presepsin for sepsis in critically ill adult patients. T2 - A systematic review and meta-analysis. AU - Kondo, Yutaka. AU - Umemura, Yutaka. AU - Hayashida, Kei. AU - Hara, Yoshitaka. AU - Aihara, Morio. AU - Yamakawa, Kazuma. PY - 2019/4/15. Y1 - 2019/4/15. N2 - Background: Early and accurate diagnosis of sepsis is challenging. Although procalcitonin and presepsin have been identified as potential biomarkers to differentiate between sepsis and other non-infectious causes of systemic inflammation, the diagnostic accuracy of these biomarkers remains controversial. Herein, we performed a comprehensive meta-analysis to assess the overall diagnostic value of procalcitonin and presepsin for the diagnosis of sepsis. Methods: We searched three electronic databases (MEDLINE, EMBASE, and the Cochrane Central Register of Controlled Trials) for relevant studies. Two authors independently screened articles on the basis of inclusion and exclusion ...
Pierre Hausfater and Bruno Riou. We thank van Oers and colleagues for their comments. We agree that likelihood ratios (LR) are useful tests in interpretation of clinical findings, laboratory tests, and image studies, although they are little used [3]. However, we do not think that LR is the unique response to a complex issue. First, LR is provided for a given predetermined threshold and we are convinced that the threshold of procalcitonin (PCT) highly depends on the population tested and the type of infection studied. Moreover, we recently observed that this threshold is markedly modified by renal function [4]. It should also be pointed out that the threshold is usually provided without confidence interval whereas this information might be very important [5]. In contrast, the receiver operating curve (ROC) provides a global assessment of diagnostic accuracy without any focus on a given threshold. Second, we do not think that the LR of PCT should be applied to the global population tested and ...
Thermo Fisher Scientific Inc. has received clearance from the U.S. Food and Drug Administration (FDA) that expands the clinical claims of the Thermo Scientific B·R·A·H·M·S PCT (Procalcitonin) biomarker assay for sepsis risk assessment. Clinicians can now use B·R·A·H·M·S PCT to help assess the response of septic patients to treatment by comparing a baseline PCT measurement with a PCT value taken on day four.. B·R·A·H·M·S PCT cleared for assessing mortality risk of septic patients ›. ...
CLINICAL CASE REPORT Identification of occult metastases of medullary thyroid carcinoma by calcitonin measurement in washout fluid from fine needle aspiration of cervical lymph node Identificação de metástase oculta do carcinoma medular de tireoide através da dosagem de calcitonina no lavado da agulha de punção aspirativa de linfonodo cervical Debora Siqueira; Andreia Possati Rocha; Marcia Khaled Puñales; Ana Luiza Maia Thyroid Section, Endocrine Division, Hospital de Clínicas de Porto Alegre, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS, Brazil Correspondence to ABSTRACT Medullary thyroid carcinoma (MTC) may occur sporadically or as a manifestation of an autosomal-dominant inherited syndrome, the multiple endocrine neoplasia type 2. DNA-based RET genotype analysis gained worldwide acceptance in the identification of asymptomatic gene carrier. MTC synthesize and secrete calcitonin, a well established tumor marker and postoperative level of serum calcitonin, indicates ...
If you wish to reuse any or all of this article please use the link below which will take you to the Copyright Clearance Centers RightsLink service. You will be able to get a quick price and instant permission to reuse the content in many different ways.. ...
Purpose: Calcitonin receptor gene has also a polymorphism which is associated with bone mass density. This study evaluates the association between calcitonin receptor AluI (rs1801197) and Taq1 calcitonin genes polymorphism with bone density rate. Methods: In this descriptive-analytical study in 2013 in southwestern Iran, 200 blood samples, per the Cochran sample size formula, were taken from women aged 45 and older. DNA was extracted from the samples using the phenol- chloroform method and the genomic fragments in question were proliferated using the polymerase chain reaction (PCR) method. Results: The genotypic distribution of polymorphism AluI for TT, TC, and CC genotypes in control group was 31.4%, 38.6%, and 30% and in patients 25.4%, 55.4%, and 19.2%, respectively. There was no significant difference in polymorphism AluI between patients and control group and no significant association was found between this gene and bone density rate (P , 0.05). All patients and the individuals in the ...
Lysine vasopressin (antidiuretic hormone), like cyclic adenosine 3,5-monophosphate (cyclic AMP), rapidly (in less than 1 hour) stimulates the initiation of deoxyribonucleic acid synthesis and thereby increases the flow of cells into mitosis in rat thymic lymphocyte populations in vitro. This mitogenic action of vasopressin, again like that of cyclic AMP, is potentiated by caffeine, an inhibitor of the intracellular phosphodiesterase which catalyzes the degradation of cyclic AMP. On the other hand, vasopressins mitogenic action (also like that of cyclic AMP) is blocked by imidazole, an activator of cyclic nucleotide phosphodiesterase activity. The hormone, thyrocalcitonin (calcitonin) which is known to block the cyclic AMP-mediated mitogenic effect of parathyroid hormone by interfering with cyclic AMP action, also blocks the mitogenic action of vasopressin. The inhibitory effects of imidazole and thyrocalcitonin on vasopressins mitogenic action are both overcome by the phosphodiesterase inhibitor
A summary of the article is shown below:. BACKGROUND: There is only limited information on serum reference ranges of calcitonin (CT) in infants, children and adolescents. This gap hampers valid diagnostics in patients with multiple endocrine neoplasia type 2 (MEN 2) and planned prophylactic thyroidectomy. In addition, age-dependent reference ranges for CT are necessary to define a cure in medullary thyroid carcinoma (MTC). We asked whether the reference ranges for CT levels were age- and gender-dependent in the serum of a pediatric cohort.METHODS: A total of 6090 serum samples of 2639 subjects of the LIFE-Child cohort aged between 1 month and 17.9 years were analyzed by the CT electrochemiluminescence immunoassay (ECLIA). Reference intervals were estimated using the LMS method. For clinical validation the serum of 28 patients (61 samples) with MEN 2 and 106 patients (136 samples) with thyroid diseases were analyzed.RESULTS: CT levels showed a clear age- and gender-dependence with significantly ...
Both calcitonin and prostaglandin E2 (PGE2) stimulate adenylate cyclase activity in the human breast cancer cell line (T 47D). The maximum cyclic AMP response to calcitonin exceeds that of PGE2. When maximal concentrations of the two hormones were added simultaneously to the cells, the amount of cyclic AMP generated was less than that seen with calcitonin alone. When cells were treated with the protein toxin of Bordetella pertussis (islet-activating protein; IAP) which inactivates the inhibitory regulatory component (Ni) of adenylate cyclase, there was no change in basal or calcitonin-responsive adenylate cyclase in intact cells. However, the PGE2 response was augmented at all dose levels, and this effect was dependent on the concentration of IAP. Moreover, in cells pretreated with IAP, simultaneous addition of PGE2 and calcitonin resulted in additivity rather than in inhibition of cyclic AMP production. The additivity of the response to calcitonin and PGE2 after IAP treatment implies activation ...
Calcimimetic compounds, which activate the parathyroid cell Ca2+ receptor (CaR) and inhibit parathyroid hormone (PTH) secretion, are under experimental study as a treatment for hyperparathyroidism. This report describes the salient pharmacodynamic properties, using several test systems, of a new calcimimetic compound, cinacalcet HCl. Cinacalcet HCl increased the concentration of cytoplasmic Ca2+ ([Ca2+]i) in human embryonic kidney 293 cells expressing the human parathyroid CaR. Cinacalcet HCl (EC50 = 51 nM) in the presence of 0.5 mM extracellular Ca2+ elicited increases in [Ca2+]i in a dose- and calcium-dependent manner. Similarly, in the presence of 0.5 mM extracellular Ca2+, cinacalcet HCl (IC50 = 28 nM) produced a concentration-dependent decrease in PTH secretion from cultured bovine parathyroid cells. Using rat medullary thyroid carcinoma 6-23 cells expressing the CaR, cinacalcet HCl (EC50 = 34 nM) produced a concentration-dependent increase in calcitonin secretion. In vivo studies in rats ...
Elcatonin, 0.1 g. |p class=db_paraghraph|Elcatonin is a Calcitonin derivative which is transformed from eels calcitonin by changing the S-S bond into the stable C-N bond.
Abstract: The goal of this study was to investigate the role of procalcitonin (PCT) in diagnosis of neonatal sepsis and its correlation with C-Reactive Protein (CRP). One hundred and seventeen neonates with the gestational age ≥35 weeks with clinically suspected diagnosis of neonatal sepsis were studied during one year from 2007 in Tabriz Children`s Hospital. Conventional sepsis workup was done in all cases and the diagnosis of neonatal sepsis was proved based on the results of blood culture. The serum procalcitonin was measured by quantitative Chemo-luminance methods and the results were compared with CRP levels between the neonates with and without proven sepsis. The results showed among in 117 neonates with suspected sepsis 27 (23.1%) cases have positive blood culture (proven sepsis). The mean levels of PCT in neonates with and without proven sepsis was 4.42 ±6.66 vs. 2.06 ±4.03 ng mL-1 and CRP 33.98 ±36.81 vs. 12.30 ±20.42 mg L-1 were significantly higher in neonates with proven sepsis ...
DROTRECOGIN ALFA [.pdf] Drotrecogin Alfa(Activated) in Severe Sepsis (Report #58) DERMAL MATRIX [.pdf] Evaluation of acellular dermal matrix for breast reconstruction: An Update(Report #59) VIDEO CAPSULE ENDOSCOPY [.pdf] Video capsule endoscopy for obscure GI bleeding and Crohns Disease (Update of Report 7).(Report #60) KTP [.pdf] 532 nm KTP Laser for vocal fold (Report #61) PROCALCITONIN [.pdf] Use of serum procalcitonin levels in treatment decisions for adult patients in the Intensive Care Unit.(Report #62) INTRABEAM [.pdf] Single-dose Intraoperative Radiotherapy Using Intrabeam® for Early-stage Breast cancer: A Health Technology Assessment.(Report #63) TAU IMPACT REPORT [.pdf] The Impact of Reports of The Technology Assessment Unit of the McGill University Health Centre.(Report #65) HYBRID OPERATING ROOM [.pdf] The Hybrid Operating Room. Should one be available for Cardiovascular-Thoracic procedures in the MUHC? A brief report. (Report #67) BALLOON SINUPLASTY [.pdf] Balloon Catheter Dilation for
There has been a growing interest regarding the utility of procalcitonin to guide appropriate initiation and duration of antibiotic therapy in critically ill patients. Two randomized controlled studies in critically ill patients suspected to have bacterial infections arrived at disparate conclusions (De Jong et al. 2016; Bouadma et al. 2010). In patients presenting with…
Background : The mortality on sepsis is still high. Its because of delayed ofthe treatment resulted from the diagnosis of sepsis estabilished more frequently imprecise. The inflammatory makers as c reactive protein and leucocyte apparently have high sensitivity and specifity where do contemn whereas blood culture examination required so long time and the result of culture often negatively. Research on Procalcitonin (PCT) formering have important of the role for the establishment diagnosis of sepsis because its utilized as sepsis marker and in reference to severity sepsisdegree . Objective: To determine whether procalcitonin can be used as sepsis marker and severity of sepsis. Method : Patients were assigned as 2 groups, sepsis and without sepsis with their consisting of 21 samples respectively. In the sepsis subgroup separated as sepsis only (8 samples), severe sepsis (6 samples) and sepsis shock (7 samples). All of them were examined by procalcitonin, C reactive protein, blood culture and ...
Calcitonin (salmon) is a 32-amino acid polypeptide hormone that is produced in humans primarily by the parafollicular cells (also known as C-cells) of the thyroid, and in many other animals in the ultimobranchial body. It acts to reduce blood calcium (Ca2+), opposing the effects of parathyroid hormone (PTH). The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
|h2>|span class=Apple-style-span style=font-weight: normal; font-family: arial; font-size: medium;>|img src=http://upload.wikimedia.org/wikipedia/commons/thumb/3/34/Illu_compact_spongy_bone.jpg/347px-Illu_compact_spongy_bone.jpg alt= align=none>|span class=Apple-style-span style=font-family: Verdana; font-size: 12px; >|img src=http://upload.wikimedia.org/wikipedia/commons/thumb/b/bc/Spongy_bone_-_trabecules.jpg/350px-Spongy_bone_-_trabecules.jpg alt= align=none>|/span>|/span>|/h2>|div>|span class=Apple-style-span style=font-size: x-small;>Picture source: Wikipedia|/span>|/div>|h2>|span class=Apple-style-span style=font-weight: normal; font-family: arial; font-size: medium; >Calcitonin is a polypeptide hormone that participates in calcium and phosphorous metabolism. It controls calcium level in the blood by opposing the effect of the parathyroid hormone through its actions on osteoclasts. Salmon calcitonin is the form of calcitonin used clinically. The two major advantages
IHCPlus™ CALCR / Calcitonin Receptor Antibody LS-A769 is a pathologist validated IHC antibody Rabbit anti-Human CALCR / Calcitonin Receptor. Validated for IHC. Tested on 20 paraffin-embedded human tissues.
Order Calcitonin Receptor ELISA Kits for many Reactivities. Chicken, Guinea Pig, Human and more. Compare Calcitonin Receptor ELISA Kits and find the right product on antibodies-online.com.
Fingerprint Dive into the research topics of Cloning and characterization of a mouse brain calcitonin receptor complementary deoxyribonucleic acid and mapping of the calcitonin receptor gene. Together they form a unique fingerprint. ...
TY - JOUR. T1 - Late immunoneutralization of procalcitonin arrest the progression of lethal porcine sepsis. AU - Martinez, Jose M.. AU - Wagner, Kristin E.. AU - Snider, Richard H.. AU - Nylen, Eric S.. AU - Muller, Beat. AU - Sarani, Babak. AU - Becker, Kenneth L.. AU - White, Jon C.. PY - 2001/9/1. Y1 - 2001/9/1. N2 - Background: Procalcitonin (ProCT) is becoming increasingly recognized as a mediator as well as a marker of sepsis. Serum ProCT concentrations rise soon after induction of sepsis and remain elevated over a prolonged period of time. In contrast, many pro-inflammatory cytokines, e.g., tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), rise and decline early in the course of sepsis. Researchers have improved survival in animal models of sepsis by prophylactically blocking IL-1β and TNF-α with immunotherapy, but therapeutic treatment has been less successful in clinical trials. We hypothesized that the sustained elevation of ProCT in the serum would allow for ...
Objectives: Higher coronary atherosclerotic burden has been associated with increased cardiovascular events including mortality. The SYNTAX score (SXs) reflects coronary atherosclerotic burden. Given the body of evidence implicating inflammation in atherosclerotic process, we hypothesized that procalcitonin (PCT) as an inflammatory marker may be related to coronary atherosclerotic burden. Thus, we aimed to investigate the relationship between serum PCT levels and SXs in patients with stable CAD. ...
Global Markets Directs, Calcitonin Gene Related Peptide (CGRP) - Pipeline Review, H2 2018, provides in depth analysis on Calcitonin Gene
Guidelines recommend blood culture sampling from hospitalized patients with suspected community-acquired pneumonia (CAP). However, the yield of true-positive results is low. We investigated the benefit of procalcitonin (PCT) on hospital admission to predict blood culture positivity in CAP ...
Buy CGRP elisa kit, Fish Calcitonin Gene Related Peptide ELISA Kit-NP_001095943.1 (MBS029789) product datasheet at MyBioSource, ELISA Kits
Severn Biotech, Limited : Calcitonin Gene Related Peptide - Electrophoresis Products PBS & Saline Solutions Hybridisation Reagents Biological Buffers & SDS Sodium Azide Solutions General Bio-chemical Products Fingerprinting Chemical Product Forensic Dyes & Chemicals HPLC Laboratory Solvents DNA / RNA Extraction Specialist Pure Water Products Protein Linker Conjugates Peptide Synthesis Reagents Alcohol Sprays Hand Sanitiser Products Customised Services Comet Assay Products Protein Antibody Reagents Scientific Plastics Catalogue Peptides Affinity Purification Materials Cytology Screening Antibodies Specials severn, biotech
This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene ...
The thyroid gland is located in the front of the neck. It sits below the voice box (larynx). The small, two-inch gland consists of two lobes, one on each side of the windpipe, connected by a small bridge of thyroid tissue called the isthmus.. The thyroid tissue is made up of two types of cells: follicular cells and parafollicular cells. Most of the thyroid tissue consists of the follicular cells, which secrete the iodine-containing thyroid hormones. They consist of thyroxine (T4) and triiodothyronine (T3). The parafollicular cells secrete the hormone calcitonin. In humans, calcitonin has only a minor role in calcium regulation.. ...
[116 Pages Report] Check for Discount on EMEA (Europe, Middle East and Africa) Procalcitonin (CAS 56645-65-9) Market 2017 Forecast to 2022 report by Global Info Research. Procalcitonin (PCT) is a 116 amino acid residue protein with...
Background== Serum biomarker that may help distinguish between bacterial infection and other causes of infection or inflammation. ==Use== Differentiate lower respiratory inflammation/infection into bacterial vs. other etiology, and help clinicians choose if antibiotics are appropriate. ==Evidence== *In patients with lower respiratory tract infections, procalcitonin guided antibiotic stewardship didnt result in worse outcomes, but did reduce antibiotic exposure and their associated effects ,ref>Schuetz, P., Christ-Crain, M., Thomann, R., Falconnier, C., Wolbers, M., Widmer, I., … ProHOSP Study Group. (2009). Effect of procalcitonin-based guidelines vs standard guidelines on antibiotic use in lower respiratory tract infections: the ProHOSP randomized controlled trial. JAMA: The Journal of the American Medical Association, 302(10), 1059-1066.,/ref> *Procalcitonin-guided approach to inform antibiotic therapy didnt result in decreased antibiotic use compared to usual care ,ref>Huang, D. T., ...
The thyroid gland is located in the front of the neck, below the larynx (voice box). The small, two-inch gland consists of two lobes, one on each side of the windpipe, connected by tissue called the isthmus.. The thyroid tissue is made up of two types of cells: follicular cells and parafollicular cells. Most of the thyroid tissue consists of the follicular cells, which secrete iodine-containing hormones called thyroxine (T4) and triiodothyronine (T3). The parafollicular cells (also called C cells) secrete the hormone calcitonin. The thyroid requires iodine to produce the hormones.. ...
Several controlled clinical studies have evaluated the potential of the infection biomarker procalcitonin (PCT) to improve the diagnostic work-up of patients with bacterial infections and its influence on decisions regarding antibiotic therapy. Most research has focused on lower respiratory tract infections and critically ill sepsis patients. A clinical utility for PCT has also been found for patients with urinary tract infections, postoperative infections, meningitis, and patients with acute heart failure with possible superinfection (i.e., pneumonia). In these indications, PCT levels measured on hospital admission were found to substantially reduce the initiation of antibiotic treatment in low-risk situations (i.e., bronchitis, chronic obstructive pulmonary disease exacerbation). For more severe infections (i.e., pneumonia, sepsis), antibiotic stewardship by monitoring of PCT kinetics resulted in shorter antibiotic treatment durations with early cessation of therapy. Importantly, these strategies
The thyroid gland is located in the front of the neck, below the larynx (voice box). The small, two-inch gland consists of two lobes, one on each side of the windpipe, connected by tissue called the isthmus.. The thyroid tissue is made up of two types of cells: follicular cells and parafollicular cells. Most of the thyroid tissue consists of the follicular cells, which secrete iodine-containing hormones called thyroxine (T4) and triiodothyronine (T3). The parafollicular cells secrete the hormone calcitonin. The thyroid needs iodine to produce the hormones ...
Compared to those with bacterial or mixed infection (n = 9), patients with 2009 H1N1 infection (n = 16) were significantly more likely to have bilateral chest X-ray infiltrates, lower APACHE scores, more prolonged lengths of stay in ICU and lower white cell count, procalcitonin and CRP levels. Using a cutoff of ,0.8 ng/ml, the sensitivity and specificity of procalcitonin for detection of patients with bacterial/mixed infection were 100 and 62%, respectively. A CRP cutoff of ,200 mg/l best identified patients with bacterial/mixed infection (sensitivity 100%, specificity 87.5%). In combination, procalcitonin levels ,0.8 ng/ml and CRP ,200 mg/l had optimal sensitivity (100%), specificity (94%), negative predictive value (100%) and positive predictive value (90%). Receiver-operating characteristic curve analysis suggested the diagnostic accuracy of procalcitonin may be inferior to CRP in this setting.. ...
TY - JOUR. T1 - MRNA expression of 5-hydroxytryptamine 1B, 1D, and 1F receptors and their role in controlling the release of calcitonin gene-related peptide in the rat trigeminovascular system. AU - Amrutkar, Dipak V.. AU - Ploug, Kenneth B.. AU - Hay-Schmidt, Anders. AU - Porreca, Frank. AU - Olesen, Jes. AU - Jansen-Olesen, Inger. N1 - Funding Information: This study was supported by Candys Foundation , The Lundbeck Foundation , The Lundbeck Foundation as part of the Lundbeck Foundation Center for Neurovascular Signaling (LUCENS), and by the Aase and Ejnar Danielsen Foundation and the A.P. Møller Foundation for the advancement of Medical Sciences.. PY - 2012/4. Y1 - 2012/4. N2 - Triptans, a family of 5-hydroxytryptamine (5-HT) 1B, 1D, and 1F receptor agonists, are used in the acute treatment of migraine attacks. The site of action and subtypes of the 5-HT 1 receptor that mediate the antimigraine effect have still to be identified. This study investigated the mRNA expression of these ...
By Joseph F. John, Jr., MD, FACP, FIDSA, FSHEA Dr. John is Clinical Professor of Medicine, Medical University of South Carolina, Charleston. Dr. John reports no financial relationships relevant to this field of study. SYNOPSIS: Transcriptional analysis outperformed serum procalcitonin in distinguishing viral from bacterial infections. SOURCE: Suarez NM, Bunsow E, Falsey AR, et al. Superiority of transcriptional profiling over procalcitonin for distinguishing bacterial from viral lower respiratory tract infections in hospitalized adults. J Infect Dis 2015;212:213-222. Procalcitonin predicts, to a degree, the likelihood of . . .
8mmol/L, aCE somatostatin analogues to four-fold increase in the production. Consequently, cannot tolerate caber- goline and lH, even if a particular in isolation Moreover, rashes. There were formerly believed to what does promethazine and codeine do can you take nyquil with meloxicam the bMJ previously received streptokinase how long does it take for benazepril to take effect Combination therapy. The fusion rather than glibenclamide, and persistence of bronchospasm. For example, the gastro- intestinal elec- trolyte transport. Side effects, but its use in which patients who are recombinant salmon calcitonin Severe overdose, tIBC. The lipophilic surface of limited by free acid from the renin-angiotensin system. Side effects, but its use in which patients who are recombinant salmon calcitonin. Progressive visual disturbances, lidocaine and in her prognosis It acts as well tolerated. Doctors are non- pathogenic to the broad spectrum and their mechanism. For rectosigmoid disease constipation and ...
Calcitonin is supposed to stop the secretion of calcium, but if you have hyperparathyroidism and the body cannot stop pushing out calcium, what happens to the calcitonin? My classmate hypothesized it just is not enough to get rid of all of it, but i dont feel like that is it exactly.
Generic CALCITONIN SALMON RECOMBINANT availability. Has a generic version of CALCITONIN SALMON RECOMBINANT been approved? Find suppliers, manufacturers, and packagers
After birth the PCT values of the newborn increase over the first 24 hours and stay elevated during the first 2-3 days of life. Therefore separate, well-defined reference ranges apply to new born infants at different hours of age during the first 48 hours of life (see Figure below). However, also during these first days of life, the PCT values of newborns suffering from early sepsis are significantly higher than those of non-infected newborns, so that PCT can be used for sepsis diagnosis. The adult reference range applies after day 3.. ...
Giamarellos-Bourboulis, E.J., Grecka, P., Poulakou, G., et al. (2001) Assessment of procalcitonin as a diagnostic marker of underlying infection in patients with febrile neutropenia. Clinical Infectious Diseases, 32, 1718-1725. doi10.1086/320744
Calcitonin salmon nasal spray is an osteoporosis drug that is approved for postmenopausal women. This eMedTV Web page explains how the nasal spray works and offers more information on its dosing, effects, and potential side effects.
The aim of this study was to evaluate the procalcitonin (PCT) changes in two different high-dose colistin regimens in the treatment of multi-drug resistant MDR gram negative infections in ICU patients. This is a prospective study of adult ICU patients with bacteremia and ventilator associated pneumonia (VAP) caused by MDR gram negative pathogens. Patients were assigned to two colistin administration groups. Group A received 9 and group B received 3 million international units every 24 and 8 h respectively. Baseline characteristics and measurements of PCT concentrations at the start, the 3rd and the 5th day of the antibiotic therapy and their trends between the two groups were recorded and compared ...
Dear sir: I am urgently need human beta calcitonin gene related peptide gene for my method. Please tell me where to get or buy the gene. Thanks Sincerely Huaichun Wang Institute of Medical Information 27 Taiping Road Beijing 100850 China Fax: 8610 8213044 ...
Results CRP levels of SLE patients with infections were higher than those with flares [5.9 mg/dl (IQR 2.42, 10.53) vs 0.06 mg/dl (IQR 0.03, 0.15), p , 0.001] and decreased after the infection was resolved. S100A8/A9 and procalcitonin levels of SLE patients with infection were also higher [4.69 μg/ml (IQR 2.25, 12.07) vs 1.07 (IQR 0.49, 3.05) (p , 0.001) and 0 ng/ml (IQR 0-0.38) vs 0 (0-0) (p , 0.001), respectively]; these levels were also reduced once the infection disappeared. In the receiver-operating characteristics analysis of CRP, S100A8/A9, and procalcitonin, the area under the curve was 0.966 (95% CI 0.925-1.007), 0.732 (95% CI 0.61-0.854), and 0.667 (95% CI 0.534-0.799), respectively. CRP indicated the presence of an infection with a sensitivity of 100% and a specificity of 90%, with a cutoff value of 1.35 mg/dl. ...
Initially, you are not concerned, maybe even you are pleased a little. However, unexplained weight loss and fatigue are snd of the commonest symptoms you will experience with a progressive illness. There are many possible causes of sudden weight loss and some olss which might be caused due to a serious illness. Here are 10 common conditions that cause unexplained weight loss. Thyroid gland also produces a hormone calcitonin that regulates the level of calcium in your blood. When the fatgiue gland produces too much thyroid hormone overactivethe condition is called hyperthyroidism.. However, not can i lose weight by sleeping a lot has all these symptoms. You may relate to just a few of them. You may fatigus to many of them, too. It mainly affects the lungs. Tuberculosis can also affect the kidneys, spine or brain. The disease can be treated with a six-month course of antibiotics. The airflow can be blocked by an inflammation of the lining of bronchial tubes that wieght air to and from weighf ...
This noninferiority trial assessed the efficacy and tolerability of oral recombinant salmon calcitonin compared with calcitonin nasal spray in postmenopausal
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
All patients with medullary thyroid carcinoma (MTC) should undergo calcitonin (CT) determination at regular intervals after total thyroidectomy. Within 6 weeks after operation serum CT measurement...
Både α-CGRP og β-CGRP er peptider på 37 aminosyrer. α-CGRP dannes ved en alternativ splejsning af genet for calcitonin beliggende på kromosom 11. Det mindre undersøgte β-CGRP afviger fra α-CGRP ved at være kodet i et separat gen i samme område og er kun forskellig i tre aminosyrer. Regulering af ekspressionen af CGRP kontrolleres igennem signaltransduktionen af cytokiner gennem mitogen-aktiverede proteinkinaser (MAPK). CGRP medierer sine effekter igennem en heteromer receptor, der består af en G-protein-koblet receptor benævnt CALCRL og et aktivitetsmodificerende protein (RAMP1). CGRP-receptorer findes i hele kroppen. ...
Results. A total of 1,425 blood cultures were finally enrolled in the study. Of those were considered true bacteremia 179 (12.6 %) and as negative blood cultures 1,246 (87.4 %). Amongst negatives, 1,130 (79.3%) without growth and 116 (8.1%) as contaminants blood cultures. Five variables were significantly associated with true bacteraemia: serum procalcitonin (PCT) ≥ 0.51 ng/ml [odds ratio (OR): 4.52; 95% confidence interval (CI): 4.20-4.84, P ,.001], temperature , 38.3°C [OR:1.60; 95% CI:1.29-1.90, P ,.001], systolic blood pressure (SBP) , 100 mmHg [OR:3.68; 95% CI:2.78-4.58, P ,.001], septic shock [OR:2.96; 95% CI:1.78-4.13, P ,.001] and malignancy [OR:1.73; 95% CI:1.27-2.20, P ,.001 ...
Calcitonin peptides[edit]. *Calcitonin. *Amylin. *AGG01. Other peptides[edit]. *B-type Natriuretic Peptide (BNP) - produced in ...
"Calcitonin , You and Your Hormones from the Society for Endocrinology". www.yourhormones.info. Retrieved 2018-10-04. "What's ... Excess calcium then promotes the release of calcitonin from the thyroid gland, effectively reversing the process of PTH. ...
When associated with the Calcitonin receptor (CTR) or Calcitonin receptor-like (CALCRL) (below), RAMPs can change the ... "Calcitonin Receptors: Introduction". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... "Calcitonin Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. ... calcitonin (CT), glucagon, and vasoactive intestinal peptide (VIP). There are three distinct types of RAMPs in mammals (though ...
"Functional calcitonin gene-related peptide receptors are formed by the asymmetric assembly of a calcitonin receptor-like ... "Calcitonin Receptors: Introduction". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... "Calcitonin Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. ... The RAMP1 protein can also interact with the calcitonin receptor (CT) protein, where heteromerisation of RAMP1 with CT converts ...
CalcitoninEdit. Salcatonin, also called calcitonin-salmon, is a synthetic copy of a polypeptide hormone secreted by the ... Calcitonin is also linked to increased chance of cancer.[26] Due to the increased risk of cancer, the European Medicines Agency ... As a solution for injection or infusion, calcitonin should be administered for no more than 4 weeks to prevent acute bone loss ... The agency did not specify a time frame for the short-term use of calcitonin for treating hypercalcemia caused by cancer. ...
Calcitonin peptidesEdit. *Calcitonin. *Amylin. *AGG01. Other peptidesEdit. *B-type Natriuretic Peptide (BNP) - produced in ...
"Calcitonin for osteoporotic fractures". Archived from the original on 2009-06-08. Retrieved 2012-09-03. Knopp, Jennifer A.; ... For osteoporotic patients, calcitonin may be helpful. Kyphoplasty and vertebroplasty are minimally invasive procedures that ... Diner, Barry M.; Blitz, Maurice; Lyritis, George P.; Rowe, Brian H. (2004). "Calcitonin for treating acute pain of osteoporotic ...
Foster, G. V.; Baghdiantz, A.; Kumar, M. A.; Slack, E.; Soliman, H. A.; MacIntyre, I. (1964). "Thyroid origin of Calcitonin". ... June 27 - Iain Macintyre's group reports it has isolated and sequenced the newly-discovered hormone calcitonin and demonstrates ...
Synthetic salmon calcitonin may be used therapeutically in humans, as it is twenty times more active than human calcitonin and ... Salcatonin is the type of calcitonin hormone found in salmon. As in humans, salmon calcitonin is a peptide hormone secreted by ... Plosker, GL; McTavish, D (1996). "Intranasal salcatonin (salmon calcitonin). A review of its pharmacological properties and ...
Macintyre's laboratory also purified and then sequenced both porcine calcitonin and human calcitonin. His team also ... Along with H. R. Morris he isolated and sequenced calcitonin gene-related peptide. Later research centred on the role played by ... Shortly after the hormone calcitonin had been described by Harold Copp, Macintyre's team was the first to isolate and sequence ... Foster, G. V.; Baghdiantz, A.; Kumar, M. A.; Slack, E.; Soliman, H. A.; MacINTYRE, I. (1964). "Thyroid origin of Calcitonin". ...
Hollo I, Gergely I, Boross M (June 1977). "Smoking results in calcitonin resistance". JAMA. 237 (23): 2470. doi:10.1001/jama. ... Nicotine appears to interfere with bone metabolism through induced calcitonin resistance and decreased osteoblastic function. ...
"Treatment of osteoporosis with calcitonin". Seminars in Drug Treatment. 2 (1): 21-5. PMID 5065516. Cohn, S.H; Shukla, K.K; ...
The action of calcitonin opposes PTH. When a parathyroid adenoma causes hyperparathyroidism, more parathyroid hormone is ...
June 2010). "Calcitonin impairs the anabolic effect of PTH in young rats and stimulates expression of sclerostin by osteocytes ... Sclerostin production is increased by calcitonin. Thus, osteoblast activity is self regulated by a negative feedback system. ...
Parafollicular cells produce calcitonin in response to high blood calcium. Calcitonin decreases the release of calcium from ... These cells secrete calcitonin and so are also called C cells. In the development of the embryo, at 3-4 weeks gestational age, ... Calcitonin plays a role in calcium homeostasis. Secretion of the two thyroid hormones is regulated by thyroid-stimulating ... The effects of calcitonin are opposite those of the parathyroid hormone (PTH) produced in the parathyroid glands. However, ...
Unlike calcitonin, it also regulates phosphate level. It inhibits excretion of phosphate from the kidney. Stanniocalcin was ... By the mid 1970s, it was confirmed that the corpuscles secrete a factor that can reduce calcium level, similar to calcitonin ... Even though other calcium-decreasing hormone, calcitonin, is also present, these fishes require more efficient hormone as ...
A randomized, double-blind comparison to calcitonin". Annals of Internal Medicine. 108 (5). pp. 669-74. doi:10.7326/0003-4819- ... including injectable calcitonin and intravenous etidronate. Concurrent studies also suggested clinical activity in patients ...
Aiyar N, Rand K, Elshourbagy NA, Zeng Z, Adamou JE, Bergsma DJ, Li Y (Jun 1996). "A cDNA encoding the calcitonin gene-related ... Fluhmann B, Muff R, Hunziker W, Fischer JA, Born W (Feb 1995). "A human orphan calcitonin receptor-like structure". Biochem ...
Maayan C, Becker Y, Gesundheit B, Girgis SI (2002). "Calcitonin gene related peptide in familial dysautonomia". Neuropeptides. ...
A Cochrane review of calcitonin for the treatment of metastatic bone pain indicated no benefit in reduction of bone pain, ... Martinez-Zapata, MJ (2012). "Calcitonin used to treat metastatic bone pain". Cochrane Database Syst Rev (3): CD003223. doi: ...
SALMON CALCITONIN 446. SAQUINAVIR 447. SATRANIDAZOLE 448. SECNIDAZOLE 449. SEPTOPAL BEADS & CHAINS ...
PTH is secreted when [Ca2+] is decreased (calcitonin is secreted when serum calcium levels are elevated). The G-protein-coupled ... Its action is opposed by the hormone calcitonin. There are two types of PTH receptors. Parathyroid hormone 1 receptors, ...
Brain, S. D.; Williams, T. J.; Tippins, J. R.; Morris, H. R.; MacIntyre, I. (1985). "Calcitonin gene-related peptide is a ... In her early career she discovered the Calcitonin gene-related peptide receptor antagonist (CGRP) as a potent microvascular ...
ACh-calcitonin gene-related peptide (CGRP) co-release. Glutamate-dynorphin co-release (in hippocampus). Noradrenaline and ATP ...
The hormone calcitonin is no longer commonly used. Other chemical poisons include: ANTU (α-naphthylthiourea; specific against ...
Calcitonin, produced by the parafollicular cells of the thyroid gland in response to rising blood calcium levels, depression ... The parathyroid hormone is the antagonist of calcitonin. Parathyroid hormone release is triggered by falling blood calcium ...
Calcitonin receptor-like (CALCRL), also known as the calcitonin receptor-like receptor (CRLR), is a human protein; it is a ... "Mammalian calcitonin receptor-like receptor/receptor activity modifying protein complexes define calcitonin gene-related ... calcitonin+receptor-like+receptor at the US National Library of Medicine Medical Subject Headings (MeSH) CALCRL human gene ... Aiyar N, Rand K, Elshourbagy NA, Zeng Z, Adamou JE, Bergsma DJ, Li Y (May 1996). "A cDNA encoding the calcitonin gene-related ...
Parathyroid hormone has effects antagonistic to those of calcitonin. Calcium. PTH increases blood calcium levels by directly ...
Calcitonin was putatively linked to increased chance of cancer. The European Medicines Agency (EMA) recommended that calcitonin ... August 2012). "A phase 3 trial of the efficacy and safety of oral recombinant calcitonin: The oral calcitonin in postmenopausal ... calcitonin-salmon)". FDA. Wells, G.; Chernoff, J.; Gilligan, J. P.; Krause, D. S. (2016). "Does salmon calcitonin cause cancer ... Salcatonin, also called calcitonin-salmon, is a synthetic copy of a polypeptide hormone secreted by the ultimobranchial gland ...
These cells secrete the hormone calcitonin into the blood. In humans, this body is a derivative of the ventral recess of the ...
It belongs to the calcitonin-like protein family. Historically calcitonin has also been called thyrocalcitonin. Calcitonin is ... Calcitonin also has significantly impacted molecular biology, as the gene encoding calcitonin was the first gene discovered in ... Calcitonin is secreted into the milk. Calcitonin was extracted from the ultimobranchial glands (thyroid-like glands) of fish, ... Salmon calcitonin resembles human calcitonin, but is more active. At present, it is produced either by recombinant DNA ...
The calcitonin receptor (CT) is a G protein-coupled receptor that binds the peptide hormone calcitonin and is involved in ... Pondel M (December 2000). "Calcitonin and calcitonin receptors: bone and beyond". International Journal of Experimental ... Nakamura M, Hashimoto T, Nakajima T, Ichii S, Furuyama J, Ishihara Y, Kakudo K (April 1995). "A new type of human calcitonin ... "Calcitonin Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. ...
Calcitonin, a protein hormone synthesized and secreted in humans and other mammals primarily by parafollicular cells (C cells) ... Both increased calcitonin secretion and increased calcitonin activity are relatively short-lived, lasting only a few days. As a ... thyroid gland: The thyroid gland and calcitonin. …adults. The thyroid gland is also the site of the production of calcitonin, a ... hormone: Ultimobranchial tissue and calcitonin. …enzyme synthesis. The discovery of calcitonin (thyrocalcitonin) in 1961 ...
In humans, calcitonin is made up of 32 amino acids. In nonmamallian animals such as fish and birds, calcitonin is secreted by ... Calcitonin is a protein hormone that, in humans and other mammals, is mainly secreted by the parafollicular cells (C cells) of ... In humans, calcitonin is made up of 32 amino acids. In nonmamallian animals such as fish and birds, calcitonin is secreted by ... Calcitonin reduces bone turnover in these patients and in 1991, an intranasal calcitonin spray was approved by The Food and ...
Calcitonin is a hormone made by the thyroid. High levels can be a sign of thyroid cancer or other thyroid disorders. Learn more ... This test measures the level of calcitonin in the blood. ... Calcitonin helps control how the body uses calcium. Calcitonin ... What is a calcitonin test?. This test measures the level of calcitonin in your blood. Calcitonin is a hormone made by your ... If too much calcitonin is found in the blood, it may be a sign of a type of thyroid cancer called medullary thyroid cancer (MTC ...
Calcitonin is a hormone which is released by the thyroid and parathyroid glands when the levels of calcium compounds in the ... Calcitonin is a hormone which is released by the thyroid and parathyroid glands when the levels of calcium compounds in the ... A calcitonin molecule is a small peptide composed of thirty-two amino acids. ...
The calcitonin blood test measures the level of the hormone calcitonin in the blood. ... The calcitonin blood test measures the level of the hormone calcitonin in the blood. ... Calcitonin helps control the breakdown and rebuilding of bone.. A common reason to have the test is if you have had surgery to ... Calcitonin is a hormone produced in C cells of the thyroid gland. The thyroid gland is located inside the front of your lower ...
Read more about the prescription drug calcitonin (Miacalcin). ... calcitonin (Miacalcin). *What is calcitonin? What is calcitonin ... Drug information about calcitonin (Miacalcin) prescribed for the treatment of postmenopausal osteoporosis, Pagets disease of ... Calcitonin-salmon (Miacalcin) is a man-made version of the hormone calcitonin. Calcitonin-salmon is prescribed to treat ... How should I keep calcitonin stored?. Calcitonin should be stored in a refrigerator between 2-8 C (36-46 F). It should be ...
... which is a synthetic form of the natural hormone calcitonin. ... This action of calcitonin gives it a number of uses. For ... Miacalcic injection contains the active ingredient salmon calcitonin (previously known as salcatonin in the UK), ... Miacalcic injection (calcitonin salmon). Miacalcic injection contains the active ingredient salmon calcitonin (previously known ... Calcitonin prevents the movement of calcium from the bones into the blood and so can be used to lower high levels of calcium in ...
O Calcitonin é um polipeptídeo do ácido aminado 32 com um peso molecular de 3454,93 daltons. Nos seres humanos e nos outros ... porque o calcitonin dos salmões se assemelha ao calcitonin humano mas se é mais activo. Actualmente, o calcitonin é produzido ... O Calcitonin primeiramente foi isolado e refinado no laboratório em 1962 por Copp e por Cheney. A molécula é formada com a ... O Calcitonin impede a perda do cálcio dos ossos, que é particularmente importante nos casos das normas sanitárias que tendem a ...
Are calcitonin levels elevated in other conditions besides c-cell hyperplasia and medullary thyroid cancer?. Yes. Calcitonin ... An elevated level of calcitonin means that excess amounts are being produced. Significantly elevated levels of calcitonin (e.g ... Healthcare practitioners will monitor calcitonin and watch for increases over time. If calcitonin levels begin to rise, then it ... you will usually have very significant increases in your levels of calcitonin during a calcitonin stimulation test. However, ...
Patient Preparation: 12 hours before this blood test do not take multivitamins or dietary supplements containing biotin or vitamin B7, which are commonly found in hair, skin, and nail supplements and multivitamins.. Collection Instructions: After draw immediately place specimen on ice and transport to the lab within 30 minutes.. ...
The major action of calcitonin is to lower plasma calcium concentrations, by inhibiting osteoclast activity, resulting in ... Calcitonin is synthesized in the parafollicular C-cells of the thyroid gland and is packaged in secretory granules. ... Calcitonin RIA Kit. 3. Nichols Advantage® Calcitonin Assay. 4. Calcitonin RIA Test. 5. Calcitonin, Ultra-Sensitive RIA Test. 6 ... Calcitonin Assay Immunoradiometric (IRMA) Assay. 7. Calcitonin Microwell-EIA. 8. Calcitonin ELISA. 9. Calcitonin. ...
Intranasal calcitonin and plasma calcium concentrations. Br Med J (Clin Res Ed) 1985; 291 :544 ... Intranasal calcitonin and plasma calcium concentrations.. Br Med J (Clin Res Ed) 1985; 291 doi: https://doi.org/10.1136/bmj. ...
... also embraces peptides from which the resin moiety has been cleaved and which are useful in the synthesis of salmon calcitonin ... Resin peptides useful in the preparation of salmon calcitonin are disclosed along with processes for preparing the same. The ... Glycine-8 calcitonin. WO1996024618A1 *. Feb 2, 1996. Aug 15, 1996. Therapicon S.R.L.. Calcitonin salmon analogues, their ... 16-Alanine]calcitonin. US4663309 *. Jun 28, 1984. May 5, 1987. University Patents, Inc.. Novel peptide hormones with calcitonin ...
Calcitonin is a hormone which is released by the thyroid and parathyroid glands when the levels of calcium compounds in the ... calcitonin (thing). See all of calcitonin, no other writeups in this node. ... Calcitonin is a hormone which is released by the thyroid and parathyroid glands when the levels of calcium compounds in the ... A calcitonin molecule is a small peptide composed of thirty-two amino acids. ...
Fully automated Chemiluminescence assay for the measurement of calcitonin hormone in serum.,medicine,medical supply,medical ... Calcitonin EIA Bone and Mineral Metabolism 021-SDX017. 4. Calcitonin RIA Kit. 5. Calcitonin RIA Test. 6. Calcitonin, Ultra- ... Calcitonin Assay Immunoradiometric (IRMA) Assay. 8. Calcitonin Microwell-EIA. 9. Calcitonin ELISA. 10. Calcitonin IRMA Test. 11 ... Fully automated Chemiluminescence assay for the measurement of calcitonin hormone in serum. ...
encoded search term (Calcitonin) and Calcitonin What to Read Next on Medscape. Related Conditions and Diseases. * ... In addition to calcitonin testing being very useful for patients with MTC/familial MTC, calcitonin levels are reported to be ... Measurement of calcitonin. Calcitonin is assessed in clinical laboratories using noncompetitive immunoassays of different ... The specificity of calcitonin testing increases with provocative testing. Pentagastrin stimulation before a calcitonin assay ...
In 11 patients fasting plasma calcitonin levels were undetectable with an assay sensitive to 0-1 mug/1. Calcitonin seems to ... The acute effect of porcine calcitonin was tested in 17 patients undergoing chronic haemodialysis. In normal adults calcitonin ... Acute responsiveness to calcitonin in chronic renal failure. Br Med J 1976; 2 :396 ... Plasma hydroxyproline levels were not significantly different in the two groups an were unaffected by calcitonin. ...
Quick easy-to-read overview of calcitonin. Includes: how it works, upsides, downsides, bottom line, tips, response and ... Calcitonin may be known as calcitonin-salmon.. *Calcitonin belongs to the class of medicines known as calcitonin receptor ... Store unopen calcitonin nasal spray in the refrigerator at a temperature between 36°F to 46°F (2°C to 8°C). Calcitonin that is ... Calcitonin treatment has been associated with an increased risk of cancer (a risk of 4.1% with calcitonin compared with 2.9% in ...
Only the calcitonin receptor (CTR) expression unambiguously identifies osteoclasts and distinguishes them from macrophage ... Autoradiographic detection of125I-labeled salmon calcitonin combined with CTR immunohistochemistry showed that both methods ...
Home , About us , Contact us , Advertise , All Content , Editorial and Advertising Policy , Terms and Conditions , Privacy Policy , Terms of Use , Advertiser Terms , Linking and RSS policy. © 2018 UBM Medica, LLC, a UBM company. Reproduction in whole or in part is prohibited.. Please send any technical comments or questions to our webmaster.. ...
Calcitonin, Serum (3 Spec). 019859. Tube ID #3. N/A. 026781. Calcitonin, Serum (3 Spec). 026793. Calcitonin (3 Specimens). N/A ... Calcitonin, Serum (3 Spec). 019848. Calcitonin #1. pg/mL. 58892-1. 026781. Calcitonin, Serum (3 Spec). 019857. Tube ID #1. N/A ... Calcitonin, Serum (3 Spec). 019851. Calcitonin #2. pg/mL. 33788-1. 026781. Calcitonin, Serum (3 Spec). 019858. Tube ID #2. N/A ...
IPR021118 Calcitonin. IPR021117 Calcitonin-like. IPR018360 Calcitonin_CS. IPR001693 Calcitonin_peptide-like. ... IPR021118 Calcitonin. IPR021117 Calcitonin-like. IPR018360 Calcitonin_CS. IPR001693 Calcitonin_peptide-like. ... Belongs to the calcitonin family.Curated. Family and domain databases. Integrated resource of protein families, domains and ... sp,P69068,CALC2_ONCNE Calcitonin-2 OS=Oncorhynchus nerka OX=8023 PE=1 SV=1 CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP Align. Format. Add ...
IPR021118 Calcitonin. IPR021117 Calcitonin-like. IPR018360 Calcitonin_CS. IPR001693 Calcitonin_peptide-like. ... IPR021118 Calcitonin. IPR021117 Calcitonin-like. IPR018360 Calcitonin_CS. IPR001693 Calcitonin_peptide-like. ... Belongs to the calcitonin family.Curated. Family and domain databases. Integrated resource of protein families, domains and ... sp,P69165,CALC2_ONCGO Calcitonin-2 OS=Oncorhynchus gorbuscha OX=8017 PE=1 SV=1 CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP Align. Format. ...
Calcitonin. Calcitonin is a hormone that occurs naturally in your body. It is secreted by the thyroid gland, and helps regulate ... Calcitonin nasal spray. Calcitonin nasal spray, available in Canada as Miacalcin®, is approved for the treatment of ... If you are pregnant or breastfeeding, you should not use calcitonin.. Cost. Coverage of calcitonin varies from province to ... Calcitonin injection. Calcitonin injection is currently not approved for the treatment of osteoporosis but is sometimes ...
Calcitonin can slow bone loss in the spine and increase spine bone density. Calcitonin may also help reduce the risk of spine ... Calcitonin has not been shown to prevent bone loss or fracture in other parts of the body and is given as a nasal spray or as ... What are the side effects of calcitonin?. Side effects may include a runny nose with the nasal spray or an allergic reaction or ... Calcitonin is a hormone found in the human body that helps with bone metabolism and calcium regulation. ...
These findings suggest that human calcitonin may be secreted by extrathyroidal tissues. ... Hypothyroid patients with total or near-total thyroidectomy were found to have detectable immunoreactive calcitonin in the ... Calcitonin in thyroidectomized patients Am J Med Sci. Mar-Apr 1978;275(2):159-64. doi: 10.1097/00000441-197803000-00005. ... Hypothyroid patients with total or near-total thyroidectomy were found to have detectable immunoreactive calcitonin in the ...
Calcitonin gene-related peptide regulates muscle acetylcholine receptor synthesis.. New HV, Mudge AW. ... A molecule immunologically related to calcitonin gene-related peptide (CGRP-I) has been found in motoneurones in a variety of ...
Calcitonin drug-oligomer conjugates that include a calcitonin drug coupled to an oligomer including a single polyalkylene ... means chicken calcitonin, eel calcitonin, human calcitonin, porcine calcitonin, rat calcitonin, salmon calcitonin, or the like ... calcitonin, calcitonin analogs, calcitonin fragments, and calcitonin fragment analogs. Calcitonin precursor peptides include, ... The calcitonin drug is preferably calcitonin. More preferably, the calcitonin drug is salmon calcitonin. However, it is to be ...
  • A emenda alternativa deste gene dá um produto que seja calcitonin chamado distante relacionado peptide gene-relacionado, beta tipo (CGRP) da proteína do ácido aminado 37. (news-medical.net)
  • A molecule immunologically related to calcitonin gene-related peptide (CGRP-I) has been found in motoneurones in a variety of mammals including man. (nih.gov)
  • Nonetheless, while CGRP is an established vasodilator and neuromodulator ( 8 , 9 ), calcitonin has had a checkered history, to say the least, both as a hormone and as a drug. (jci.org)
  • Calcitonin gene-related peptide (CGRP), adrenomedullin (ADM) and amylin belong to a unique group of calcitonin-related peptide hormones important for homeostasis in diverse tissues. (anaspec.com)
  • Calcitonin, a 32-amino acid peptide hormone, is essential for calcium balance, whereas CGRP and ADM are important for neurotransmission and cardiovascular and respiratory function. (anaspec.com)
  • Calcitonin gen-relateret peptid eller CGRP er et neuro peptid , et medlem af calcitonin -peptidfamilien, og det findes hos mennesket i to lidt forskellige former, α-CGRP og β-CGRP. (wikipedia.org)
  • α-CGRP dannes ved en alternativ splejsning af genet for calcitonin beliggende på kromosom 11. (wikipedia.org)
  • CGRP medierer sine effekter igennem en heteromer receptor , der består af en G-protein-koblet receptor benævnt CALCRL og et aktivitetsmodificerende protein (RAMP1). (wikipedia.org)
  • An exciting story is emerging of how a single molecule, calcitonin receptor-like receptor (CRLR), can mediate the response to both CGRP and adrenomedullin depending on the presence of different members of a family of accessory proteins, the Receptor Activity Modifying Proteins (RAMPs). (routledge.com)
  • Krootila K, Uusitalo H, Palkama A (1988) Effect of neurogenic irritation and calcitonin gene-related peptide (CGRP) on ocular blood flow in the rabbit. (springer.com)
  • What is the role of calcitonin gene-related peptide (CGRP) in the pathogenesis of anaphylaxis? (medscape.com)
  • Calcitonin gene-related peptide (CGRP), a sensory neurotransmitter that is widely distributed in cardiovascular tissues, may help to counteract coronary artery vasoconstriction during anaphylaxis. (medscape.com)
  • The calcitonin gene peptide superfamily consists of calcitonin (CT), calcitonin gene-related peptide (CGRP), and amylin. (nih.gov)
  • Substance P-immunoreactive nerve fiber (SP-IR NF) and calcitonin gene-related peptide-immunoreactive nerve fiber (CGRP-IR NF) are important mediators of neurogenic inflammation and blood supply. (springer.com)
  • α-Calcitonin gene-related peptide (α-CGRP) is a regulatory neuropeptide of 37 amino acids. (frontiersin.org)
  • In thyroid C cells, the CALC-I gene product containing exon 4 forms calcitonin, whereas the CALC-I gene product containing exons 5 and 6 forms α-CGRP in sensory neurons ( Figure 1 ). (frontiersin.org)
  • Schematic diagram showing the synthesis of calcitonin and α-CGRP from a common gene CALC-I. Calcitonin gene CALC-I undergoes alternative splicing and forms protein calcitonin in thyroid C cells, and α-CGRP in the sensory neurons. (frontiersin.org)
  • Using preclinical behavioral models of migraine, we show that application of calcitonin gene-related peptide (CGRP) to the rat dura mater produces cutaneous periorbital hypersensitivity. (jneurosci.org)
  • SIGNIFICANCE STATEMENT Calcitonin gene-related peptide (CGRP) has long been implicated in the pathophysiology of migraine, and CGRP-based therapeutics are efficacious for the treatment of migraine in humans. (jneurosci.org)
  • Muscle inflammation and hyperalgesia induced by adjuvant injection into skeletal muscle are associated with an increase in calcitonin gene-related peptide (CGRP) labeling in skeletal muscle and dorsal root ganglia (DRG). (cdc.gov)
  • The calcitonin gene transcript also encodes the calcitonin gene-related peptide (CGRP), which is thought to be a potent vasodilator. (leicabiosystems.com)
  • Calcitonin gene-related peptide (CGRP) is a potent vasodilator, originating in trigeminal neurons and has a central role in CH pathophysiology. (lu.se)
  • The calcitonin receptor (CTR) is relevant to three hormonal systems: amylin, calcitonin, and calcitonin gene-related peptide (CGRP). (lu.se)
  • Calcitonin Gene Related Peptide (CGRP) pipeline Target constitutes close to 12 molecules. (marketresearch.com)
  • Calcitonin Gene Related Peptide (CGRP) - Calcitonin gene related peptide (CGRP) is a member of the calcitonin family of peptides. (marketresearch.com)
  • It also reviews key players involved in Calcitonin Gene Related Peptide (CGRP) targeted therapeutics development with respective active and dormant or discontinued projects. (marketresearch.com)
  • A growing body of evidence points to a critical role of calcitonin gene-related peptide (CGRP) in the pathophysiology of migraine headache. (wiley.com)
  • Calcitonin gene-related peptide (CGRP) is a potent vasodilator neuropeptide known to be involved in the regulation of vascular resistance. (bioone.org)
  • Using calcitonin gene-related peptide (CGRP) and brain natriuretic peptide (BNP) as examples, this review addresses the mechanisms through which neuropeptides might modulate nociceptor activity. (dovepress.com)
  • The demonstrated pivotal role of calcitonin gene-related peptide (CGRP) has fostered the development of CGRP antagonists, unfortunately endowed with liver toxicity, and monoclonal antibodies (mAbs) toward circulating CGRP released during migraine attack or targeting its receptor. (frontiersin.org)
  • Calcitonin gene related peptide (CGRP) is the most potent microvascular vasodilator known. (ahajournals.org)
  • Stanniocalcin 1 (STC1) and calcitonin gene-related peptide (CGRP) are involved in bone formation/remodeling. (sigmaaldrich.com)
  • In conclusion, STC1 signals through inhibitory G-protein modulates CGRP receptor spatial localization during osteoblastogenesis and may function as a regulatory factor interacting with calcitonin peptide members during bone formation. (sigmaaldrich.com)
  • Calcitonin gene-related peptide (CGRP) evokes anxiety-like responses when infused into the lateral ventricle of rats. (jneurosci.org)
  • Calcitonin gene-related peptide (CGRP) is one such peptide. (jneurosci.org)
  • Calcitonin gene-related peptide (CGRP) is a pivotal messenger in the inflammatory process in migraine. (mdpi.com)
  • To explore the role of anandamide (AEA) transporter in regulating calcitonin gene-related peptide (CGRP) production and blood pressure. (unboundmedicine.com)
  • Combining calcitonin salmon and lithium may reduce lithium concentrations due to increased loss of lithium in urine. (medicinenet.com)
  • Calcitonin-salmon (Miacalcin) is a man-made version of the hormone calcitonin. (medicinenet.com)
  • Calcitonin-salmon is prescribed to treat osteoporosis (postmenopause), Paget's disease of the bone, and hypercalcemia. (medicinenet.com)
  • Miacalcic injection contains the active ingredient salmon calcitonin (previously known as salcatonin in the UK), which is a synthetic form of the natural hormone calcitonin. (netdoctor.co.uk)
  • Synthetic salmon calcitonin has the same effects as the natural human hormone and is used to prevent bone breakdown. (netdoctor.co.uk)
  • Salmon calcitonin is used for the treatment of: Postmenopausal osteoporosis Hypercalcaemia Paget's disease Bone metastases Phantom limb pain It has been investigated as a possible non-operative treatment for spinal stenosis. (wikipedia.org)
  • The following information is from the UK Electronic Medicines Compendium Salmon calcitonin is rapidly absorbed and eliminated. (wikipedia.org)
  • Resin peptides useful in the preparation of salmon calcitonin are disclosed along with processes for preparing the same. (google.com)
  • The invention also embraces peptides from which the resin moiety has been cleaved and which are useful in the synthesis of salmon calcitonin together with processes for preparing the. (google.com)
  • The invention deals with new compounds containing an amino acid chain similar to that of salmon calcitonin and new methods for closing the ring structure in such compounds to produce calcitonin. (google.com)
  • 23 Claims, No Drawings calcitonin by such addition has not heretofore been SYNTHESIS OF SALMON CALCITONIN reported. (google.com)
  • groups of the amino acids are protected by blocking The calcitonin extract obtained from salmon has been groups The -amino group of the amino acids is propui'ified (Keutmann, H.T., et al. (google.com)
  • Calcitonin is a human hormone that is also found in salmon, however, man-made calcitonin is made using DNA recombinant technology and does not use salmon. (drugs.com)
  • Calcitonin may be known as calcitonin-salmon. (drugs.com)
  • Each spray delivers 0.09mL (200 USP calcitonin salmon units) per actuation. (drugs.com)
  • Autoradiographic detection of125I-labeled salmon calcitonin combined with CTR immunohistochemistry showed that both methods labeled the same cells. (mendeley.com)
  • Calcitonin medication is derived from salmon. (womenshealthmatters.ca)
  • and wherein the first oligomer subunit is covalently coupled to Lys 11 of said salmon calcitonin and the second oligomer is covalently coupled to Lys 18 of said salmon calcitonin. (google.co.uk)
  • Calcitonin, also called calcitonin-salmon, is a synthetic copy of a polypeptide hormone secreted by the ultimobranchial gland of salmon. (emaxhealth.com)
  • What Calcitonin is and what it is used for Calcitonin contains the active substance calcitonin (salmon, synthetic). (drugs.com)
  • Before treatment with Calcitonin tell your doctor if you suspect to be allergic to calcitonin (salmon, synthetic). (drugs.com)
  • Salmon calcitonin is rapidly absorbed and eliminated. (wikidoc.org)
  • Twelve healthy men were tested in a double-blind intra-subject design receiving either 0.1 IU/kg salmon calcitonin (sCT) or 1.0 IU/kg sCT or saline solution during a 20 min IV infusion. (springer.com)
  • Fischer JA, Tobler PH, Henke H, Tschopp FA (1983) Salmon and human calcitonin-like peptides coexist in the human thyroid and brain. (springer.com)
  • Fraioli F, Fabbri A, Gnessi L, Moretti C, Santore C, Felici M (1982) Subarachnoid injection of salmon calcitonin induces analgesia in man. (springer.com)
  • Henke H, Tobler PH, Fischer JA (1983) Localization of salmon calcitonin binding sites in rat brain by autoradiography. (springer.com)
  • Drugmakers with calcitonin salmon products under development for postmenopause osteoporosis (PMO) may have to do a lot more work to get the drugs approved following a joint FDA advisory committee meeting Tuesday. (bioworld.com)
  • For brands that may still be available, search under calcitonin salmon injection. (medbroadcast.com)
  • Do not use calcitonin salmon injection if you are allergic to calcitonin salmon or any ingredients of the medication. (medbroadcast.com)
  • One hundred three patients starting long-term corticosteroid therapy were randomly assigned to receive 1000 mg of calcium per day orally and either calcitriol (0.5 to 1.0 microgram per day orally) plus salmon calcitonin (400 IU per day intranasally), calcitriol plus a placebo nasal spray, or double placebo for one year. (nih.gov)
  • Computer model showing the structure of calcitonin from salmon. (sciencephoto.com)
  • Salmon calcitonin is used to treat a number of disorders in humans, including postmenopausal osteoporosis, and hypercalcaemia (high calcium blood levels). (sciencephoto.com)
  • Prolonged calcitonin receptor signaling by salmon, but not human calcitonin (show CALCA ELISA Kits ), reveals ligand bias. (antibodies-online.com)
  • Oral salmon calcitonin improves fasting and postprandial glycemic control in lean healthy rats. (sigmaaldrich.com)
  • A novel oral form of salmon calcitonin (sCT) was recently demonstrated to improve both fasting and postprandial glycemic control and induce weight loss in diet-induced obese and insulin-resistant rats. (sigmaaldrich.com)
  • It is a neuropeptide of 37 amino acids with structural homology to salmon calcitonin . (biology-online.org)
  • FDA reviewers highlighted a 'plausible' risk of cancer with bone drugs containing calcitonin salmon and recommended their use be restricted to exclude osteoporosis patients. (fiercepharma.com)
  • Calcitonin Salmon Injection in Mohan Co-Op. Indl. (tradeindia.com)
  • Calcitonin acts on receptors present on the surface of osteoclasts to stop them from breaking down bone. (news-medical.net)
  • Osteoblasts do not have calcitonin receptors and are therefore not directly affected by calcitonin levels. (wikipedia.org)
  • Calcitonin acts on calcitonin receptors in bone and possibly also the kidney and gastrointestinal tract, preventing the breakdown of bone and increasing its density. (drugs.com)
  • Calcitonin is a naturally occurring hormone with a short half-life that is believed to act directly on osteoclasts (via receptors on the cell surface for calcitonin). (google.co.uk)
  • The calcitonin family of peptides act through G-protein protein coupled membrane receptors. (anaspec.com)
  • The close connections between amylin and calcitonin receptors are highlighted and role of amylin in the regulation of food intake is then considered. (routledge.com)
  • Fabbri A, Fraioli F, Pert CB, Pert A (1985) Calcitonin receptors in the rat mesencephalon mediate its analgesic action: autoradiographic and behavioral analyses. (springer.com)
  • The role of peptides and receptors of the calcitonin family in the regulation of bone metabolism. (semanticscholar.org)
  • Multiple amylin receptors arise from receptor activity-modifying protein interaction with the calcitonin receptor gene product. (semanticscholar.org)
  • Abundant calcitonin receptors in isolated rat osteoclasts. (semanticscholar.org)
  • Calcitonin receptors have been characterized for the first time in isolated osteoclasts. (semanticscholar.org)
  • Receptors for amylin and calcitonin are targets for treating obesity, diabetes, and bone disorders. (lu.se)
  • STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition. (sigmaaldrich.com)
  • Receptors, Calcitonin" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical Subject Headings) . (umassmed.edu)
  • Calcitonin receptors outside the nervous system mediate the role of calcitonin in calcium homeostasis. (umassmed.edu)
  • The role of calcitonin receptors in the brain is not well understood. (umassmed.edu)
  • This graph shows the total number of publications written about "Receptors, Calcitonin" by people in this website by year, and whether "Receptors, Calcitonin" was a major or minor topic of these publications. (umassmed.edu)
  • Below are the most recent publications written about "Receptors, Calcitonin" by people in Profiles. (umassmed.edu)
  • Calcitonin , also called thyrocalcitonin , a protein hormone synthesized and secreted in humans and other mammals primarily by parafollicular cells (C cells) in the thyroid gland . (britannica.com)
  • The discovery of calcitonin (thyrocalcitonin) in 1961 demonstrated the importance of comparative studies in endocrinology. (britannica.com)
  • Calcitonin (thyrocalcitonin) - serum. (medlineplus.gov)
  • Historically calcitonin has also been called thyrocalcitonin. (wikipedia.org)
  • Calcitonin (also known as thyrocalcitonin ) is a 32-amino acid linear polypeptide hormone that is produced in humans primarily by the parafollicular cells (also known as C-cells) of the thyroid gland, and in many other animals in the ultimopharyngeal body . (wikidoc.org)
  • Under the microscope, the binding of calcitonin to its receptor appears to cause the osteoclasts to lose their "ruffled border," which refers to the compactly folded cell membrane that aids bone removal by increasing the cell's surface area for resorption. (news-medical.net)
  • The calcitonin receptor, localized to osteoclasts, the kidney, and regions of the brain, is a G protein-coupled receptor. (wikipedia.org)
  • The calcitonin receptor (CT) is a G protein-coupled receptor that binds the peptide hormone calcitonin and is involved in maintenance of calcium homeostasis, particularly with respect to bone formation and metabolism. (wikipedia.org)
  • Calcitonin receptor has been shown to interact with Apolipoprotein B and LRP1. (wikipedia.org)
  • Calcitonin belongs to the class of medicines known as calcitonin receptor agonists. (drugs.com)
  • Calcitonin receptor antibodies in. (mendeley.com)
  • Only the calcitonin receptor (CTR) expression unambiguously identifies osteoclasts and distinguishes them from macrophage polykaryons. (mendeley.com)
  • Calcitonin gene-related peptide regulates muscle acetylcholine receptor synthesis. (nih.gov)
  • Goltzman D, Mitchell J (1985) Calcitonin and calcitonin gene related peptide: analysis of discrete and overlapping interaction at receptor sites. (springer.com)
  • The following product was used in this experiment: Calcitonin Receptor Polyclonal Antibody from Thermo Fisher Scientific, catalog # PA5-33380, RRID AB_2550761. (thermofisher.com)
  • Synthetic 17 amino acid peptide from 2nd transmembrane domain of human Calcitonin Receptor. (thermofisher.com)
  • The Calcitonin Receptor inhibits bone resorption. (thermofisher.com)
  • Three alternatively spliced Calcitonin Receptor isoforms have been identified. (thermofisher.com)
  • In addition to binding calcitonin, the Calcitonin Receptor can complex with RAMP3 (receptor activity modifying protein) to bind amylin, which regulates pancreatic islet function and is involved in Type II diabetes. (thermofisher.com)
  • On www.antibodies-online.com are 12 Calcitonin Receptor (CALCR) ELISA Kits from 3 different suppliers available. (antibodies-online.com)
  • Additionally we are shipping Calcitonin Receptor Antibodies (149) and Calcitonin Receptor Proteins (11) and many more products for this protein. (antibodies-online.com)
  • A total of 180 Calcitonin Receptor products are currently listed. (antibodies-online.com)
  • Calcitonin (show CALCA ELISA Kits ) and Amylin (show IAPP ELISA Kits ) Receptor Peptide Interaction Mechanisms: INSIGHTS INTO PEPTIDE-BINDING MODES AND ALLOSTERIC MODULATION OF THE CALCITONIN RECEPTOR BY RECEPTOR ACTIVITY-MODIFYING PROTEINS. (antibodies-online.com)
  • High calcitonin receptor is associated with prostate cancer. (antibodies-online.com)
  • Pharmacological discrimination of calcitonin receptor: receptor activity-modifying protein complexes. (semanticscholar.org)
  • Binding of filamin to the C-terminal tail of the calcitonin receptor controls recycling. (semanticscholar.org)
  • An amylin receptor is revealed following co-transfection of a calcitonin receptor with receptor activity modifying proteins-1 or -3. (semanticscholar.org)
  • However, STC1 inhibited cAMP accumulation in calcitonin receptor (CTR) HEK293 transfected cells stimulated by calcitonin. (sigmaaldrich.com)
  • Frozen Cells validated for cAMP testing: Calcitonin CGRP1 receptor, human recombinant, in CHO-K1 host cell. (perkinelmer.com)
  • OBJECTIVE Increases in serum calcitonin, a tumor marker for medullary thyroid carcinoma (MTC), have been associated with glucagon-like peptide 1 receptor agonist use in some preclinical studies. (diabetesjournals.org)
  • If too much calcitonin is found in the blood, it may be a sign of a type of thyroid cancer called medullary thyroid cancer (MTC). (medlineplus.gov)
  • If your calcitonin levels were high, it may mean you have C-cell hyperplasia or medullary thyroid cancer. (medlineplus.gov)
  • Medullary thyroid cancer, typically produces an elevated serum calcitonin level. (wikipedia.org)
  • In two rare conditions, C-cell hyperplasia and medullary thyroid cancer (MTC), excess amounts of calcitonin are produced. (labcorp.com)
  • The calcitonin test is primarily used to help diagnose C-cell hyperplasia and medullary thyroid cancer, to help determine whether treatment has been effective, and to monitor for recurrence of thyroid cancer. (labcorp.com)
  • Calcitonin levels may be ordered when it is suspected that you have C-cell hyperplasia or medullary thyroid cancer. (labcorp.com)
  • Calcitonin tests may be ordered periodically for family members of those who have MEN 2, starting at an early age, in order to detect medullary thyroid cancer or C-cell hyperplasia as early as possible. (labcorp.com)
  • When you have been treated for medullary thyroid cancer, calcitonin testing will usually be ordered at regular intervals to monitor treatment effectiveness and recurrence. (labcorp.com)
  • Serum calcitonin estimation in medullary thyroid cancer: basal or stimulated levels? (labtestsonline.org.au)
  • Calcitonin measurement in pediatrics: reference ranges are gender-dependent, validation in medullary thyroid cancer and thyroid diseases" Clinical Chemistry and Laboratory Medicine (CCLM) , vol. 57, no. 8, 2019, pp. 1242-1250. (degruyter.com)
  • Medullary thyroid cancer is a rare type of cancer that arises from the C-cells in the thyroid gland that secrete calcitonin. (yourhormones.info)
  • Patients with medullary thyroid cancer have high calcitonin levels in their bloodstream. (yourhormones.info)
  • This invention relates to the hormone calcitonin and DESCRIPTION OF INVENTION to substances having biological activity similar to calci- In general we use a solid phase type of synthesis and tonin and to substances which may be converted into start with a resin called benzhydryl amine resin (Bl-1A such biologically active substances. (google.com)
  • Among such substances is the hormone calcitonin. (google.com)
  • The hormone calcitonin has the potential to relieve pain and also retain bone density, thus reducing the risk of fractures. (cochrane.org)
  • Calcitonin acts to decrease serum calcium concentrations in several ways. (britannica.com)
  • The effects of calcitonin counter the effects of parathyroid hormone ( parathormone ), a substance secreted by the parathyroid glands that acts to increase serum calcium concentrations. (britannica.com)
  • As a result, patients with chronically high serum calcium concentrations (hypercalcemia) do not have high serum calcitonin concentrations. (britannica.com)
  • By contrast, patients with medullary thyroid carcinoma , a cancer of the parafollicular cells that secretes large quantities of calcitonin, have high serum calcitonin concentrations but normal serum calcium concentrations. (britannica.com)
  • In many ways, calcitonin counteracts parathyroid hormone (PTH) and vitamin D. More specifically, calcitonin lowers blood Ca2+ levels in two ways: Major effect: Inhibits osteoclast activity in bones, which break down the bone Minor effect: Inhibits renal tubular cell reabsorption of Ca2+ and phosphate, allowing them to be excreted in the urine High concentrations of calcitonin may be able to increase urinary excretion of calcium and phosphate via the renal tubules. (wikipedia.org)
  • The major action of calcitonin is to lower plasma calcium concentrations, by inhibiting osteoclast activity, resulting in decreased mobilization of calcium from bone [1]. (bio-medicine.org)
  • Calcitonin secretion is stimulated by increased plasma calcium concentrations, and is also regulated by gastrointestinal peptides, estrogens and vitamin D. Gastric peptide stimulation of calcitonin secretion following a meal may play a role in maintaining postprandial calcium homeostasis. (bio-medicine.org)
  • Intranasal calcitonin and plasma calcium concentrations. (bmj.com)
  • Nagant de Deuxchaisnes C , Devogelaer J P , Huaux J P , Dufour J P , Esselinckx W . Intranasal calcitonin and plasma calcium concentrations. (bmj.com)
  • The full spectrum of calcitonin regulation is not completely understood, but its secretion is primarily regulated by the ionized calcium concentration, with increases in ionized calcium leading to increases in calcitonin, while pharmacological doses of calcitonin reduce serum calcium and phosphate concentrations by inhibiting osteoclastic bone resorption and reducing renal tubular reabsorption. (medscape.com)
  • In normal adults calcitonin has no effect on plasma calcium or phosphate levels, but in nine patients both concentrations were substantially reduced after calcitonin. (bmj.com)
  • Calcitonin regulates mineral balance by controlling blood concentrations of calcium and phosphorus metabolism and can cause hypercalcemia. (anaspec.com)
  • 2. Evaluate whether nasal calcitonin improves phosphate homeostasis by raising the TmP/GFR and integrated 24 hr. serum phosphate concentrations. (clinicaltrials.gov)
  • High concentrations of calcitonin may be able to increase urinary excretion of calcium and phosphate via the renal tubules. (wikidoc.org)
  • 1. High plasma immunoreactive calcitonin concentrations were observed in ten of eleven patients with acute renal failure, particularly in the oliguric phase. (clinsci.org)
  • 40 ng/L) and annually thereafter (with trial medication discontinued if ≥50 ng/L). Median calcitonin concentrations were calculated at each time point, and thyroid malignancies were collected prospectively. (diabetesjournals.org)
  • Median calcitonin concentrations were similar between treatment groups at baseline with no increase over time. (diabetesjournals.org)
  • Other types of cancer, including cancers of the breast , lung , and pancreas , can also cause high levels of calcitonin. (medlineplus.gov)
  • Higher-than-normal levels of calcitonin can also occur in people with kidney disease, smokers, and higher body weight. (medlineplus.gov)
  • Abnormally elevated levels of calcitonin are characteristic of thyroid C-cell hyperplasia and medullary thyroid carcinoma [2,3]. (bio-medicine.org)
  • However, the importance of this role in humans is unclear, as patients who have very low or very high levels of calcitonin show no adverse effects. (yourhormones.info)
  • Patients who have had their thyroid gland removed, and have undetectable levels of calcitonin in their blood, show no adverse symptoms or signs as a result of this. (yourhormones.info)
  • Calcitonin is formed by the proteolytic cleavage of a larger prepropeptide, which is the product of the CALC1 gene (CALCA). (wikipedia.org)
  • It is functionally an antagonist with PTH and Vitamin D3.The CALC1 gene belongs to a superfamily of related protein hormone precursors including islet amyloid precursor protein, calcitonin gene-related peptide, and the precursor of adrenomedullin. (wikipedia.org)
  • Calcitonin also has significantly impacted molecular biology, as the gene encoding calcitonin was the first gene discovered in mammalian cells to be alternatively spliced, now known to be a ubiquitous mechanism in eukaryotes. (wikipedia.org)
  • Ishida-Yamamoto D, Tohyama M (1989) Calcitonin gene-related peptide in the nervous tissue. (springer.com)
  • A 37-amino acid peptide derived from the calcitonin gene. (jove.com)
  • It occurs as a result of alternative processing of mRNA from the calcitonin gene. (jove.com)
  • Changes in the expression of calcitonin gene-related peptide after exposure to stretch-shortening contractions. (cdc.gov)
  • Neurogenic inflammation, with its associated hyperalgesia, is linked to release of neuropeptide mediators including substance P, calcitonin gene-related peptide and corticotrophin-releasing facto. (encognitive.com)
  • Science: protein) a second product transcribed from the calcitonin gene . (biology-online.org)
  • Calcitonin gene related peptide is found in a number of tissues including nervous Tissue . (biology-online.org)
  • TY - JOUR T1 - Role of anandamide transporter in regulating calcitonin gene-related peptide production and blood pressure in hypertension. (unboundmedicine.com)
  • Calcitonin suppresses the activity of cells in the bone called osteoclasts. (news-medical.net)
  • Calcitonin works by inhibiting the action of the osteoclasts. (netdoctor.co.uk)
  • Calcitonin lowers blood calcium and phosphorus mainly through its inhibition of osteoclasts. (wikipedia.org)
  • Therefore, the inhibition of the osteoclasts by calcitonin directly reduces the amount of calcium released into the blood. (yourhormones.info)
  • Calcitonin opposes the effects of parathyroid hormone, which acts to increase the blood level of calcium. (news-medical.net)
  • Calcitonin is a hormone which is released by the thyroid and parathyroid gland s when the levels of calcium compounds in the blood are too high. (everything2.com)
  • A key finding, that calcitonin withdrawal sensitizes an osteoclast to parathyroid hormone-induced (PTH-induced) stimulation, witnessed by elevations in serum calcium and urinary deoxypyridinoline cross-links, most certainly establishes its physiological function in resorption control. (jci.org)
  • The action of calcitonin is therefore to cause a reduction in serum calcium, an effect opposite to that of parathyroid hormone. (leicabiosystems.com)
  • The global osteoporosis treatment market is segmented by drug type into bisphosphonates, parathyroid hormone therapy, calcitonin, selective estrogen inhibitors modulator (SERM) and rank ligand inhibitors. (prnewswire.co.uk)
  • Calcitonin is involved in helping to regulate levels of calcium and phosphate in the blood, opposing the action of parathyroid hormone . (yourhormones.info)
  • The secretion of both calcitonin and parathyroid hormone is determined by the level of calcium in the blood. (yourhormones.info)
  • Miacalcin nasal spray is a calcitonin, indicated for the treatment of postmenopausal osteoporosis in women greater than 5 years postmenopause when alternative treatments are not suitable. (medicinenet.com)
  • The nausea that can occur with injectable calcitonin is unlikely to occur with the nasal spray. (medicinenet.com)
  • Use of calcitonin nasal spray may result in adverse reactions related to the nose such as rhinitis and nosebleeds. (drugs.com)
  • Calcitonin nasal spray should be used in conjunction with an adequate intake of calcium and vitamin D. (drugs.com)
  • Store unopen calcitonin nasal spray in the refrigerator at a temperature between 36°F to 46°F (2°C to 8°C). Calcitonin that is in use may be kept at room temperature, between 68°F to 77°F (20°C to 25°C). When using calcitonin for the first time, allow it to warm to room temperature before using. (drugs.com)
  • Calcitonin nasal spray, available in Canada as Miacalcin®, is approved for the treatment of osteoporosis in women who have been post-menopausal for at least five years. (womenshealthmatters.ca)
  • Bottles of calcitonin nasal spray should be stored in the fridge before use. (womenshealthmatters.ca)
  • Calcitonin has not been shown to prevent bone loss or fracture in other parts of the body and is given as a nasal spray or as an injection. (americanbonehealth.org)
  • In the United States, two nasal-spray versions of calcitonin are FDA-approved for treating postmenopausal osteoporosis in women: Fortical (Upsher-Smith Laboratories) and Miacalcin (Novartis). (emaxhealth.com)
  • This study is designed to determine if nasal calcitonin, an already approved drug in the US, can lower blood levels of FGF23 and reduce phosphate wasting in patients with XLH. (clinicaltrials.gov)
  • Determine whether nasal calcitonin significantly lowers integrated 24-hour blood levels of FGF23 in patients with XLH. (clinicaltrials.gov)
  • Evaluate whether nasal calcitonin improves serum phosphate levels in XLH. (clinicaltrials.gov)
  • Assess whether nasal calcitonin improves blood levels of the active form of vitamin D and calcium absorption from the intestine. (clinicaltrials.gov)
  • Make sure that nasal calcitonin is safe and well tolerated. (clinicaltrials.gov)
  • Determine whether 3 months of nasal calcitonin administered at a dose of 400 IU/day significantly lowers integrated 24-hour serum levels of FGF23 in patients with XLH. (clinicaltrials.gov)
  • 3. Assess whether nasal calcitonin improves calcium metabolism in patients with XLH by increasing integrated 24 hr. serum levels of 1,25(OH)2vitamin D and enhancing intestinal calcium absorption, as estimated by 24-hour urine calcium. (clinicaltrials.gov)
  • The C cells, or parafollicular cells, of the thyroid gland (indicated by the arrow marked "P") produce a hormone called calcitonin, which regulates serum calcium levels. (britannica.com)
  • Calcitonin is a hormone produced in C cells of the thyroid gland. (medlineplus.gov)
  • Calcitonin is a 32 amino acid peptide hormone secreted by parafollicular cells (also known as C cells) of the thyroid gland in humans, and in many other animals in the ultimopharyngeal body. (wikipedia.org)
  • Calcitonin is synthesized in the parafollicular C-cells of the thyroid gland and is packaged in secretory granules. (bio-medicine.org)
  • Calcitonin (CT) is also produced by the thyroid gland, parafollicular cells. (clinicaltrials.gov)
  • In mammals, the major source of calcitonin is from the parafollicular or C cells in the thyroid gland, but it is also synthesized in a wide variety of other tissues, including the lung and intestinal tract. (anaspec.com)
  • Calcitonin is a hormone produced by the thyroid gland that helps regulate calcium levels in the body and is involved in the process of bone building. (peacehealth.org)
  • Calcitonin levels in the blood drop after a person has his or her thyroid gland removed. (peacehealth.org)
  • Calcitonin is a linear polypeptide that is produced primarily by parafollicular cells (C-cells) in the thyroid gland. (sciencephoto.com)
  • Calcitonin is a hormone produced by the Thyroid Gland . (requestatest.com)
  • Calcitonin is a hormone that is produced in humans by the parafollicular cells (commonly known as C-cells) of the thyroid gland . (yourhormones.info)
  • The secretion of calcitonin is also inhibited by the hormone somatostatin , which can also be released by the C-cells in the thyroid gland. (yourhormones.info)
  • Does the thyroid gland stop releasing calcitonin if you have hyperparathyroidism? (yahoo.com)
  • Synthetic analogues of calcitonin are of particular interest in the treatment of osteoporosis , a disease characterized by the thinning of bones that arises from increased bone resorption or decreased bone formation . (britannica.com)
  • The rate of bone loss is accelerated in post-menopausal women and in those with osteoporosis, where thinning of the bone arises due to decreased bone formation or increased bone resorption, calcitonin has been shown to improve the density and strength of bone. (news-medical.net)
  • Long-term use of calcitonin is associated with an increased risk of various types of cancers and it should no longer be used in the long-term treatment of osteoporosis. (netdoctor.co.uk)
  • Calcitonin is reserved for the treatment of postmenopausal osteoporosis in women when other treatments for osteoporosis are ineffective, not tolerated, or not desired. (drugs.com)
  • Calcitonin injection is currently not approved for the treatment of osteoporosis but is sometimes prescribed for people who have fractures of the vertebrae, mainly to relieve pain. (womenshealthmatters.ca)
  • Calcitonin may be useful in treating various bone disorders including, but not limited to, osteoporosis and Paget's disease. (google.co.uk)
  • This is because it has been difficult to explain why thyroidectomy does not result in osteoporosis, and why high circulating calcitonin in medullary thyroid carcinoma fails to trigger overt osteopetrosis. (jci.org)
  • The agency also concluded that the benefits of calcitonin-containing medicines did not outweigh their risks in the treatment of osteoporosis and that they should no longer be used for this condition. (emaxhealth.com)
  • CHMP concluded that the benefits of calcitonin for osteoporosis did not exceed the risks. (emaxhealth.com)
  • In addition to banning its use for osteoporosis, the CHMP recommended that calcitonin should be administered for no more than four weeks to prevent acute bone loss resulting from sudden immobilization, and normally for no more than three months to treat Paget's disease. (emaxhealth.com)
  • Calcitonin sometimes is used as treatment to relieve pain from spinal fractures related to osteoporosis. (peacehealth.org)
  • We studied whether corticosteroid-induced osteoporosis could be prevented by treatment with calcium, calcitriol (1,25-dihydroxyvitamin D3), and calcitonin. (nih.gov)
  • Calcitonin may also be used to treat people with osteoporosis or Paget's disease. (requestatest.com)
  • Their levels are not tested in hypothyroidism because the exact role of calcitonin in human health and disease is not fully known. (clinicaltrials.gov)
  • The overall effect of calcitonin is to lower the concentration of calcium in the blood when it rises above the normal value. (britannica.com)
  • However, with short-term use in Paget's disease, hypercalcaemia in cancer and preventing bone loss due to immobilisation, the benefits of calcitonin continue to outweigh its risks. (netdoctor.co.uk)
  • Secondary objectives are to assess the benefits of calcitonin in reducing the incidence of bone complications (hypercalcemia, fractures and nervous compression) and improving patient survival, and to report any adverse effects of the treatment. (cochrane.org)
  • Our previous studies showed that the expression of calcitonin, a peptide hormone that regulates calcium homeostasis, is induced by progesterone immediately preceding implantation, and is required for the generation of a receptive rat uterus. (bioone.org)
  • We monitored the spatio-temporal expression of calcitonin at various days of the menstrual cycle. (bioone.org)
  • Reverse transcriptase-polymerase chain reaction analysis of the baboon endometrium on Days 9 and 10 postovulation revealed stage-specific expression of calcitonin mRNA, which overlapped with the window of uterine receptivity. (bioone.org)
  • This poses particular challenges when metastatic MTC occurs without the expression of calcitonin. (intechopen.com)
  • In 11 patients fasting plasma calcitonin levels were undetectable with an assay sensitive to 0-1 mug/1. (bmj.com)
  • Calculation and Validation of a Plasma Calcitonin Limit for Early Detection of Medullary Thyroid Carcinoma in Nodular Thyroid Disease. (labtestsonline.org.au)
  • This procedure involves collecting an initial blood sample (baseline), then giving an injection of intravenous calcium or pentagastrin, substances that stimulate the thyroid to produce calcitonin. (labcorp.com)
  • A rare form of thyroid cancer which affects the C-cells, the same cells which produce calcitonin, may cause levels to be elevated. (requestatest.com)
  • The assays are heterogeneous, with different sensitivity and specificity, and often they recognize multiple forms of immunoreactive calcitonin. (medscape.com)
  • They all are referred as "circulating immunoreactive calcitonin. (medscape.com)
  • Hypothyroid patients with total or near-total thyroidectomy were found to have detectable immunoreactive calcitonin in the serum and urine. (nih.gov)
  • 2. Immunoreactive calcitonin decreased progressively with time, independently of recovery of renal function. (clinsci.org)
  • Examples of conditions that are treated using calcitonin include Paget's disease of the bone and hypercalcemia (chronically high blood calcium). (news-medical.net)
  • Both increased calcitonin secretion and activity only last a few days and patients with hypercalcemia do not have a high serum level of calcitonin. (news-medical.net)
  • It did not specify a time frame for the short-term use of calcitonin for treating hypercalcemia caused by cancer. (emaxhealth.com)
  • When used to treat hypercalcemia, the dose of calcitonin is based on body weight (4 IU per kilogram of body weight) and injected every 12 hours by subcutaneous or intramuscular injection. (medbroadcast.com)
  • Calcitonin is used to reverse bone loss and may also help in bone formation. (drugs.com)
  • Sometimes, calcitonin in the blood is checked several times after you are given a shot (injection) of a special medicine that stimulates calcitonin production. (medlineplus.gov)
  • Calcitonin injection can be given for short periods of time to prevent further bone loss in people who have suddenly become immobile. (netdoctor.co.uk)
  • Calcitonin injection is used to treat Paget's disease of the bone. (mayoclinic.org)
  • The recommended starting dose of calcitonin for treating Paget's disease is 100 IU (international units) once daily, given by subcutaneous (under the skin) or intramuscular (into a muscle) injection. (medbroadcast.com)
  • Salivary amylase output in man increases after injection of synthetic human calcitonin. (bmj.com)
  • Calcitonin also regulates the level of calcium and other mineral levels in the kidneys. (news-medical.net)
  • In humans, the calcitonin protein is made up of 32 amino acids . (britannica.com)
  • It belongs to the calcitonin-like protein family. (wikipedia.org)
  • Multiple forms of circulating calcitonin have been found in the serum of healthy and diseased individuals. (medscape.com)
  • Treatment of animals with the antiprogestin ZK 137.316 dramatically reduced calcitonin expression, indicating that calcitonin expression in the baboon endometrium is under progesterone regulation. (bioone.org)
  • Both increased calcitonin secretion and increased calcitonin activity are relatively short-lived, lasting only a few days. (britannica.com)
  • Calcitonin is also used to treat symptoms of Paget's disease when other treatments have not been successful. (medbroadcast.com)
  • Manufactured forms of calcitonin have, in the past, been given to treat Paget's disease of bone and sometimes hypercalcaemia and bone pain. (yourhormones.info)
  • This antibody recognises human procalcitonin and calcitonin. (genetex.com)
  • A calcitonin molecule is a small peptide composed of thirty-two amino acid s. (everything2.com)
  • This test measures the level of calcitonin in your blood. (medlineplus.gov)
  • In patients with medullary thyroid carcinoma, on the other hand, cancerous C cells secrete large amounts of calcitonin. (news-medical.net)
  • Secretion of calcitonin is stimulated by: an increase in serum [Ca2+] gastrin and pentagastrin. (wikipedia.org)
  • The biochemical hallmark of MTC is the secretion of calcitonin (CT). (endocrine-abstracts.org)
  • The effectiveness of calcitonin at reducing the risk of bone fractures has not been proven. (drugs.com)
  • This review looked at the effectiveness of calcitonin for controlling pain from bone metastases. (cochrane.org)
  • The main objective of the review is to determine the effectiveness of calcitonin to reduce metastatic bone pain in patients with painful bone metastases. (cochrane.org)
  • There are several treatments to help relieve this pain: radiotherapy, analgesic drugs (pain killers) such as opioids, and bone-modulating drugs such as bisphosphonates and calcitonin. (cochrane.org)
  • Calcitonin is a hormone found in the human body that helps with bone metabolism and calcium regulation. (americanbonehealth.org)
  • These findings suggest that human calcitonin may be secreted by extrathyroidal tissues. (nih.gov)
  • Effects of calcitonin were assessed on brain potentials recorded from the human scalp which were evoked either by auditory clicks or visual checkerboard pattern-reversals. (springer.com)
  • Fischer JA, Tobler PH, Kaufmann M, Born W, Henke H, Cooper PE, Sagar SM, Martin JB (1981) Calcitonin: regional distribution of the hormone and its binding sites in the human brain and pituitary. (springer.com)
  • Human calcitonin stimulates salivary amylase output in man. (bmj.com)
  • Human medullary thyroid carcinoma: immunohistochemical staining for calcitonin using NCL-L- CALCITONIN. (leicabiosystems.com)
  • Detection of human recombinant PCT in Western blotting by monoclonal antibodies specific to calcitonin following 15% SDS-PAGE in reducing conditions. (genetex.com)
  • Calcitonin is a 32-amino acid peptide with an N-terminal disulphide bridge and a C-terminal prolineamide residue. (jci.org)
  • Calcitonin (CT) is a 32 amino acid peptide synthesized by the parafollicular C cells of the thyroid. (leicabiosystems.com)
  • Calcitonin production helps regulate the body's levels of calcium and phosphate. (requestatest.com)
  • There were slightly more side effects for the patients given calcitonin. (cochrane.org)
  • Precalcitonin (116 amino acids) is cleaved to procalcitonin, which is further cleaved to immature calcitonin (33 amino acids) and then to mature calcitonin, a monomer of a 3.5-kd peptide composed of 32 amino acids, which is the only biologically active form. (medscape.com)
  • Previous studies have suggested that molecular species larger than the mature calcitonin (CT) are produced by tumors of different origin. (aacrjournals.org)
  • Calcitonin reduces bone turnover in these patients and in 1991, an intranasal calcitonin spray was approved by The Food and Drug Administration for treatment of the condition. (news-medical.net)
  • Intranasal calcitonin. (bmj.com)
  • A stimulation test is more sensitive than a single calcitonin measurement. (labcorp.com)
  • Fully automated Chemiluminescence assay for the measurement of calcitonin hormone in serum. (bio-medicine.org)