AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsAnthropology, Education, Sociology and Social PhenomenaTechnology, Industry, AgricultureInformation ScienceHealth Care
Burkholderia cepacia complexBurkholderia cepaciaBurkholderia InfectionsBurkholderiaCystic FibrosisBurkholderia cenocepaciaBurkholderia pseudomalleiRec A RecombinasesBacterial Typing TechniquesHydrogen CyanideOnionsDNA, BacterialSputumEnvironmental MicrobiologyBiofilmsPolymorphism, Restriction Fragment LengthPyrrolnitrinBenzethoniumMelioidosisOpportunistic InfectionsSequence Analysis, DNASodium BenzoateRNA, Ribosomal, 16SPolymerase Chain ReactionTobramycinRandom Amplified Polymorphic DNA Technique4-ButyrolactoneVirulencePhylogenyElectrophoresis, Gel, Pulsed-FieldMolecular Sequence DataSoil MicrobiologyQuorum SensingDNA, RibosomalAnti-Bacterial AgentsGram-Negative Bacterial InfectionsBacterial ProteinsSpecies SpecificityGenes, BacterialMicrobial ViabilityBurkholderia gladioliDNA FingerprintingMicrobial Sensitivity Tests2,4,5-Trichlorophenoxyacetic AcidCulture MediaGlandersPolysaccharides, BacterialDrug Resistance, BacterialGene Expression Regulation, BacterialGenome, BacterialVirulence FactorsBase SequencePseudomonasBiodegradation, EnvironmentalPseudomonas aeruginosaGenotype
Burkholderia cepacia complex
A group of phenotypically similar but genotypically distinct species (genomovars) in the genus BURKHOLDERIA. They are found in water, soil, and the rhizosphere of crop plants. They can act as opportunistic human pathogens and as plant growth promoting and biocontrol agents.
Burkholderia cepacia
A species of BURKHOLDERIA considered to be an opportunistic human pathogen. It has been associated with various types of infections of nosocomial origin.
Burkholderia Infections
Infections with bacteria of the genus BURKHOLDERIA.
Burkholderia
A genus of gram-negative, aerobic, rod-shaped bacteria. Organisms in this genus had originally been classified as members of the PSEUDOMONAS genus but overwhelming biochemical and chemical findings indicated the need to separate them from other Pseudomonas species, and hence, this new genus was created.
Cystic Fibrosis
An autosomal recessive genetic disease of the EXOCRINE GLANDS. It is caused by mutations in the gene encoding the CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR expressed in several organs including the LUNG, the PANCREAS, the BILIARY SYSTEM, and the SWEAT GLANDS. Cystic fibrosis is characterized by epithelial secretory dysfunction associated with ductal obstruction resulting in AIRWAY OBSTRUCTION; chronic RESPIRATORY INFECTIONS; PANCREATIC INSUFFICIENCY; maldigestion; salt depletion; and HEAT PROSTRATION.
Burkholderia cenocepacia
A species of gram-negative bacteria that causes disease in plants. It is found commonly in the environment and is an opportunistic pathogen in humans.
Burkholderia pseudomallei
A species of gram-negative, aerobic bacteria that causes MELIOIDOSIS. It has been isolated from soil and water in tropical regions, particularly Southeast Asia.
Rec A Recombinases
A family of recombinases initially identified in BACTERIA. They catalyze the ATP-driven exchange of DNA strands in GENETIC RECOMBINATION. The product of the reaction consists of a duplex and a displaced single-stranded loop, which has the shape of the letter D and is therefore called a D-loop structure.
Bacterial Typing Techniques
Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.
Hydrogen Cyanide
Hydrogen cyanide (HCN); A toxic liquid or colorless gas. It is found in the smoke of various tobacco products and released by combustion of nitrogen-containing organic materials.
Onions
Herbaceous biennial plants and their edible bulbs, belonging to the Liliaceae.
DNA, Bacterial
Deoxyribonucleic acid that makes up the genetic material of bacteria.
Sputum
Material coughed up from the lungs and expectorated via the mouth. It contains MUCUS, cellular debris, and microorganisms. It may also contain blood or pus.
Environmental Microbiology
The study of microorganisms living in a variety of environments (air, soil, water, etc.) and their pathogenic relationship to other organisms including man.
Biofilms
Encrustations, formed from microbes (bacteria, algae, fungi, plankton, or protozoa) embedding in extracellular polymers, that adhere to surfaces such as teeth (DENTAL DEPOSITS); PROSTHESES AND IMPLANTS; and catheters. Biofilms are prevented from forming by treating surfaces with DENTIFRICES; DISINFECTANTS; ANTI-INFECTIVE AGENTS; and antifouling agents.
Polymorphism, Restriction Fragment Length
Variation occurring within a species in the presence or length of DNA fragment generated by a specific endonuclease at a specific site in the genome. Such variations are generated by mutations that create or abolish recognition sites for these enzymes or change the length of the fragment.
Pyrrolnitrin
3-Chloro-4-(3-chloro-2-nitrophenyl)pyrrole. Antifungal antibiotic isolated from Pseudomonas pyrrocinia. It is effective mainly against Trichophyton, Microsporium, Epidermophyton, and Penicillium.
Benzethonium
Bactericidal cationic quaternary ammonium surfactant used as a topical anti-infective agent. It is an ingredient in medicaments, deodorants, mouthwashes, etc., and is used to disinfect apparatus, etc., in the food processing and pharmaceutical industries, in surgery, and also as a preservative. The compound is toxic orally as a result of neuromuscular blockade.
Melioidosis
A disease of humans and animals that resembles GLANDERS. It is caused by BURKHOLDERIA PSEUDOMALLEI and may range from a dormant infection to a condition that causes multiple abscesses, pneumonia, and bacteremia.
Opportunistic Infections
An infection caused by an organism which becomes pathogenic under certain conditions, e.g., during immunosuppression.
Sequence Analysis, DNA
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
Sodium Benzoate
The sodium salt of BENZOIC ACID. It is used as an antifungal preservative in pharmaceutical preparations and foods. It may also be used as a test for liver function.
RNA, Ribosomal, 16S
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
Polymerase Chain Reaction
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
Tobramycin
An aminoglycoside, broad-spectrum antibiotic produced by Streptomyces tenebrarius. It is effective against gram-negative bacteria, especially the PSEUDOMONAS species. It is a 10% component of the antibiotic complex, NEBRAMYCIN, produced by the same species.
Random Amplified Polymorphic DNA Technique
Technique that utilizes low-stringency polymerase chain reaction (PCR) amplification with single primers of arbitrary sequence to generate strain-specific arrays of anonymous DNA fragments. RAPD technique may be used to determine taxonomic identity, assess kinship relationships, analyze mixed genome samples, and create specific probes.
4-Butyrolactone
One of the FURANS with a carbonyl thereby forming a cyclic lactone. It is an endogenous compound made from gamma-aminobutyrate and is the precursor of gamma-hydroxybutyrate. It is also used as a pharmacological agent and solvent.
Virulence
The degree of pathogenicity within a group or species of microorganisms or viruses as indicated by case fatality rates and/or the ability of the organism to invade the tissues of the host. The pathogenic capacity of an organism is determined by its VIRULENCE FACTORS.
Phylogeny
The relationships of groups of organisms as reflected by their genetic makeup.
Electrophoresis, Gel, Pulsed-Field
Gel electrophoresis in which the direction of the electric field is changed periodically. This technique is similar to other electrophoretic methods normally used to separate double-stranded DNA molecules ranging in size up to tens of thousands of base-pairs. However, by alternating the electric field direction one is able to separate DNA molecules up to several million base-pairs in length.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Soil Microbiology
The presence of bacteria, viruses, and fungi in the soil. This term is not restricted to pathogenic organisms.
Quorum Sensing
A phenomenon where microorganisms communicate and coordinate their behavior by the accumulation of signaling molecules. A reaction occurs when a substance accumulates to a sufficient concentration. This is most commonly seen in bacteria.
DNA, Ribosomal
DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.
Anti-Bacterial Agents
Substances that reduce the growth or reproduction of BACTERIA.
Gram-Negative Bacterial Infections
Infections caused by bacteria that show up as pink (negative) when treated by the gram-staining method.
Bacterial Proteins
Proteins found in any species of bacterium.
Species Specificity
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
Genes, Bacterial
The functional hereditary units of BACTERIA.
Microbial Viability
Ability of a microbe to survive under given conditions. This can also be related to a colony's ability to replicate.
Burkholderia gladioli
A species of gram-negative, aerobic bacteria that acts as both a human and plant pathogen.
DNA Fingerprinting
A technique for identifying individuals of a species that is based on the uniqueness of their DNA sequence. Uniqueness is determined by identifying which combination of allelic variations occur in the individual at a statistically relevant number of different loci. In forensic studies, RESTRICTION FRAGMENT LENGTH POLYMORPHISM of multiple, highly polymorphic VNTR LOCI or MICROSATELLITE REPEAT loci are analyzed. The number of loci used for the profile depends on the ALLELE FREQUENCY in the population.
Microbial Sensitivity Tests
Any tests that demonstrate the relative efficacy of different chemotherapeutic agents against specific microorganisms (i.e., bacteria, fungi, viruses).
2,4,5-Trichlorophenoxyacetic Acid
An herbicide with strong irritant properties. Use of this compound on rice fields, orchards, sugarcane, rangeland, and other noncrop sites was terminated by the EPA in 1985. (From Merck Index, 11th ed)
Culture Media
Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.
Glanders
A contagious disease of horses that can be transmitted to humans. It is caused by BURKHOLDERIA MALLEI and characterized by ulceration of the respiratory mucosa and an eruption of nodules on the skin.
Polysaccharides, Bacterial
Polysaccharides found in bacteria and in capsules thereof.
Drug Resistance, Bacterial
The ability of bacteria to resist or to become tolerant to chemotherapeutic agents, antimicrobial agents, or antibiotics. This resistance may be acquired through gene mutation or foreign DNA in transmissible plasmids (R FACTORS).
Gene Expression Regulation, Bacterial
Any of the processes by which cytoplasmic or intercellular factors influence the differential control of gene action in bacteria.
Genome, Bacterial
The genetic complement of a BACTERIA as represented in its DNA.
Virulence Factors
Those components of an organism that determine its capacity to cause disease but are not required for its viability per se. Two classes have been characterized: TOXINS, BIOLOGICAL and surface adhesion molecules that effect the ability of the microorganism to invade and colonize a host. (From Davis et al., Microbiology, 4th ed. p486)
Base Sequence
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Pseudomonas
A genus of gram-negative, aerobic, rod-shaped bacteria widely distributed in nature. Some species are pathogenic for humans, animals, and plants.
Biodegradation, Environmental
Elimination of ENVIRONMENTAL POLLUTANTS; PESTICIDES and other waste using living organisms, usually involving intervention of environmental or sanitation engineers.
Pseudomonas aeruginosa
A species of gram-negative, aerobic, rod-shaped bacteria commonly isolated from clinical specimens (wound, burn, and urinary tract infections). It is also found widely distributed in soil and water. P. aeruginosa is a major agent of nosocomial infection.
Genotype
The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.

Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia). (1/151)

An antibiotic efflux gene cluster that confers resistance to chloramphenicol, trimethoprim, and ciprofloxacin has been identified in Burkholderia cenocepacia (genomovar III), an important cystic fibrosis pathogen. Five open reading frames have been identified in the cluster. There is apparently a single transcriptional unit, with llpE encoding a lipase-like protein, ceoA encoding a putative periplasmic linker protein, ceoB encoding a putative cytoplasmic membrane protein, and opcM encoding a previously described outer membrane protein. A putative LysR-type transcriptional regulatory gene, ceoR, is divergently transcribed upstream of the structural gene cluster. Experiments using radiolabeled chloramphenicol and salicylate demonstrated active efflux of both compounds in the presence of the gene cluster. Salicylate is an important siderophore produced by B. cepacia complex isolates, and both extrinsic salicylate and iron starvation appear to upregulate ceoR promoter activity, as does chloramphenicol. These results suggest that salicylate is a natural substrate for the efflux pump in B. cenocepacia and imply that the environment of low iron concentration in the cystic fibrosis lung can induce efflux-mediated resistance, even in the absence of antibiotic selective pressure.  (+info)

The Burkholderia cepacia epidemic strain marker is part of a novel genomic island encoding both virulence and metabolism-associated genes in Burkholderia cenocepacia. (2/151)

The Burkholderia cepacia epidemic strain marker (BCESM) is a useful epidemiological marker for virulent B. cenocepacia strains that infect patients with cystic fibrosis. However, there was no evidence that the original marker, identified by random amplified polymorphic DNA fingerprinting, contributed to pathogenicity. Here we demonstrate that the BCESM is part of a novel genomic island encoding genes linked to both virulence and metabolism. The BCESM was present on a 31.7-kb low-GC-content island that encoded 35 predicted coding sequences (CDSs): an N-acyl homoserine lactone (AHL) synthase gene (cciI) and corresponding transcriptional regulator (cciR), representing the first time cell signaling genes have been found on a genomic island; fatty acid biosynthesis genes; an IS66 family transposase; transcriptional regulator CDSs; amino acid metabolism genes; and a group of hypothetical genes. Mutagenesis of the AHL synthase, amidase (amiI), and porin (opcI) genes on the island was carried out. Testing of the isogenic mutants in a rat model of chronic lung infection demonstrated that the amidase played a role in persistence, while the AHL synthase and porin were both involved in virulence. The island, designated the B. cenocepacia island (cci), is the first genomic island to be defined in the B. cepacia complex and its discovery validates the original epidemiological correlation of the BCESM with virulent CF strains. The features of the cci, which overlap both pathogenicity and metabolism, expand the concept of bacterial pathogenicity islands and illustrate the diversity of accessory functions that can be acquired by lateral gene transfer in bacteria.  (+info)

Importance of the ornibactin and pyochelin siderophore transport systems in Burkholderia cenocepacia lung infections. (3/151)

Previously, orbA, the gene encoding the outer membrane receptor for ferric-ornibactin, was identified in Burkholderia cenocepacia K56-2, a strain which produces ornibactin, salicylic acid, and negligible amounts of pyochelin. A K56-2 orbA mutant was less virulent than the parent strain in a rat agar bead infection model. In this study, an orbA mutant of B. cenocepacia Pc715j which produces pyochelin in addition to ornibactin and salicylic acid was constructed. The gene encoding the outer membrane receptor for ferric-pyochelin (fptA) was also identified. An fptA mutant was constructed in Pc715j and shown to be deficient in [(59)Fe]pyochelin uptake. A 75-kDa iron-regulated protein was identified in outer membrane preparations of Pc715j that was absent in outer membrane preparations of Pc715jfptA::tp. Pc715jfptA::tp and Pc715jorbA::tp produced smaller amounts of their corresponding siderophores. Both Pc715jorbA::tp and Pc715jfptA::tp were able to grow in iron starvation conditions in vitro. In the agar bead model, the Pc715jorbA::tp mutant was cleared from the lung, indicating that the pyochelin uptake system does not compensate for the absence of a functional ornibactin system. Pc715jfptA::tp persisted in rat lung infections in numbers similar to those of the parent strain, indicating that the ferric-ornibactin uptake system could compensate for the defect in ferric-pyochelin uptake in vivo. These studies suggest that the ornibactin uptake system is the most important siderophore-mediated iron transport system in B. cenocepacia lung infections.  (+info)

Genetic characterization of a multicomponent signal transduction system controlling the expression of cable pili in Burkholderia cenocepacia. (4/151)

Cable pili are peritrichous organelles expressed by certain strains of Burkholderia cenocepacia, believed to facilitate colonization of the lower respiratory tract in cystic fibrosis patients. The B. cenocepacia cblBACDS operon encodes the structural and accessory proteins required for the assembly of cable pili, as well as a gene designated cblS, predicted to encode a hybrid sensor kinase protein of bacterial two-component signal transduction systems. In this study we report the identification of two additional genes, designated cblT and cblR, predicted to encode a second hybrid sensor kinase and a response regulator, respectively. Analyses of the deduced amino acid sequences of the cblS and cblT gene products revealed that both putative sensor kinases have transmitter and receiver domains and that the cblT gene product has an additional C-terminal HPt domain. Mutagenesis of the cblS, cblT, or cblR gene led to a block in expression of CblA, the major pilin subunit, and a severe decrease in cblA transcript abundance. Using transcriptional fusion analyses, the decrease in the abundance of the cblA transcript in the cblS, cblT, and cblR mutants was shown to be due to a block in transcription from the cblB-proximal promoter, located upstream of the cblBACDS operon. Furthermore, ectopic expression of either cblS or cblR in wild-type B. cenocepacia strain BC7 led to a significant increase, while ectopic expression of cblT resulted in a dramatic decrease, in abundance of the CblA major pilin and the cblA transcript. Our results demonstrate that the B. cenocepacia cblS, cblT, and cblR genes are essential for cable pilus expression and that their effect is exerted at the level of transcription of the cblBACDS operon. These findings are consistent with the proposed function of the cblSTR gene products as a multicomponent signal transduction pathway controlling the expression of cable pilus biosynthetic genes in B. cenocepacia.  (+info)

Identification of Burkholderia cenocepacia genes required for bacterial survival in vivo. (5/151)

Burkholderia cenocepacia (formerly Burkholderia cepacia complex genomovar III) causes chronic lung infections in patients with cystic fibrosis. In this work, we used a modified signature-tagged mutagenesis (STM) strategy for the isolation of B. cenocepacia mutants that cannot survive in vivo. Thirty-seven specialized plasposons, each carrying a unique oligonucleotide tag signature, were constructed and used to examine the survival of 2,627 B. cenocepacia transposon mutants, arranged in pools of 37 unique mutants, after a 10-day lung infection in rats by using the agar bead model. The recovered mutants were screened by real-time PCR, resulting in the identification of 260 mutants which presumably did not survive within the lungs. These mutants were repooled into smaller pools, and the infections were repeated. After a second screen, we isolated 102 mutants unable to survive in the rat model. The location of the transposon in each of these mutants was mapped within the B. cenocepacia chromosomes. We identified mutations in genes involved in cellular metabolism, global regulation, DNA replication and repair, and those encoding bacterial surface structures, including transmembrane proteins and cell surface polysaccharides. Also, we found 18 genes of unknown function, which are conserved in other bacteria. A subset of 12 representative mutants that were individually examined using the rat model in competition with the wild-type strain displayed reduced survival, confirming the predictive value of our STM screen. This study provides a blueprint to investigate at the molecular level the basis for survival and persistence of B. cenocepacia within the airways.  (+info)

Production of exopolysaccharide by Burkholderia cenocepacia results in altered cell-surface interactions and altered bacterial clearance in mice. (6/151)

Despite the characterization of some Burkholderia cepacia complex exopolysaccharides (EPSs), little is known about the role of EPSs in the pathogenicity of B. cepacia complex organisms. We describe 2 Burkholderia cenocepacia (genomovar III) isolates obtained from a patient with cystic fibrosis (CF): the nonmucoid isolate C8963 and the mucoid isolate C9343. Both isolates had identical random amplified polymorphic DNA patterns. C9343 produced a capsule composed of the EPSs PS-I and PS-II, as well as alpha -1,6-glucan. These isolates exhibited several phenotypic differences: C8963 synthesized octanoyl-homoserine lactone and produced biofilms, but C9343 did not; in a mouse model of pulmonary infection, C8963 was cleared more rapidly than was C9343; and C9343 interacted poorly with macrophages and neutrophils, compared with C8963, suggesting that the C9343 capsule interfered with cell-surface interactions. Overproduction of EPS by C9343 resulted in a mucoid appearance and interfered with cell-surface interactions and clearance in an animal model. This mucoid colonial appearance could enhance the persistence and virulence of this important CF-related pathogen.  (+info)

Involvement of a plasmid-encoded type IV secretion system in the plant tissue watersoaking phenotype of Burkholderia cenocepacia. (7/151)

Burkholderia cenocepacia strain K56-2, a representative of the Burkholderia cepacia complex, is part of the epidemic and clinically problematic ET12 lineage. The strain produced plant tissue watersoaking (ptw) on onion tissue, which is a plant disease-associated trait. Using plasposon mutagenesis, mutants in the ptw phenotype were generated. The translated sequence of a disrupted gene (ptwD4) from a ptw-negative mutant showed homology to VirD4-like proteins. Analysis of the region proximal to the transfer gene homolog identified a gene cluster located on the 92-kb resident plasmid that showed homology to type IV secretion systems. The role of ptwD4, ptwC, ptwB4, and ptwB10 in the expression of ptw activity was determined by conducting site-directed mutagenesis. The ptw phenotype was not expressed by K56-2 derivatives with a disruption in ptwD4, ptwB4, or ptwB10 but was observed in a derivative with a disruption in ptwC. Complementation of ptw-negative K56-2 derivatives in trans resulted in complete restoration of the ptw phenotype. In addition, analysis of culture supernatants revealed that the putative ptw effector(s) was a secreted, heat-stable protein(s) that caused plasmolysis of plant protoplasts. A second chromosomally encoded type IV secretion system with complete homology to the VirB-VirD system was identified in K56-2. Site-directed mutagenesis of key secretory genes in the VirB-VirD system did not affect expression of the ptw phenotype. Our findings indicate that in strain K56-2, the plasmid-encoded Ptw type IV secretion system is responsible for the secretion of a plant cytotoxic protein(s).  (+info)

Burkholderia cepacia genomovar III and Burkholderia vietnamiensis double infection in a cystic fibrosis child. (8/151)

Herein we report a case of a cystic fibrosis child who was simultaneously infected with Burkholderia cepacia genomovar III and Burkholderia vietnamiensis. After antimicrobial therapy only B. cepacia genomovar III persisted.  (+info)

Social interactions in the Burkholderia cepacia complex: biofilms and quorum sensing. - Semantic ScholarSocial interactions in the Burkholderia cepacia complex: biofilms and quorum sensing. - Semantic Scholar
Burkholderia cepacia complex bacteria are opportunistic pathogens that cause respiratory tract infections in susceptible patients, mainly people with cystic fibrosis. There is convincing evidence that B. cepacia complex bacteria can form biofilms, not only on abiotic surfaces (e.g., glass and plastics), but also on biotic surfaces such as epithelial cells, leading to the suggestion that biofilm formation plays a key role in persistent infection of cystic fibrosis lungs. This article presents an overview of the molecular mechanisms involved in B. cepacia complex biofilm formation, the increased resistance of sessile B. cepacia complex cells and the role of quorum sensing in B. cepacia complex biofilm formation.
https://www.semanticscholar.org/paper/Social-interactions-in-the-Burkholderia-cepacia-co-Coenye/a43dd7fe5d1840c2cf96112de121d185a59299c6
Distribution and genomic location of active insertion sequences in the Burkholderia cepacia complex | Microbiology SocietyDistribution and genomic location of active insertion sequences in the Burkholderia cepacia complex | Microbiology Society
This study aimed firstly to establish the distribution and copy number within the Burkholderia cepacia complex of three insertion sequences (IS402, IS407 and IS1416) that possess the ability to activate transcription and hence influence gene expression. A second aim was to map the genomic insertion sites of one of the active insertion sequences (IS407) to establish putative links between insertion site and downstream gene activation. The resulting data revealed that all three insertion sequences were present in one-third of the 66 isolates tested. The three insertion sequences were prevalent across the nine B. cepacia complex species, although IS402 was absent from the 16 Burkholderia anthina strains tested and IS407 was absent from all 10 Burkholderia pyrrocinia strains. IS407 copies from six strains (two Burkholderia cenocepacia strains and one strain each of Burkholderia multivorans, Burkholderia stabilis, Burkholderia vietnamiensis and B. anthina) were mapped to the genome using hemi-nested inverse
https://www.microbiologyresearch.org/content/journal/jmm/10.1099/jmm.0.46175-0
A General Protein O-glycosylation System Within the Burkholderia Cepacia Complex Is Involved in Motility and Virulence - PubMedA General Protein O-glycosylation System Within the Burkholderia Cepacia Complex Is Involved in Motility and Virulence - PubMed
Bacteria of the Burkholderia cepacia complex (Bcc) are pathogens of humans, plants, and animals. Burkholderia cenocepacia is one of the most common Bcc species infecting cystic fibrosis (CF) patients and its carriage is associated with poor prognosis. In this study, we characterized a general O-link …
https://pubmed.ncbi.nlm.nih.gov/24673753/
Azithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.govAzithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.gov
Pulmonary infection with Burkholderia cepacia complex (BCC) in patients with CF is often associated with a more rapid decline in lung function. Because of the resistance of BCC to many antibiotics, treatment options are often limited. New therapies to improve outcomes for patients infected with BCC are needed.. However, because of the unpredictable nature of this pulmonary infection in CF, patients with BCC infection have been excluded from many CF therapeutic trials.. Recent published trials in the United States, Australia, and the United Kingdom have all demonstrated clinical benefits from prolonged administration of azithromycin in CF. In these trials, the vast majority of patients were chronically infected with Pseudomonas aeruginosa.. Patients with BCC were excluded from the US and UK trials, and only four patients with BCC infection were enrolled in the Australian trial. Thus, the effectiveness of azithromycin in CF patients infected with BCC is largely unknown and deserves further ...
https://clinicaltrials.gov/ct2/show/NCT00298922
Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)
Regan KH, Bhatt J. Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis. Cochrane Database of Systematic Reviews 2016, Issue 11. Art. No.: CD009876. DOI: 10.1002/14651858.CD009876.pub3 ...
https://www.ecfs.eu/resource-article/cf-literature/eradication-therapy-burkholderia-cepacia-complex-people-cystic
ফার্মাসিউটিক্যালে নতুন উদ্বেগের নাম Burkholderia cepacia complex (Bcc) - PharmaBanglaফার্মাসিউটিক্যালে নতুন উদ্বেগের নাম Burkholderia cepacia complex (Bcc) - PharmaBangla
Burkholderia cepacia complex (Bcc) গ্রাম নেগেটিভ, অ্যারোবিক (অক্সিজেনের উপস্থিতিতে বাঁচতে পারে) ব্যাক্টেরিয়া
https://pharmabangla.com/article/2690
Burkholderia cepacia complex | Johns Hopkins ABX GuideBurkholderia cepacia complex | Johns Hopkins ABX Guide
Burkholderia cepacia complex answers are found in the Johns Hopkins ABX Guide powered by Unbound Medicine. Available for iPhone, iPad, Android, and Web.
https://peds.unboundmedicine.com/pedscentral/view/Johns_Hopkins_ABX_Guide/540069/all/Burkholderia_cepacia_complex?q=Disease+Wilson
burkholderia cepacia complex Archives - PacBioburkholderia cepacia complex Archives - PacBio
By downloading, copying, or making any use of the images located on this website (Site) you acknowledge that you have read and understand, and agree to, the terms of this Image Usage Agreement, as well as the terms provided on the Legal Notices webpage, which together govern your use of the images as provided below. If you do not agree to such terms, do not download, copy or use the images in any way, unless you have written permission signed by an authorized Pacific Biosciences representative.. Subject to the terms of this Agreement and the terms provided on the Legal Notices webpage (to the extent they do not conflict with the terms of this Agreement), you may use the images on the Site solely for (a) editorial use by press and/or industry analysts, (b) in connection with a normal, peer-reviewed, scientific publication, book or presentation, or the like. You may not alter or modify any image, in whole or in part, for any reason. You may not use any image in a manner that misrepresents the ...
https://www.pacb.com/auto_tags/burkholderia-cepacia-complex/
Targeting the bacterial cytoskeleton of CF pathogens for antimicrobial development - A cautionary tale? - ePrints - Newcastle...Targeting the bacterial cytoskeleton of CF pathogens for antimicrobial development - A cautionary tale? - ePrints - Newcastle...
AbstractBackground Burkholderia cepacia complex (BCC) bacteria are opportunistic pathogens that cause severe lung infections in cystic fibrosis (CF). Treatment of BCC infections is difficult due to the inherent multidrug resistance of BCC. There is a pressing need to find new bacterial targets for antimicrobials. We have previously shown that the novel compound Q22, which is related to A22 and inhibits the bacterial cytoskeletal protein MreB, inhibits growth of BCC bacteria.Aims We aimed to further analyse the phenotypic effects of Q22 treatment on BCC virulence traits to assess its feasibility as an antimicrobial.Methods BCC bacteria were grown in the presence of Q22 and a broad phenotypic analysis was performed, including resistance to H2O2 induced oxidative stress, changes in inflammatory potential of cell surface components and in vivo drug toxicity studies. The influence of Q22 treatment on inflammatory potential was measured by monitoring the cytokine responses of BCC whole cell lysates, ...
https://eprint.ncl.ac.uk/197731
U.S. FDA Investigates B. cepacian Complex Outbreak Linked to Personal CareU.S. FDA Investigates B. cepacian Complex Outbreak Linked to Personal Care
A no-rinse foam cleanser has been linked to at least 10 confirmed cases of Burkholderia cepacia complex; Shadow Holdings dba Bocchi Laboratories has voluntarily recalled the product as the FDA investigates.
https://www.cosmeticsandtoiletries.com/regulatory/region/northamerica/FDA-Investigates-B-cepacian-Complex-Outbreak-Linked-to-Personal-Care-482218091.html
Marine Drugs | Free Full-Text | Antimicrobial Activity of Monoramnholipids Produced by Bacterial Strains Isolated from the Ross...Marine Drugs | Free Full-Text | Antimicrobial Activity of Monoramnholipids Produced by Bacterial Strains Isolated from the Ross...
Microorganisms living in extreme environments represent a huge reservoir of novel antimicrobial compounds and possibly of novel chemical families. Antarctica is one of the most extraordinary places on Earth and exhibits many distinctive features. Antarctic microorganisms are well known producers of valuable secondary metabolites. Specifically, several Antarctic strains have been reported to inhibit opportunistic human pathogens strains belonging to Burkholderia cepacia complex (Bcc). Herein, we applied a biodiscovery pipeline for the identification of anti-Bcc compounds. Antarctic sub-sea sediments were collected from the Ross Sea, and used to isolate 25 microorganisms, which were phylogenetically affiliated to three bacterial genera (Psychrobacter, Arthrobacter, and Pseudomonas) via sequencing and analysis of 16S rRNA genes. They were then subjected to a primary cell-based screening to determine their bioactivity against Bcc strains. Positive isolates were used to produce crude extracts from microbial
http://www.mdpi.com/1660-3397/14/5/83
Synthesis of 4-Amino-4-Deoxy-L-Arabinose C-Phosphonate Esters as Transferase Inhibitors | EUROCARB 2019Synthesis of 4-Amino-4-Deoxy-L-Arabinose C-Phosphonate Esters as Transferase Inhibitors | EUROCARB 2019
The group of 17 opportunistic pathogens linked to severe infections in cystic fibrosis and other immunocompromised conditions has been known as the Burkholderia cepacia complex.[1] The inner Kdo residue of Burkholderia lipopolysaccharide (LPS), which is highly conserved across the genus, is flanked by 4-amino-4-deoxy-L-arabinose units (Ara4N).[2] Furthermore, the binding of Ara4N to the phosphate groups of lipid A has been purported as one of the reasons for hindered interaction with cationic agents and consequently, to induce antibiotic resistance.[3] We set out to synthesize a series of tenable Ara4N transferase (ArnT) inhibitors with the prospect of impeding the biosynthetic pathway towards activated Ara4N species.[4] By the same token, we intend to inhibit the transfer of Ara4N residues both to Burkholderia LPS core and lipid A in vitro. Our synthetic endeavours en route to C-glycosidic derivatives mimicking either the transition state of glycosyl transfer or ArnT natural substrate will be ...
https://eurocarb2019.com/abstracts/p110
CAZy - BacteriaCAZy - Bacteria
Lineage: cellular organisms; Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderia cepacia complex; Burkholderia ...
http://www.cazy.org/b449.html
ecorn-cf: Question singleecorn-cf: Question single
The advantages of MALDI-TOF are that identification from pure culture can take minutes and is relatively cost-effective- other than the cost of the machine (approx. $200,000), relatively few reagents are required to process a sample. A recent paper investigating the use of MALDI-TOF to identify common CF pathogens, estimated that 71% of Pseudomonas aeruginosa isolates were identified by MALDI-TOF by day 2 of incubation, at which stage none had been identified by conventional culture2. Similarly, with Staphylococcus aureus, 89% were identified using MALDI-TOF by day 1 of incubation, whereas only 68% had been identified by culture on day 2. It can also identify bacteria which are slow growing much more quickly than by using standard culture techniques. In addition, it can also be used to identify yeasts and fungi, which are commonly found in CF patients. It can also determine differences between species of bacteria, such as those in the Burkholderia cepacia complex, which prove problematic for ...
http://ecorn-cf.eu/index.php?id=32&no_cache=1&L=8&tx_expertadvice_pi1%5Bshowitem%5D=3325
KEGG T00771: BCAL0647KEGG T00771: BCAL0647
bcj:BCAL0647 K00799 glutathione S-transferase [EC:2.5.1.18] , (GenBank) putative glutathione S-transferase (A) MKLYYWPKTRAFRALWMLEELGVVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSAP FAESGAVLLYLADRCPGAGLGVAPDDPLRGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA FGWGNIARVQRALAQALAHSRWLVGDRFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR AEDRDAFRRAVAIEQREAARLLHA ...
http://www.genome.jp/dbget-bin/www_bget?-f+-n+a+bcj:BCAL0647
KEGG SSDB Paralog Search Result: bur:Bcep18194 A5156KEGG SSDB Paralog Search Result: bur:Bcep18194 A5156
T00286 (aalt,achr,actc,amyb,amyc,asw,cmos,cthd,dfn,fek,fva,hta,kak,kmx,kpnk,lei,lsh,lys,mcol,msub,mtab,noe,oor,paru,pje,png,ptd,rpln,sclo,sera,sfz,slb,snl,srub,taj : calculation not yet completed ...
http://www.kegg.jp/ssdb-bin/ssdb_paralog?org_gene=bur:Bcep18194_A5156
Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical MicrobiologyUpdated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical Microbiology
The Burkholderia cepacia complex consists of nine closely related species: Burkholderia cepacia genomovars I and VI, Burkholderia multivorans (genomovar II), Burkholderia cenocepacia (genomovar III), Burkholderia stabilis (genomovar IV), Burkholderia vietnamiensis (genomovar V), Burkholderia ambifaria (genomovar VII), Burkholderia anthina (genomovar VIII), and Burkholderia pyrrocinia (genomovar IX) (2, 9, 10). Despite the advances that have been made in the understanding of the taxonomy and epidemiology of this group, infections of the respiratory tract with B. cepacia complex organisms still have a considerable impact on morbidity and mortality in cystic fibrosis (CF) patients (4, 5, 6). B. cepacia complex strains have also attracted attention as possible biocontrol and bioremediation agents that could be used as antagonists of soil-borne plant pathogens, as plant growth-promoting agents, and for the bioremediation of various recalcitrant xenobiotics (3, 8). To aid in identification, ...
https://jcm.asm.org/content/41/6/2797.long
Taxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical MicrobiologyTaxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical Microbiology
At the beginning of this review it is essential to clarify the terminology that will be used to refer to the members of the Burkholderia cepacia complex and their relatives. The name B. cepacia will relate only to B. cepacia genomovar I. Strains resembling B. cepacia may belong to the B. cepacia complex, to otherBurkholderia species (for instance, Burkholderia gladioli), or to species from other genera (for instance,Ralstonia pickettii) that share some phenotypic or genotypic similarities with the B. cepacia complex. B. cepacia complex bacteria and organisms that may be confused with them will be altogether referred to as B. cepacia-like organisms. Most previous reports regarding these organisms were published before the recognition of the complicated taxonomic relationships between the different members of the B. cepacia complex; it is therefore unclear to what category the presumed B. cepacia isolates described would belong. For that reason, when such literature is cited, the name B. cepacia ...
https://jcm.asm.org/content/39/10/3427?ijkey=016117cc34c5b762756dd57266ee67d3be91427d&keytype2=tf_ipsecsha
A Decade of Burkholderia cenocepacia Virulence Determinant Research<...A Decade of Burkholderia cenocepacia Virulence Determinant Research<...
TY - JOUR. T1 - A Decade of Burkholderia cenocepacia Virulence Determinant Research. AU - Loutet, S.A.. AU - Valvano, Miguel. PY - 2010/10. Y1 - 2010/10. N2 - The Burkholderia cepacia complex (Bcc) is a group of genetically related environmental bacteria that can cause chronic opportunistic infections in patients with cystic fibrosis (CF) and other underlying diseases. These infections are difficult to treat due to the inherent resistance of the bacteria to antibiotics. Bacteria can spread between CF patients through social contact and sometimes cause cepacia syndrome, a fatal pneumonia accompanied by septicemia. Burkholderia cenocepacia has been the focus of attention because initially it was the most common Bcc species isolated from patients with CF in North America and Europe. Today, B. cenocepacia, along with Burkholderia multivorans, is the most prevalent Bcc species in patients with CF. Given the progress that has been made in our understanding of B. cenocepacia over the past decade, we ...
https://pure.qub.ac.uk/en/publications/a-decade-of-burkholderia-cenocepacia-virulence-determinant-resear
Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...
Review question We looked for evidence of which antibiotics are best to treat a flare up of symptoms in people with cystic fibrosis with persistent Burkholderia cepacia complex lung infection.. Background Cystic fibrosis is a common inherited condition where the lungs often become blocked with mucus. This harms the lungs defences and often results in chronic, persistent infections that cannot be cleared by antibiotics. People with cystic fibrosis often need courses of antibiotics to reduce their symptoms (for instance cough, excess mucus and breathlessness) when these flare up or worsen. Such episodes are called exacerbations, and are usually treated with intravenous antibiotics (given through a drip into a vein). One group of bacteria that can infect the lungs of people with cystic fibrosis is called the Burkholderia cepacia complex. These closely-related bacteria are found widely in the environment and do not cause infections in healthy people who do not have cystic fibrosis. They are ...
http://www.cochrane.org/CD009529/CF_which-antibiotics-are-best-treat-worsening-symptoms-people-cystic-fibrosis-persistent-burkholderia
EMBL: CP000871EMBL: CP000871
ID CP000871; SV 1; circular; genomic DNA; STD; PRO; 167422 BP. XX AC CP000871; AAVB01000000-AAVB01000037; XX PR Project:PRJNA17407; XX DT 16-NOV-2007 (Rel. 93, Created) DT 12-DEC-2013 (Rel. 119, Last updated, Version 2) XX DE Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence. XX KW . XX OS Burkholderia multivorans ATCC 17616 OC Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; OC Burkholderiaceae; Burkholderia; Burkholderia cepacia complex. OG Plasmid pBMUL01 XX RN [1] RP 1-167422 RG US DOE Joint Genome Institute RA Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E., RA Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., RA Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J., RA Richardson P.; RT Complete sequence of plasmid1 of Burkholderia multivorans ATCC 17616; RL Unpublished. XX RN [2] RP 1-167422 RG US DOE Joint Genome Institute RA Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., ...
http://pbil.univ-lyon1.fr/cgi-bin/acnuc-search-ac?query=CP000871&db=EMBL&ident=ACNUC7421
Phase variation has a role in Burkholderia ambifaria niche adaptation - Espace INRSPhase variation has a role in Burkholderia ambifaria niche adaptation - Espace INRS
Members of the Burkholderia cepacia complex (Bcc), such as B. ambifaria, are effective biocontrol strains, for instance, as plant growth-promoting bacteria; however, Bcc isolates can also cause severe respiratory infections in people suffering from cystic fibrosis (CF). No distinction is known between isolates from environmental and human origins, suggesting that the natural environment is a potential source of infectious Bcc species. While investigating the presence and role of phase variation in B. ambifaria HSJ1, an isolate recovered from a CF patient, we identified stable variants that arose spontaneously irrespective of the culture conditions. Phenotypic and proteomic approaches revealed that the transition from wild-type to variant types affects the expression of several putative virulence factors. By using four different infection models (Drosophila melanogaster, Galleria mellonella, macrophages and Dictyostelium discoideum), we showed that the wild-type was more virulent than the ...
http://espace.inrs.ca/2207/
Treatments to cure long-term infections with Burkholderia cepacia in people with cystic fibrosis | CochraneTreatments to cure long-term infections with Burkholderia cepacia in people with cystic fibrosis | Cochrane
Review question. We reviewed the evidence for antibiotic treatment to cure early infection with Burkholderia cepacia complex in people with cystic fibrosis and prevent it becoming permanent.. Background. Cystic fibrosis is an inherited disease and people who have this disease produce large amounts of thick mucus which is difficult to clear. This mucus blocks up their lungs and digestive systems. People with cystic fibrosis suffer from lots of chest infections, which cause scarring of their airways. Eventually, they develop infections that cant be cured with antibiotics, so their lungs always contain lots of bugs, this is described as being chronically infected. One of these bugs, Burkholderia cepacia, causes a lot of problems for people with cystic fibrosis because it is very difficult to treat and makes their lung disease deteriorate faster than it otherwise would. This is an updated version of the review.. Search date. We last searched for any evidence on 12 March 2019.. Study ...
https://www.cochrane.org/CD009876/CF_treatments-cure-long-term-infections-burkholderia-cepacia-people-cystic-fibrosis
Items where Author is Nicholson, Audrey - Northumbria Research LinkItems where Author is Nicholson, Audrey - Northumbria Research Link
Nicholson, Audrey, Perry, John, James, Arthur, Stanforth, Stephen, Carnell, Sonya, Wilkinson, Kathryn, Khan, Anjam, de Soyza, Anthony and Gould, Kate (2012) In vitro activity of S-(3,4-dichlorobenzyl) isothiourea hydrochloride and novel structurally related compounds against multidrug-resistant bacteria, including Pseudomonas aeruginosa and Burkholderia cepacia complex. International Journal of Antimicrobial Agents, 39 (1). pp. 27-32. ISSN 0924-8579 de Soyza, Anthony, Meachery, Gerard, Hester, Katy, Nicholson, Audrey, Parry, Gareth, Tocewicz, Krzysztof, Pillay, Thasee, Clark, Stephen, Lordan, James, Schueler, Stephan, Fisher, Andrew, Dark, John, Gould, Kate and Corris, Paul (2010) Lung transplantation for patients with cystic fibrosis and Burkholderia cepacia complex infection: A single-center experience. The Journal of Heart and Lung Transplantation, 29 (12). pp. 1395-1404. ISSN 1053 2498 Meachery, Gerard, de Soyza, Anthony, Nicholson, Audrey, Parry, Gareth, Hasan, Asif, Tocewicz, Krzysztof, ...
http://nrl.northumbria.ac.uk/view/creators/Nicholson=3AAudrey=3A=3A.html
Burkholderia cenocepacia ATCC ® BAA-245D-5™Burkholderia cenocepacia ATCC ® BAA-245D-5™
Burkholderia cenocepacia ATCC ® BAA-245D-5™ Designation: Genomic DNA from Burkholderia cenocepacia strain LMG 16656 TypeStrain=False Application:
https://www.atcc.org/en/Products/Cells_and_Microorganisms/Bacteria/Bacterial_Nucleic_Acids/BAA-245D-5.aspx
https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310
Free Online Library: Environmental Burkholderia cepacia complex isolates in human infections.(DISPATCHES) by Emerging Infectious Diseases; Health, general Infection Health aspects
https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310
Genome-wide transcription start site profiling in biofilm-grown Burkholderia cenocepacia J2315Genome-wide transcription start site profiling in biofilm-grown Burkholderia cenocepacia J2315
Mapping transcription start sites across the B. cenocepacia genome added relevant information to the J2315 annotation. Genes and novel regulatory RNAs putatively involved in B. cenocepacia biofilm formation were identified. These findings will help in understanding regulation of B. cenocepacia biofi …
https://pubmed.ncbi.nlm.nih.gov/26462475/
KEGG PATHWAY: Glycolysis / Gluconeogenesis - Burkholderia cenocepacia J2315KEGG PATHWAY: Glycolysis / Gluconeogenesis - Burkholderia cenocepacia J2315
Glycolysis is the process of converting glucose into pyruvate and generating small amounts of ATP (energy) and NADH (reducing power). It is a central pathway that produces important precursor metabolites: six-carbon compounds of glucose-6P and fructose-6P and three-carbon compounds of glycerone-P, glyceraldehyde-3P, glycerate-3P, phosphoenolpyruvate, and pyruvate [MD:M00001]. Acetyl-CoA, another important precursor metabolite, is produced by oxidative decarboxylation of pyruvate [MD:M00307]. When the enzyme genes of this pathway are examined in completely sequenced genomes, the reaction steps of three-carbon compounds from glycerone-P to pyruvate form a conserved core module [MD:M00002], which is found in almost all organisms and which sometimes contains operon structures in bacterial genomes. Gluconeogenesis is a synthesis pathway of glucose from noncarbohydrate precursors. It is essentially a reversal of glycolysis with minor variations of alternative paths [MD:M00003 ...
http://www.genome.jp/kegg-bin/show_pathway?bcj00010+BCAL2623
Recombinant Burkholderia vietnamiensis UPF0060 membrane protein Bcep1808 1236 (Bcep1808 1236) - CusabioRecombinant Burkholderia vietnamiensis UPF0060 membrane protein Bcep1808 1236 (Bcep1808 1236) - Cusabio
Purchase Recombinant Burkholderia vietnamiensis UPF0060 membrane protein Bcep1808_1236 (Bcep1808_1236). It is produced in Yeast. High purity. Good price.
https://www.cusabio.com/Recombinant-Protein/Recombinant-Burkholderia-vietnamiensis-UPF0060-membrane-protein-Bcep18081236-Bcep18081236-397481.html
bcscV - Type III secretion system protein - Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 ...bcscV - Type III secretion system protein - Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
https://www.uniprot.org/uniprot/B4EFC6
hisS - Histidine--tRNA ligase - Burkholderia cenocepacia (strain AU 1054) - hisS gene & proteinhisS - Histidine--tRNA ligase - Burkholderia cenocepacia (strain AU 1054) - hisS gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
https://www.uniprot.org/uniprot/Q1BGX3
Pre GI: GenePre GI: Gene
General Information: Burkholderia cenocepacia MC0-3 was isolated from soil associated with maize roots. This species (genomovar III) is part of the Burkholderia cepacia complex, which consists of 9 closely related species, also known as genomovars. These organisms are commonly found in soil and all are opportunistic pathogens espcially in cystic fibrosis patients. ...
http://pregi.bi.up.ac.za/pre_gi_gene.php?source_accession=NC_010515&gi_accession=NC_010515:1491590
Profile | Biosciences | University of ExeterProfile | Biosciences | University of Exeter
The species that presently constitute the Burkholderia cepacia complex (Bcc) have multiple roles; they include soil and water saprophytes, bioremediators, and plant, animal and human pathogens. Since the first description of pathogenicity in the Bcc was based on sour skin rot of onion bulbs, this study returned to this plant host to investigate the onion-associated phenotype of the Bcc. Many Bcc isolates, which were previously considered to be non-mucoid, produced copious amounts of exopolysaccharide (EPS) when onion tissue was provided as the sole nutrient. EPS production was not species-specific, was observed in isolates from both clinical and environmental sources, and did not correlate with the ability to cause maceration of onion tissue. Chemical analysis suggested that the onion components responsible for EPS induction were primarily the carbohydrates sucrose, fructose and fructans. Additional sugars were investigated, and all alcohol sugars tested were able to induce EPS production, in ...
https://biosciences.exeter.ac.uk/staff/profile/index.php?web_id=alan_brown
Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia...Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia...
TY - JOUR. T1 - Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia cepacia Complex. AU - Loveridge, E Joel. AU - Jones, Cerith. AU - Bull, Matthew J. AU - Moody, Suzy C. AU - Kahl, Małgorzata W. AU - Khan, Zainab. AU - Neilson, Louis. AU - Tomeva, Marina. AU - Adams, Sarah E. AU - Wood, Andrew C. AU - Rodriguez-Martin, Daniel. AU - Pinel, Ingrid. AU - Parkhill, Julian. AU - Mahenthiralingam, Eshwar. AU - Crosby, John. N1 - Copyright © 2017 Loveridge et al.. PY - 2017/7/1. Y1 - 2017/7/1. N2 - Pseudomonas mesoacidophila ATCC 31433 is a Gram-negative bacterium, first isolated from Japanese soil samples, that produces the monobactam isosulfazecin and the β-lactam-potentiating bulgecins. To characterize the biosynthetic potential of P. mesoacidophila ATCC 31433, its complete genome was determined using single-molecule real-time DNA sequence analysis. The 7.8-Mb genome comprised four replicons, three chromosomal (each ...
https://pure.solent.ac.uk/en/publications/reclassification-of-the-specialized-metabolite-producer-pseudomon
Pre GI: GenePre GI: Gene
General Information: This organism (AU 1054) was isolated from the blood of a patient with CF. This microbe has three chromosomes. Opportunistic pathogen. This species (genomovar III) is part of the Burkholderia cepacia complex, which consists of 9 closely related species, also known as genomovars. These organisms are commonly found in soil and all are opportunistic pathogens espcially in cystic fibrosis patients. ...
http://pregi.bi.up.ac.za/pre_gi_gene.php?source_accession=NC_008060&gi_accession=NC_008060:1346581
Predicted Orthologs - RBBHPredicted Orthologs - RBBH
Please Note: Ortholuge cannot be used for certain RBB analyses involving closely-related strains (e.g. Burkholderia cenocepacia J2315 versus Burkholderia cenocepacia AU 1054) because the phylogenetic distance between each ingroup protein is very small in relation to the phylogenetic distance between each ingroup protein and the associated outgroup protein. In these cases, the Ortholuge Classification value will be left blank which indicates Ortholuge analysis was not peformed, however the two proteins may very well be orthologs. In other cases, only some rows will be missing Ortholuge classifications, which can occur when a suitable gene could not be found in the outgroup species ...
https://burkholderia.com/rbbh/pairs?query_strain_id=146&queryStrain=Burkholderia+cenocepacia+J2315&hit_strain_id=129&hitStrain=Burkholderia+cenocepacia+AU+1054&max=100&sort=gene.locusTag&offset=800&order=asc
Priebe Laboratory | Boston Childrens HospitalPriebe Laboratory | Boston Childrens Hospital
The Priebe Laboratory, located in the Enders Research Building of Boston Childrens Hospital, studies the bacterial pathogens Pseudomonas aeruginosa and the Burkholderia cepacia complex, with the long-term goal of developing vaccines and new antimicrobials. Techniques used in Priebes group span multiple fields, including microbiology, molecular biology, genomics, cellular and molecular immunology, and animal models of infection.. ...
http://www.childrenshospital.org/research/labs/priebe-laboratory
A0K923 | SWISS-MODEL RepositoryA0K923 | SWISS-MODEL Repository
SWISS-MODEL Repository entry for A0K923 (NUOA_BURCH), NADH-quinone oxidoreductase subunit A. Burkholderia cenocepacia (strain HI2424)
https://swissmodel.expasy.org/repository/uniprot/A0K923
A0K968 | SWISS-MODEL RepositoryA0K968 | SWISS-MODEL Repository
SWISS-MODEL Repository entry for A0K968 (Y2294_BURCH), Probable transcriptional regulatory protein Bcen2424_2294. Burkholderia cenocepacia (strain HI2424)
https://swissmodel.expasy.org/repository/uniprot/A0K968
orange complex bacteria (OCB) - Allie: Abbreviation / Long Form Info.orange complex bacteria (OCB) - Allie: Abbreviation / Long Form Info.
Search for abbreviations and long forms in lifescience, results along with the related PubMed / MEDLINE information and co-occurring abbreviations.
http://allie.dbcls.jp/pair/OCB
Successful containment of a nosocomial outbreak of Burkholderia cepacia in a special care baby unit of a base hospital in Sri...Successful containment of a nosocomial outbreak of Burkholderia cepacia in a special care baby unit of a base hospital in Sri...
Over 6 days in May 2013, 4 BCs out of 14 in the special care baby unit of Base Hospital Avissawella, grew B. cepacia. BCs became positive after a mean of 3.5 days since admission. All four neonates developed high levels of inflammatory markers and thrombocytopaenia. Organism showed identical ABs in all isolates, with sensitivity to meropenem, ceftazidime, ciprofloxacin and resistance to trimethoprim and aminoglycosides. All babies were successfully treated with meropenem.. A 10% dextrose solution used for the neonates grew B. Cepacia on culture. This solution is not readily available in our setting and its prepared in the unit, using 5% and 50% dextrose combination. It was used for different babies at multiple times throughout the day by several nurses. Other samples that grew B. cepacia included a bottle of normal saline used as a multiple dose vial for preparation of intravenous (IV) drugs, a gallipot of sterile water used for suction of airway of a ventilated baby, 2 incubator humidifiers ...
https://0-aricjournal-biomedcentral-com.brum.beds.ac.uk/articles/10.1186/2047-2994-4-S1-P264
Burkholderia ambifaria Putative membrane protein|gentaur.comBurkholderia ambifaria Putative membrane protein|gentaur.com
Product information: Burkholderia ambifaria Putative membrane protein insertion efficiency factor BamMC406_3100 - Gentaur.com - Product info
https://gentaur.com/prod/burkholderia-ambifaria-putative-membrane-protein-insertion-efficiency-factor-bammc406_3100/mbs-recombinant/3498930472
Grasses of the BCEP - Butte Creek Ecological Preserve - CSU, ChicoGrasses of the BCEP - Butte Creek Ecological Preserve - CSU, Chico
collected off of dredge tailings in a recently opened oak/brush woodland, north-east portion of preserve. not usually collected below 2500 ...
http://www.csuchico.edu/bcep/species_lists/grasses.shtml
Scientific Articles - The International Burkholderia cepacia Working GroupScientific Articles - The International Burkholderia cepacia Working Group
Glowicz J, Crist M, Gould C, Moulton-Meissner H, Noble-Wang J, de Man TJB, Perry KA, Miller Z, Yang WC, Langille S, Ross J, Garcia B, Kim J, Epson E, Black S, Pacilli M, LiPuma JJ, Fagan R, B. cepacia Investigation Workgroup. 2018. A multistate investigation of health care-associated Burkholderia cepacia complex infections related to liquid docusate sodium contamination, January-October 2016. Am J Infect Control 46:649-655.. Brooks RB, Mitchell PK, Miller JR, Vasquez AM, Havlicek J, Lee H, Quinn M, Adams E, Baker D, Greeley R, Ross K, Daskalaki I, Walrath J, Moulton-Meissner H, Crist MB, Burkholderia cepacia Workgroup. 2018. Multistate Outbreak of Burkholderia cepacia Complex Bloodstream Infections After Exposure to Contaminated Saline Flush Syringes - United States, 2016-2017. Clin Infect Dis Off Publ Infect Dis Soc Am.. Becker SL, Berger FK, Feldner SK, Karliova I, Haber M, Mellmann A, Schäfers H-J, Gärtner B. 2018. Outbreak of Burkholderia cepacia complex infections associated with ...
https://ibcwg.org/index.php/home/publications/
Inhibition of co-colonizing cystic fibrosis-associated pathogens by Pseudomonas aeruginosa and Burkholderia multivorans. -...Inhibition of co-colonizing cystic fibrosis-associated pathogens by Pseudomonas aeruginosa and Burkholderia multivorans. -...
Cystic fibrosis (CF) is a recessive genetic disease characterized by chronic respiratory infections and inflammation causing permanent lung damage. Recurrent infections are caused by Gram-negative antibiotic-resistant bacterial pathogens such as Pseudomonas aeruginosa, Burkholderia cepacia complex (Bcc) and the emerging pathogen genus Pandoraea. In this study, the interactions between co-colonizing CF pathogens were investigated. Both Pandoraea and Bcc elicited potent pro-inflammatory responses that were significantly greater than Ps. aeruginosa. The original aim was to examine whether combinations of pro-inflammatory pathogens would further exacerbate inflammation. In contrast, when these pathogens were colonized in the presence of Ps. aeruginosa the pro-inflammatory response was significantly decreased. Real-time PCR quantification of bacterial DNA from mixed cultures indicated that Ps. aeruginosa significantly inhibited the growth of Burkholderia multivorans, Burkholderia cenocepacia, Pandoraea
https://www.semanticscholar.org/paper/Inhibition-of-co-colonizing-cystic-fibrosis-associ-Costello-Reen/2c45a238e56e4f8cf56e27343d3d1750f3d99154
Burkholderia cepacia complex - Infectious Disease and Antimicrobial AgentsBurkholderia cepacia complex - Infectious Disease and Antimicrobial Agents
1. Cystic Fibrosis Patient Registry, 2012 Annual Data Report Bethesda, MD: Cystic Fibrosis Foundation; 2013.. 2. Aaron SD, Ferris W, Henry DA, Speert DP, Macdonald NE. Multiple combination bactericidal antibiotic testing for patients with cystic fibrosis infected with Burkholderia cepacia. American journal of respiratory and critical care medicine 2000;161:1206-12. [PubMed]. 3. Aaron SD, Vandemheen KL, Ferris W, Fergusson D, Tullis E, Haase D, Berthiaume Y, Brown N, Wilcox P, Yozghatlian V, Bye P, Bell S, Chan F, Rose B, Jeanneret A, Stephenson A, Noseworthy M, Freitag A, Paterson N, Doucette S, Harbour C, Ruel M, MacDonald N. Combination antibiotic susceptibility testing to treat exacerbations of cystic fibrosis associated with multiresistant bacteria: a randomised, double-blind, controlled clinical trial. Lancet 2005;366:463-71. [PubMed]. 4. Avgeri SG, Matthaiou DK, Dimopoulos G, Grammatikos AP, Falagas ME. Therapeutic options for Burkholderia cepacia infections beyond co-trimoxazole: a ...
http://www.antimicrobe.org/b19.asp
Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...
In this study, we compare our results for a G. mellonella infection model with previously published BCC data from other infection models, taking care to use many of the identical BCC strains previously tested in order to ensure valid comparison. We observed that G. mellonella, as an infection model for the BCC, possessed several advantages over other infection models. Using G. mellonella, we obtained similar results to both mouse and other alternative infection models with identical BCC strains. In our experience, no other alternative infection models as tested were as sensitive, accurate (with respect to mice and rat lung model results), or as robust or simple to use as the G. mellonella model. This was despite the fact G. mellonella possesses a relatively complex innate immune response, which is lacking in plant infection models. Furthermore, due to ethical and regulatory issues, it is now difficult to perform LD50 experiments with mice. In addition, amoebae and C. elegans are somewhat more ...
https://iai.asm.org/content/76/3/1267?ijkey=55ffb420be3df92e84f74530906f85e6b3229fc4&keytype2=tf_ipsecsha
Pharmaceutical Microbiology Resources: Burkholderia cepacia - Risks in Context for Non-Sterile Pharmaceutical Products (Webinar)Pharmaceutical Microbiology Resources: Burkholderia cepacia - Risks in Context for Non-Sterile Pharmaceutical Products (Webinar)
Burkholderia cepacia complex (BCC) organisms can survive or multiply in a variety of non-sterile and water-based products because it is resistant to certain preservatives and antimicrobial agents. This makes the organism a risk in terms of non-sterile aqueous products. Detecting BCC bacteria is also a challenge and requires validated testing methods that take into consideration the unique characteristics of different BCC strains. This webinar discusses where the organism may be found, how to detect it and what to do if it is present in the manufacturing environment ...
https://www.pharmamicroresources.com/2018/09/burkholderia-cepacia-risks-in-context.html
lin protein (Burkholderia cepacia) - STRING interaction networklin protein (Burkholderia cepacia) - STRING interaction network
Other names: ATCC 25416, B. cepacia, Burkholderia cepacia, Burkholderia cepacia genomovar I, CCUG 12691, CCUG 13226, CFBP 2227, CIP 80.24, DSM 7288, ICMP 5796, IFO 14074, JCM 5964, NBRC 14074, NCCB 76047, NCPPB 2993, NCTC 10743, NRRL B-14810, Pseudomonas cepacia, Pseudomonas kingii, Pseudomonas multivorans, strain 717-ICPB 25, strain Ballard 717 ...
https://string-db.org/network/292.DM42_7161
WL94 09065 protein (Burkholderia cepacia) - STRING interaction networkWL94 09065 protein (Burkholderia cepacia) - STRING interaction network
Other names: ATCC 25416, B. cepacia, Burkholderia cepacia, Burkholderia cepacia genomovar I, CCUG 12691, CCUG 13226, CFBP 2227, CIP 80.24, DSM 7288, ICMP 5796, IFO 14074, JCM 5964, NBRC 14074, NCCB 76047, NCPPB 2993, NCTC 10743, NRRL B-14810, Pseudomonas cepacia, Pseudomonas kingii, Pseudomonas multivorans, strain 717-ICPB 25, strain Ballard 717 ...
https://string-db.org/network/292.DM42_3921
Down the sink: the local experience of a Burkholderia cenocepacia outbreak at the Canberra Hospital - 2021 ACIPC ConferenceDown the sink: the local experience of a Burkholderia cenocepacia outbreak at the Canberra Hospital - 2021 ACIPC Conference
Dr Heather Wilson1, Dr Karina Kennedy1, Ms Shannon Broadrick1, Ms Fiona Kimber1, Ms Wendy Beckingham1, Prof Peter Collignon1. 1Canberra Hospital And Health Services, Canberra, Australia. Introduction:. Burkholderia cenocepacia is an environmental organism and an unusual isolate from blood, although is a recognised cause of nosocomial outbreaks due to contamination of various fluids. B. cenocepacia bacteraemia in two patients in the Canberra Hospital ICU prompted an investigation into a common source.. Methods:. Clinical and epidemiological data were obtained from the patients medical records. Clinical and environmental specimens were cultured and identified by MALDI-TOF (Bruker). Further characterisation, using recA gene sequencing and whole genome sequencing, was performed at Queensland Pathology.. Results:. The finding that our two patients occupied the same bed within hours of having the blood cultures collected directed environmental testing of the area. B. cepacia complex was grown from a ...
https://www.acipcconference.com.au/3679
Hong Kong investigates invasive Burkholderia cepacia cluster - Outbreak News TodayHong Kong investigates invasive Burkholderia cepacia cluster - Outbreak News Today
The affected persons involved eight males and one female aged 46 to 69, who were admitted to Caritas Medical Centre from February 2017 to August 2018 respectively for management. Among them, seven were discharged, one remains hospitalized and one passed away in 2017.. The clinical diagnoses of the patients were infective spondylitis (4), sepsis (2), septic arthritis (2) and infective endocarditis (1).. Separately, the Burkholderia cepacia isolates from seven of the nine patients were found to be genetically identical upon laboratory testing.. Preliminary investigation revealed that all affected patients were people who injected drugs. Investigations are ongoing, a health department spokesman said.. Burkholderia cepacia is a bacteria which are commonly found in water, soil, and moist environments. It is generally not pathogenic to healthy person but those who have weakened immune system or chronic lung diseases may be more susceptible to infection with the bacteria.. The spokesman appealed that ...
http://outbreaknewstoday.com/hong-kong-investigates-invasive-burkholderia-cepacia-cluster-40830/
Burkholderia cepacia (Palleroni and Holmes) Yabuuchi et al. ATCC ®Burkholderia cepacia (Palleroni and Holmes) Yabuuchi et al. ATCC ®
Burkholderia cepacia ATCC ® 17616D-5™ Designation: Genomic DNA from Burkholderia cepacia strain 249 TypeStrain=False Application:
https://www.atcc.org/Products/All/17616D-5.aspx?p=1&rel=%7B0%7D
The intracellular behaviour of Burkholderia cenocepacia in murine macrophages by Jennifer S. TolmanThe intracellular behaviour of Burkholderia cenocepacia in murine macrophages by Jennifer S. Tolman
Burkholderia cenocepacia is an opportunistic pathogen causing life-threatening infections in cystic fibrosis and other immunocompromised patients. The bacterium survives within macrophages by interfering with typical endocytic trafficking, resulting in delayed maturation of a B. cenocepacia-containing phagosome. We hypothesize that B. cenocepacia alters gene expression after internalization by macrophages, inducing genes involved in intracellular survival and host adaptation. Furthermore, we hypothesize that specialized bacterial secretion systems are involved in the interactions between intracellular bacteria and macrophages. In this work, we characterize later-stage infection of macrophages by B. cenocepacia, showing replication within an acidified endosomal compartment suggestive of a phagolysosome. We examine differential gene expression by intracellular B. cenocepacia using selective capture of transcribed sequences (SCOTS) with both competitive enrichment and microarray analysis. We identified 766
https://ir.lib.uwo.ca/etd/338/
The unexpected discovery of a novel low-oxygen-activated locus for the anoxic persistence of Burkholderia cenocepacia -ORCAThe unexpected discovery of a novel low-oxygen-activated locus for the anoxic persistence of Burkholderia cenocepacia -ORCA
Burkholderia cenocepacia is a Gram-negative aerobic bacterium that belongs to a group of opportunistic pathogens displaying diverse environmental and pathogenic lifestyles. B. cenocepacia is known for its ability to cause lung infections in people with cystic fibrosis and it possesses a large 8 Mb multireplicon genome encoding a wide array of pathogenicity and fitness genes. Transcriptomic profiling across nine growth conditions was performed to identify the global gene expression changes made when B. cenocepacia changes niches from an environmental lifestyle to infection. In comparison to exponential growth, the results demonstrated that B. cenocepacia changes expression of over one-quarter of its genome during conditions of growth arrest, stationary phase and surprisingly, under reduced oxygen concentrations (6% instead of 20.9% normal atmospheric conditions). Multiple virulence factors are upregulated during these growth arrest conditions. A unique discovery from the comparative expression ...
http://orca.cf.ac.uk/45045/
Outcomes of lung transplantation for cystic fibrosis in a large UK cohort - Northumbria Research LinkOutcomes of lung transplantation for cystic fibrosis in a large UK cohort - Northumbria Research Link
Background: Lung transplantation is an important option to treat patients with advanced cystic fibrosis (CF) lung disease. The outcomes of a large UK cohort of CF lung transplantation recipients is reported.. Methods: Retrospective review of case notes and transplantation databases.. Results: 176 patients with CF underwent lung transplantation at our centre. The majority (168) had bilateral sequential lung transplantation. Median age at transplantation was 26 years. Diabetes was common pretransplantation (40%). Polymicrobial infection was common in individual recipients. A diverse range of pathogens were encountered, including the Burkholderia cepacia complex (BCC). The bronchial anastomotic complication rate was 2%. Pulmonary function (forced expiratory volume in 1 s % predicted) improved from a pretransplantation median of 0.8 l (21% predicted) to 2.95 l (78% predicted) at 1 year following transplantation. We noted an acute rejection rate of 41% within the first month. Our survival values were ...
http://nrl.northumbria.ac.uk/id/eprint/22151/
British Library EThOS: Antimicrobial strategies against Burkholderia cepaciaBritish Library EThOS: Antimicrobial strategies against Burkholderia cepacia
The aim of this project was to investigate novel antimicrobial strategies against B. cepacia, based on natural antimicrobial compounds present in plants and human airways as protection against bacterial disease. The project focused on a panel of 20 strains of B. cepacia complex. Isolates included strains representing major epidemic clones of B. cepacia and exhibiting a range of susceptibilities to all classes of conventional antibiotics. The project is focused on two major themes. First, a study of antimicrobials from plants and second, examination of the antimicrobial activities of cationic peptides present in human airway secretions. The susceptibility of the B. cepacia strain panel to plant extracts was investigated, in particular the activity of aqueous garlic extract (AGE) and thyme oil. The MIC of thyme oil for all 20 strains was found to be 0.01%. MICs of AGE ranged from 0.25%-3%. Killing curves suggesting that AGE produces a slow killing effect over a twenty four hour period, whereas ...
http://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.657471
Nurse Assist recalls I.V. Flush Syringes: Possibly linked to Burkholderia cepacia outbreak - Outbreak News TodayNurse Assist recalls I.V. Flush Syringes: Possibly linked to Burkholderia cepacia outbreak - Outbreak News Today
Nurse Assist voluntarily recalled its I.V. Flush Syringes after becoming aware of patients that developed Burkholderia cepacia bloodstream infections while receiving intravenous care using prepackaged saline flushes from Nurse Assist. Nurse Assist is notifying its distributors and customers via email, phone call, and certified mail. Customers will receive instructions for returning product. For freight collect shipping information, please contact the Customer Service Team at 1-800-649-6800 ext. 10.. Nurse Assist is actively investigating the possible link to the infections with the Food and Drug Administration, the U.S. Centers for Disease Control, and various state health departments to ensure that the products are safe for their intended use. Until an investigation can be completed, Nurse Assist urges all healthcare facilities with affected product to discontinue use and return the product to the supplier.. Consumers with questions may contact the company via telephone at 1-800-649-6800 ext. ...
http://outbreaknewstoday.com/nurse-assist-recalls-i-v-flush-syringes-possibly-linked-to-burkholderia-cepacia-outbreak-80147/
In Situ Hybridization of Burkholderia Cepacia CellsIn Situ Hybridization of Burkholderia Cepacia Cells
McNamara, Christopher J.; Leff, Laura Gunn (2002). In Situ Hybridization of Burkholderia Cepacia Cells. Humana Press 187-192. doi: 10.1385/1-59259-238-4:187. Retrieved from https://oaks.kent.edu/bscipubs/ ...
https://oaks.kent.edu/bscipubs/127
Complex bacterium writes new evolutionary story | EurekAlert! Science NewsComplex bacterium writes new evolutionary story | EurekAlert! Science News
A University of Queensland-led international study has discovered a new type of bacterial structure which has previously only been seen in more complex cells. Research team leader UQ School of Chemistry and Molecular Biosciences microbiologist Emeritus Professor John Fuerst said the study had found pore-like structures in a bacterium called Gemmata obscuriglobus.
https://www.eurekalert.org/pub_releases/2017-02/uoq-cbw013017.php
CiNii Articles - A cross-sectional study on the periodontal status and prevalence of red complex periodontal...CiNii Articles - A cross-sectional study on the periodontal status and prevalence of red complex periodontal...
p,This large-scale study cross-sectionally examined the periodontal status and prevalence of red complex bacteria (,i,Porphyromonas gingivalis,/i,, ,i,Treponema denticola,/i,, and ,i,Tannerella forsythia,/i,) in Japanese adults. A total of 977 participants were enrolled in the study. Probing depth (PD), bleeding on probing (BOP), and bone crest level (BCL) were recorded, and the presence of red complex bacteria in the saliva was examined using polymerase chain reaction. The mean BCL value and the percentage of sites with a PD ≥4 mm or the presence of BOP were significantly higher in older participants. The detection rates of ,i,P. gingivalis,/i,, ,i,T. denticola,/i,, and ,i,T. forsythia,/i, were 46.3%, 76.4%, and 61.1%, respectively. The ,i,P. ,i,gingivalis,/i, detection rate significantly increased with age, while those of ,i,T. denticola,/i, and ,i,T. forsythia,/i, were comparably high for all age groups. A close correlation between ,i,P. gingivalis,/i, and the percentage of sites with PD ...
https://ci.nii.ac.jp/naid/130007398364/en/
Burkholderia cepacia NCTC 10661 | TM Media - Titan Biotech Ltd.Burkholderia cepacia NCTC 10661 | TM Media - Titan Biotech Ltd.
A valid e-mail address. All e-mails from the system will be sent to this address. The e-mail address is not made public and will only be used if you wish to receive a new password or wish to receive certain news or notifications by e-mail ...
https://www.tmmedia.in/content/burkholderia-cepacia-nctc-10661
Lyme Disease TherapiesLyme Disease Therapies
Borellia burgdorferi, the cause of Lyme disease, is a complex bacteria. Our naturopaths have the expertise to plan strategic therapies for effective treatment.
https://www.nardellaclinic.com/naturopathic-therapies/lyme-disease-therapies/
10 brands of baby wipes recalled due to pneumonia-causing bacteria contamination | Reclaim Our Republic10 brands of baby wipes recalled due to pneumonia-causing bacteria contamination | Reclaim Our Republic
November 11, 2014 by: Julie Wilson staff writer (NaturalNews) Ten brands of baby wipes produced by the Pennsylvania-based Nutek Disposables, Inc., were recalled on October 25, 2014, following complaints of foul odor and discoloration. Upon further testing, the baby wipe and adult washcloth manufacturer discovered that some of their products contained Burkholderia cepacia, a…
https://reclaimourrepublic.wordpress.com/2017/01/30/10-brands-of-baby-wipes-recalled-due-to-pneumonia-causing-bacteria-contamination/
Survival curves for D. melanogaster infected with B. ce | Open-iSurvival curves for D. melanogaster infected with B. ce | Open-i
Survival curves for D. melanogaster infected with B. cenocepacia strains.Pricking assays were performed with a minimum of 30 flies for each strain. Statistical
https://openi.nlm.nih.gov/detailedresult.php?img=PMC2902503_pone.0011467.g002&req=4
perf-regression/margo-p2p-latency-avg-only.patch · 477c28bcc75f5800c32414b659ec142757c12e04 · sds / sds-tests · GitLabperf-regression/margo-p2p-latency-avg-only.patch · 477c28bcc75f5800c32414b659ec142757c12e04 · sds / sds-tests · GitLab
Test cases for the Mochi project. Includes regression tests that we may want to build separately from the actual Mochi components.
https://xgitlab.cels.anl.gov/sds/sds-tests/blob/477c28bcc75f5800c32414b659ec142757c12e04/perf-regression/margo-p2p-latency-avg-only.patch
OrnibactinOrnibactin
Coenye T, Vandamme P, Govan JR, LiPuma JJ (October 2001). "Taxonomy and identification of the Burkholderia cepacia complex". ... Speert DP (September 2002). "Advances in Burkholderia cepacia complex". Paediatric Respiratory Reviews. 3 (3): 230-5. doi: ... "Ornibactin production and transport properties in strains of Burkholderia vietnamiensis and Burkholderia cepacia (formerly ... LiPuma JJ (September 1998). "Burkholderia cepacia. Management issues and new insights". Clinics in Chest Medicine. 19 (3): 473- ...
https://en.wikipedia.org/wiki/Ornibactin
Povidone-iodinePovidone-iodine
Rose H, Baldwin A, Dowson CG, Mahenthiralingam E (March 2009). "Biocide susceptibility of the Burkholderia cepacia complex". ... The non-sterile form of Povidone iodine has a long history of intrinsic contamination with Burkholderia cepacia (aka ... These deficiencies were overcome by the discovery and use of PVP-I, in which the iodine is carried in a complexed form and the ... They carried out tests in vitro to demonstrate anti-bacterial activity, and found that the complex was less toxic in mice than ...
https://en.wikipedia.org/wiki/Povidone-iodine
Abdominal obesityAbdominal obesity
LiPuma JJ, Spilker T, Coenye T, Gonzalez CF (June 2002). "An epidemic Burkholderia cepacia complex strain identified in soil". ...
https://en.wikipedia.org/wiki/Abdominal_obesity
Claire WainwrightClaire Wainwright
"Factors Influencing Acquisition of Burkholderia Cepacia Complex Organisms in Patients with Cystric Fibrosis". Journal of ...
https://en.wikipedia.org/wiki/Claire_Wainwright
Cystic fibrosisCystic fibrosis
Lord R, Jones AM, Horsley A (April 2020). "Antibiotic treatment for Burkholderia cepacia complex in people with cystic fibrosis ... In addition, opportunistic infection due to Burkholderia cepacia complex can occur, especially through transmission from ... the effectiveness of antibiotics for pulmonary exacerbations in people with cystic fibrosis and Burkholderia cepacia complex or ... Eventually, Pseudomonas aeruginosa (and sometimes Burkholderia cepacia) dominates. By 18 years of age, 80% of patients with ...
https://en.wikipedia.org/wiki/Cystic_fibrosis
OsteomyelitisOsteomyelitis
The Burkholderia cepacia complex has been implicated in vertebral osteomyelitis in intravenous drug users. In general, ... Weinstein, Lenny; Knowlton, Christin A.; Smith, Miriam A. (2007-12-16). "Cervical osteomyelitis caused by Burkholderia cepacia ... The diagnosis of osteomyelitis is complex and relies on a combination of clinical suspicion and indirect laboratory markers ...
https://en.wikipedia.org/wiki/Osteomyelitis
O-linked glycosylationO-linked glycosylation
"A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence". ... Ribitol, xylose and glucuronic acid can be added to this structure in a complex modification that forms a long sugar chain. ... O-GlcNAcylation and phosphorylation can occur on the same threonine and serine residues, suggesting a complex relationship ... Glucosphingolipids, however, are often modified and can become a lot more complex. Biosynthesis of galacto- and ...
https://en.wikipedia.org/wiki/O-linked_glycosylation
Fusarium solaniFusarium solani
One particular method is the use of the bacterial complex Burkholderia cepacia, which is a registered control method. This ... However, a given species within the complex may not be as widespread and may not have the same ecology as others in the complex ... The current concept of F. solani is as a species complex consisting of multiple, closely related and morphologically poorly ... There is a proposed concept for the entire genus - widely subscribed by specialists - that would include this complex. However ...
https://en.wikipedia.org/wiki/Fusarium_solani
Walter H. BurkholderWalter H. Burkholder
Bacterial strains from the Burkholderia cepacia complex (Bcc) are opportunistic pathogens in humans with cystic fibrosis and ... Burkholderia cepacia:Friend or Foe? - Jennifer L. Parke Annual Review of Microbiology Annual Review of Phytopathology Some ... In 1950 he first described the bacteria, Pseudomonas cepacia, later Burkholderia spp., responsible for causing sour skin ... This complex of at least 9 closely related species or genomovars is currently the focus of research because of their remarkable ...
https://en.wikipedia.org/wiki/Walter_H._Burkholder
BCCBCC
... a defunct industry standards organization Burkholderia cepacia complex, a bacterial pathogen Business Controls Corporation, ...
https://en.wikipedia.org/wiki/BCC
List of MeSH codes (B03)List of MeSH codes (B03)
Burkholderia cepacia complex MeSH B03.440.400.425.251.100.110.500 - Burkholderia cepacia MeSH B03.440.400.425.251.100.355 - ... Burkholderia MeSH B03.660.075.077.100.110 - Burkholderia cepacia complex MeSH B03.660.075.077.100.110.500 - Burkholderia ... Burkholderia gladioli MeSH B03.440.400.425.251.100.477 - Burkholderia mallei MeSH B03.440.400.425.251.100.600 - Burkholderia ... Burkholderia gladioli MeSH B03.660.075.077.100.477 - Burkholderia mallei MeSH B03.660.075.077.100.600 - Burkholderia ...
https://en.wikipedia.org/wiki/List_of_MeSH_codes_(B03)
Human herpesvirus 6Human herpesvirus 6
... à Burkholderia cepacia complex chez un nourrisson révélant une granulomatose septique et une intégration génomique du virus HHV ... Lymphohistiocytic activation syndrome and Burkholderia cepacia complex infection in a child revealing chronic granulomatous ... first identified the gene product gQ1, a glycoprotein unique to HHV-6, and found that it forms a complex with gH and gL ... Soon thereafter, another glycoprotein named gQ2 was identified and found to be part of the gH/gL/gQ1 ligand complex, forming a ...
https://en.wikipedia.org/wiki/Human_herpesvirus_6
Kronisk granulomatøs sygdom, den frie encyklopædiKronisk granulomatøs sygdom, den frie encyklopædi
"Therefore, any patient of any age with a CGD type infection (Staphylococcus aureus, Burkholderia cepacia complex, Serratia ... "Any patient of any age with a CGD type infection (Staphylococcus aureus, Burkholderia cepacia complex, Serratia marcescens, ... "Any patient of any age with a CGD type infection (Staphylococcus aureus, Burkholderia cepacia complex, Serratia marcescens, ... "Any patient of any age with a CGD type infection (Staphylococcus aureus, Burkholderia cepacia complex, Serratia marcescens, ...
https://da.wikipedia.org/wiki/Kronisk_granulomatøs_sygdom
BurkholderiaBurkholderia
... is a genus of Proteobacteria whose pathogenic members include the Burkholderia cepacia complex, which attacks ... Burkholderia ambifaria Burkholderia anthina Burkholderia arboris Burkholderia cenocepacia Burkholderia cepacia Burkholderia ... Burkholderia dolosa Burkholderia gladioli Burkholderia glumae Burkholderia humptydooensis Burkholderia lata Burkholderia latens ... Burkholderia mallei Burkholderia metallica Burkholderia multivorans Burkholderia oklahomensis Burkholderia plantarii ...
https://en.wikipedia.org/wiki/Burkholderia
Burkholderia arborisBurkholderia arboris
and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex" (PDF). International Journal of ... B. arboris belongs to the Burkholderia cepacia complex. "J.P. Euzéby: List of bacterial names with standing in nomenclature". " ... "Burkholderia latens sp. nov., Burkholderia diffusa sp. nov., Burkholderia arboris sp. nov., Burkholderia seminalis sp. nov. ... Burkholderia arboris is a Gram-negative, aerobic, non-spore-forming bacterium of the genus Burkholderia and the family ...
https://en.wikipedia.org/wiki/Burkholderia_arboris
Burkholderia dolosaBurkholderia dolosa
... is a species of proteobacteria. It is a member of the Burkholderia cepacia complex. This particular strain ... Type strain of Burkholderia dolosa at BacDive - the Bacterial Diversity Metadatabase v t e. ... Missing or empty ,title= (help)CS1 maint: discouraged parameter (link) "Burkholderia dolosa". NCBI Taxonomy Browser. 152500. ...
https://en.wikipedia.org/wiki/Burkholderia_dolosa
Burkholderia territoriiBurkholderia territorii
"Burkholderia stagnalis sp. nov. and Burkholderia territorii sp. nov., two novel Burkholderia cepacia complex species from ... "Burkholderia stagnalis sp. nov. and Burkholderia territorii sp. nov., two novel Burkholderia cepacia complex species from ... Burkholderia territorii belongs to the Burkholderia cepacia complex. LSPN lpsn.dsmz.de UniProt De Smet, B; Mayo, M; Peeters, C ... Burkholderia territorii is a bacterium from the genus of Burkholderia. ...
https://en.wikipedia.org/wiki/Burkholderia_territorii
Burkholderia anthinaBurkholderia anthina
"Burkholderia anthina sp. nov. and Burkholderia pyrrocinia, two additional Burkholderia cepacia complex bacteria, may confound ... Burkholderia J.P. Euzéby: List of Prokaryotic names with Standing in Nomenclature "Burkholderia anthina". NCBI Taxonomy Browser ... Burkholderia anthina is a species of bacteria of the family Burkholderiaceae. Vandamme, Peter; Henry, Deborah; Coenye, Tom; ... Type strain of Burkholderia anthina at BacDive - the Bacterial Diversity Metadatabase v t e. ...
https://en.wikipedia.org/wiki/Burkholderia_anthina
Burkholderia metallicaBurkholderia metallica
and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex". Int. J. Syst. Evol. Microbiol. 58 ... "Burkholderia metallica". Peter Vandamme. "Identification of Burkholderia cepacia complex bacteria" (PDF). Archived from the ... "Burkholderia latens sp. nov., Burkholderia diffusa sp. nov., Burkholderia arboris sp. nov., Burkholderia seminalis sp. nov. ... a bacterium from the genus of Burkholderia and the family of Burkholderiaceae which belongs to the Burkholderia cepacia complex ...
https://en.wikipedia.org/wiki/Burkholderia_metallica
Burkholderia pyrrociniaBurkholderia pyrrocinia
"Burkholderia anthina sp. nov. and Burkholderia pyrrocinia, two additional Burkholderia cepacia complex bacteria, may confound ... "Polyphasic Characterisation of Burkholderia cepacia-Like Isolates Leading to the Emended Description of Burkholderia pyrrocinia ... "Burkholderia pyrrocinia". NCBI Taxonomy Browser. 60550. "Genus Burkholderia". List of Prokaryotic Names with Standing in ... Burkholderia pyrrocinia is a Gram-negative bacterium which has been found in soil as well as in the sputum of patients with ...
https://en.wikipedia.org/wiki/Burkholderia_pyrrocinia
Burkholderia pseudomultivoransBurkholderia pseudomultivorans
... belongs to the Burkholderia cepacia complex. LSPN lpsn.dsmz.de Straininfo of Burkholderia ... Burkholderia pseudomultivorans is a bacterium from the genus Burkholderia and the family Burkholderiaceae which was isolated ... UniProt Type strain of Burkholderia pseudomultivorans at BacDive - the Bacterial Diversity Metadatabase v t e. ... pseudomultivorans Srinivasan, S; Kim, J; Kang, S. R.; Jheong, W. H.; Lee, S. S. (2013). "Burkholderia humi sp. nov., isolated ...
https://en.wikipedia.org/wiki/Burkholderia_pseudomultivorans
Burkholderia seminalisBurkholderia seminalis
and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex". International Journal of ... bacterium from the genus of Burkholderia and the family of Burkholderiaceae which belongs to the Burkholderia cepacia complex ... "Burkholderia latens sp. nov., Burkholderia diffusa sp. nov., Burkholderia arboris sp. nov., Burkholderia seminalis sp. nov. ... "Burkholderia seminalis DSM 23518". UniProt. Retrieved 2 October 2015. Type strain of Burkholderia seminalis at BacDive - the ...
https://en.wikipedia.org/wiki/Burkholderia_seminalis
Burkholderia gladioliBurkholderia gladioli
... is closely related to, and often mistaken for, a member of the Burkholderia cepacia complex. This ... PubMed article on PCR identification of Burkholderia EMedicine overview of Burkholderia Type strain of Burkholderia gladioli at ... Burkholderia gladioli can be distinguished from the other Burkholderia because it is oxidase negative B. gladioli is indole ... Burkholderia gladioli has been identified as a plant pathogen in onions, gladiolus, iris, and together with Burkholderia glumae ...
https://en.wikipedia.org/wiki/Burkholderia_gladioli
Burkholderia latensBurkholderia latens
and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex". Int. J. Syst. Evol. Microbiol. 58 ... and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex". ijsb.sgmjournals.org. Archived ... "Burkholderia latens sp. nov., Burkholderia diffusa sp. nov., Burkholderia arboris sp. nov., Burkholderia seminalis sp. nov. ... "Burkholderia latens sp. nov., Burkholderia diffusa sp. nov., Burkholderia arboris sp. nov., Burkholderia seminalis sp. nov. ...
https://en.wikipedia.org/wiki/Burkholderia_latens
Burkholderia diffusaBurkholderia diffusa
and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex" (PDF). Int. J. Syst. Evol. ... "Burkholderia latens sp. nov., Burkholderia diffusa sp. nov., Burkholderia arboris sp. nov., Burkholderia seminalis sp. nov. ... bacterium from the genus of Burkholderia and the family of Burkholderiaceae which belongs to the Burkholderia cepacia complex ... doi:10.1099/ijs.0.65634-0. PMID 18599699.[permanent dead link] "hisA - ProFAR isomerase - Burkholderia diffusa - hisA gene & ...
https://en.wikipedia.org/wiki/Burkholderia_diffusa
Burkholderia contaminansBurkholderia contaminans
... bacterium from the genus of Burkholderia and the family of Burkholderiaceae and belongs to the Burkholderia cepacia complex, ... Rose, H.; Baldwin, A.; Dowson, C. G.; Mahenthiralingam, E. (2009). "Biocide susceptibility of the Burkholderia cepacia complex ... Burkholderia acidipaludis can cause biliary sepsis. "Genus Burkholderia". List of Prokaryotic Names with Standing in ... Type strain of Burkholderia contaminans at BacDive - the Bacterial Diversity Metadatabase v t e. ...
https://en.wikipedia.org/wiki/Burkholderia_contaminans
Burkholderia lataBurkholderia lata
... a complex within the Burkholderia cepacia complex, comprises at least two novel species, Burkholderia contaminans sp. nov. and ... a bacterium from the genus of Burkholderia and the family of Burkholderiaceae which belongs to the Burkholderia cepacia complex ... "Burkholderia lata Taxon Passport". StrainInfo. Retrieved 2013-06-12. "Burkholderia lata". Uniprot.org. Retrieved 2013-06-12. ... Type strain of Burkholderia lata at BacDive - the Bacterial Diversity Metadatabase v t e. ...
https://en.wikipedia.org/wiki/Burkholderia_lata
Burkholderia cenocepaciaBurkholderia cenocepacia
... is Burkholderia cenocepacia, a member of a bacterial group collectively referred to as the Burkholderia cepacia complex (Bcc ... doi:10.1038/s41586-020-2477-4 Lipuma J (2005). "Update on the Burkholderia cepacia complex". Curr Opin Pulm Med. 11 (6): 528-33 ... Mahenthiralingam E, Vandamme P (2005). "Taxonomy and pathogenesis of the Burkholderia cepacia complex". Chron Respir Dis. 2 (4 ... See also: Burkholderia thailandensis sRNA Originally defined as B. cepacia, the group has now been split into nine species, and ...
https://en.wikipedia.org/wiki/Burkholderia_cenocepacia
Burkholderia cepacia complexBurkholderia cepacia complex
... in the NCBI Taxonomy Browser Type strain of Burkholderia cepacia complex at BacDive, the Bacterial ... Burkholderia cepacia complex (BCC), or simply Burkholderia cepacia, is a group of catalase-producing, lactose-nonfermenting, ... Frost, F; Shaw, M; Nazareth, D (June 13, 2019). "Antibiotic therapy for chronic infection with Burkholderia cepacia complex in ... Barlasov J, Sutton S, Jakober R (April 29, 2014). "Recovery of Stressed (Acclimated) Burkholderia cepacia Complex Organisms". ...
https://en.wikipedia.org/wiki/Burkholderia_cepacia_complex
Urinary tract infectionUrinary tract infection
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Urinary_Tract_Infections
GonorrheaGonorrhea
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Gonorrhea
CholeraCholera
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ... The cholera toxin (CTX or CT) is an oligomeric complex made up of six protein subunits: a single copy of the A subunit (part A ... Upon binding, the complex is taken into the cell via receptor-mediated endocytosis. Once inside the cell, the disulfide bond is ... Researchers have discovered a complex cascade of regulatory proteins controls expression of V. cholerae virulence determinants. ...
https://en.wikipedia.org/wiki/Cholera
Bacillary dysenteryBacillary dysentery
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Bacillary_dysentery
ടൈഫോയ്ഡ് - വിക്കിപീഡിയടൈഫോയ്ഡ് - വിക്കിപീഡിയ
Burkholderia pseudomallei (Melioidosis) · Burkholderia mallei (Glanders) · Burkholderia cepacia complex · Bordetella pertussis/ ...
https://ml.wikipedia.org/wiki/ടൈഫോയ്ഡ്
Travelers diarrheaTraveler's diarrhea
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Montezuma's_Revenge_
ಜಠರ/ಜಠರೀಯ ಹುಣ್ಣು/ವ್ರಣ - ವಿಕಿಪೀಡಿಯಜಠರ/ಜಠರೀಯ ಹುಣ್ಣು/ವ್ರಣ - ವಿಕಿಪೀಡಿಯ
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://kn.wikipedia.org/wiki/ಜಠರ/ಜಠರೀಯ_ಹುಣ್ಣು/ವ್ರಣ
Meningococcal diseaseMeningococcal disease
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Meningococcemia
Chromobacteriosis infectionChromobacteriosis infection
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Chromobacteriosis_infection
Bubonic plagueBubonic plague
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Timeline_of_plague
BetaproteobacteriaBetaproteobacteria
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ... Other members of the class can infect plants, such as Burkholderia cepacia which causes bulb rot in onions as well as ...
https://en.wikipedia.org/wiki/Betaproteobacteria
List of infectious diseasesList of infectious diseases
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ... Burkholderia infection usually Burkholderia cepacia and other Burkholderia species Buruli ulcer Mycobacterium ulcerans ...
https://en.wikipedia.org/wiki/List_of_infectious_diseases
কলেরা - উইকিপিডিয়াকলেরা - উইকিপিডিয়া
Burkholderia pseudomallei (Melioidosis) · Burkholderia mallei (Glanders) · Burkholderia cepacia complex · Bordetella pertussis/ ...
https://bn.wikipedia.org/wiki/কলেরা
List of parasites of humansList of parasites of humans
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/List_of_parasites_of_humans
Klebsiella aerogenesKlebsiella aerogenes
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Enterobacter_aerogenes
Kronisk granulomatøs sygdom, den frie encyklopædiKronisk granulomatøs sygdom, den frie encyklopædi
"Therefore, any patient of any age with a CGD type infection (Staphylococcus aureus, Burkholderia cepacia complex, Serratia ... "Any patient of any age with a CGD type infection (Staphylococcus aureus, Burkholderia cepacia complex, Serratia marcescens, ... "Infection with Aspergillus, Burkholderia Cepacia, Serratia Marcescens, Nocardia should prompt work up for CGD". Chronic ... "Infection with Aspergillus, Burkholderia Cepacia, Serratia Marcescens, Nocardia should prompt work up for CGD". Chronic ...
https://da.m.wikipedia.org/wiki/Kronisk_Granulomatøs_Sygdom
Typhoid feverTyphoid fever
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Typhoid_Fever
Peptic ulcer diseasePeptic ulcer disease
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ... Prothrombin complex concentrates are preferred for severe bleeding. Recombinant factor VIIa is reserved for life-threatening ... For those who were under warfarin treatment, fresh frozen plasma (FFP), vitamin K, prothrombin complex concentrates, or ...
https://en.wikipedia.org/wiki/Peptic_ulcer_disease
Neisseria meningitidisNeisseria meningitidis
Burkholderia pseudomallei *Melioidosis. *Burkholderia mallei *Glanders. *Burkholderia cepacia complex. *Bordetella pertussis/ ...
https://en.wikipedia.org/wiki/Neisseria_meningitidis
Microbial symbiosis and immunityMicrobial symbiosis and immunity
"Influence of Pseudomonas aeruginosa Exoproducts on Virulence Factor Production in Burkholderia cepacia: Evidence of ... Mantis, N. J.; Rol, N.; Corthésy, B. (2011-11-01). "Secretory IgA's complex roles in immunity and mucosal homeostasis in the ... "The nisin-lipid II complex reveals a pyrophosphate cage that provides a blueprint for novel antibiotics". Nature Structural & ...
https://en.wikipedia.org/wiki/Microbial_symbiosis_and_immunity
The multifarious, multireplicon Burkholderia cepacia complex. - PubMed - NCBIThe multifarious, multireplicon Burkholderia cepacia complex. - PubMed - NCBI
The multifarious, multireplicon Burkholderia cepacia complex.. Mahenthiralingam E1, Urban TA, Goldberg JB. ... The Burkholderia cepacia complex (Bcc) is a collection of genetically distinct but phenotypically similar bacteria that are ... Burkholderia cepacia complex/genetics*. *Burkholderia cepacia complex/pathogenicity*. *Burkholderia cepacia complex/physiology ... cepacia syndrome, which is characterized by a rapid decline in lung function that can include invasive disease. Here we ...
https://www.ncbi.nlm.nih.gov/pubmed/15643431?dopt=Abstract
Burkholderia cepacia complex - WikipediaBurkholderia cepacia complex - Wikipedia
Burkholderia cepacia complex in the NCBI Taxonomy Browser Type strain of Burkholderia cepacia complex at BacDive, the Bacterial ... Burkholderia cepacia complex (BCC), or simply Burkholderia cepacia, is a group of catalase-producing, lactose-nonfermenting, ... Frost, F; Shaw, M; Nazareth, D (June 13, 2019). "Antibiotic therapy for chronic infection with Burkholderia cepacia complex in ... Barlasov J, Sutton S, Jakober R (April 29, 2014). "Recovery of Stressed (Acclimated) Burkholderia cepacia Complex Organisms". ...
https://en.wikipedia.org/wiki/Burkholderia_cepacia_complex
Burkholderia cepacia complex Cervical Osteomyelitis in an Intravenous Drug UserBurkholderia cepacia complex Cervical Osteomyelitis in an Intravenous Drug User
... we present a case of Burkholderia cepacia complex cervical osteomyelitis in an intravenous drug user. Burkholderia cepacia ... Burkholderia cepacia complex Cervical Osteomyelitis in an Intravenous Drug User. Sui Kwong Li1 and William B. Messer1,2 ... Burkholderia cepacia complex are closely related aerobic Gram-negative bacilli that are well described in infections among ... Burkholderia cepacia complex vertebral osteomyelitis is an infrequently described clinical syndrome in the literature though it ...
https://www.hindawi.com/journals/criid/2018/7638639/
Notice to Readers: Manufacturers Recall of Nasal Spray Contaminated with <I>Burkholderia cepacia<...Notice to Readers: Manufacturer's Recall of Nasal Spray Contaminated with <I>Burkholderia cepacia<...
... cepacia complex. Cases of B. cepacia complex infection or colonization associated with use of this product should be reported ... Notice to Readers: Manufacturers Recall of Nasal Spray Contaminated with Burkholderia cepacia Complex. ... of intrinsic contamination with Burkholderia cepacia complex. The nasal spray is distributed as Major Twice-A-Day 12 Hour ... Clinicians should be aware that patients using product from this lot number might have been exposed to B. cepacia complex. ...
https://www.cdc.gov/mmwr/preview/mmwrhtml/mm5311a8.htm
Burkholderia cepacia complex - microbewikiBurkholderia cepacia complex - microbewiki
... multireplicon Burkholderia cepacia complex." Nature. 3 Hua, C.N.C., Tokeshi, J. "Emergence of Burkholderia cepacia in Honolulu ... This is often referred to as the Burkholderia cepacia complex (BCC) [1][2]. It was originally recognized by W. H. Burkholder in ... Burkholderia cepacia complex. From MicrobeWiki, the student-edited microbiology resource. Revision as of 21:03, 10 February ... Burkholderia cepacia complex is a group of Gram-negative, non-spore forming bacilli composed of approximately 17 closely- ...
https://microbewiki.kenyon.edu/index.php?title=Burkholderia_cepacia_complex&oldid=119595
https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310
Environmental Burkholderia cepacia complex isolates in human infections.(DISPATCHES) by Emerging Infectious Diseases; Health ... cepacia+complex+isolates+in+human...-a0161011310. *APA style: Environmental Burkholderia cepacia complex isolates in human ... complex+isolates+in+human...-a0161011310,/a,. Citations: *MLA style: "Environmental Burkholderia cepacia complex isolates in ... complex+isolates+in+human...-a0161011310. *Chicago style: The Free Library. S.v. Environmental Burkholderia cepacia complex ...
https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310
Epidemiology of Burkholderia cepacia complex in patients with cystic fibrosis, CanadaEpidemiology of Burkholderia cepacia complex in patients with cystic fibrosis, Canada
The Burkholderia cepacia complex is an important group of pathogens in patients with cystic fibrosis (CF). Although evidence ... Epidemiology of Burkholderia cepacia complex in patients with cystic fibrosis, Canada Emerg Infect Dis. 2002 Feb;8(2):181-7. ... cepacia complex isolates from patients with CF from throughout Canada. A total of 905 isolates from the B. cepacia complex were ... The Burkholderia cepacia complex is an important group of pathogens in patients with cystic fibrosis (CF). Although evidence ...
https://pubmed.ncbi.nlm.nih.gov/11897071/?dopt=Abstract
Pathogenicity, virulence factors, and strategies to fight against Burkholderia cepacia complex pathogens and related species |...Pathogenicity, virulence factors, and strategies to fight against Burkholderia cepacia complex pathogens and related species |...
The Burkholderia cepaciacomplex (Bcc) is a group of 17 closely related species of the β-proteobacteria subdivision that emerged ... a complex within the Burkholderia cepacia complex comprises at least two novel species: Burkholderia contaminans sp. nov. and ... and Burkholderia metallica sp. nov., novel species within the Burkholderia cepacia complex. Int J Syst Evol Microbiol 58:1580- ... Saldías MS, Valvano MA (2009) Interactions of Burkholderia cenocepacia and other Burkholderia cepacia complex bacteria with ...
https://link.springer.com/article/10.1007%2Fs00253-010-2528-0
Taxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical MicrobiologyTaxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical Microbiology
2001) Burkholderia cepacia genomovar VI, a new member of the Burkholderia cepacia complex isolated from cystic fibrosis ... Burkholderia mallei, Burkholderia pseudomallei,Burkholderia gladioli, Burkholderia plantarii,Burkholderia glumae, Burkholderia ... cepacia genomovar I. Strains resembling B. cepacia may belong to the B. cepacia complex, to otherBurkholderia species (for ... Burkholderia vietnamiensis, Burkholderia multivorans, Burkholderia stabilis, and Burkholderia cepacia genomovars I and III. J. ...
https://jcm.asm.org/content/39/10/3427?ijkey=016117cc34c5b762756dd57266ee67d3be91427d&keytype2=tf_ipsecsha
JCI - Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia)JCI - Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia)
Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia). ... Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia). ... Salicylate is an important siderophore produced by B. cepacia complex isolates, and both extrinsic salicylate and iron ... and ciprofloxacin has been identified in Burkholderia cenocepacia (genomovar III), an important cystic fibrosis pathogen. Five ...
https://www.jci.org/articles/view/19710/table/6
Azithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.govAzithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.gov
Pulmonary infection with Burkholderia cepacia complex (BCC) in patients with CF is often associated with a more rapid decline ... Azithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex. The recruitment status of this study is unknown. ... Chronically Infected With Burkholderia Cepacia Complex. ...
https://clinicaltrials.gov/ct2/show/NCT00298922
Colonização por Burkholderia cepacia complex em pacientes com doença pulmonar supurativa...Colonização por Burkholderia cepacia complex em pacientes com doença pulmonar supurativa...
... a colonização por Burkholderia cepacia complex (BCC), sobretudo... ... Colonização por Burkholderia cepacia complex em pacientes com doença pulmonar supurativa submetidos ao transplante pulmonar: ... Burkholderia Cepacia Complex colonization in patients with suppurative lung disease undergoing lung transplantation: impact on ... a colonização por Burkholderia cepacia complex (BCC), sobretudo o genomovar III, vem sendo relacionada a pior prognóstico e, ...
https://www.teses.usp.br/teses/disponiveis/5/5156/tde-10032017-101928/pt-br.php
Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical MicrobiologyUpdated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical Microbiology
The Burkholderia cepacia complex consists of nine closely related species: Burkholderia cepacia genomovars I and VI, ... Burkholderia anthina sp. nov. and Burkholderia pyrrocinia, two additional Burkholderia cepacia complex bacteria, may confound ... Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel. Tom Coenye, Peter Vandamme, John J. LiPuma, John ... Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel. Tom Coenye, Peter Vandamme, John J. LiPuma, John ...
https://jcm.asm.org/content/41/6/2797.long
Epidemiology of Burkholderia cepacia complex colonisation in cystic fibrosis patients | European Respiratory SocietyEpidemiology of Burkholderia cepacia complex colonisation in cystic fibrosis patients | European Respiratory Society
Coeyne T, LiPuma JJ, Henry D, et al. Burkholderia cepacia genomovar VI, a new member of the Burkholderia cepacia complex ... Burkholderia cepacia complex colonisation rate is low and stable. Burkholderia multivorans and Burkholderia cenocepacia ... based diagnostic approaches for identification of Burkholderia cepacia complex, Burkholderia vietnamiensis, Burkholderia ... Epidemiology of Burkholderia cepacia complex colonisation in cystic fibrosis patients. K. De Boeck, A. Malfroot, L. Van Schil, ...
https://erj.ersjournals.com/content/23/6/851
Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from...Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from...
The treatment of cystic fibrosis (CF) patients chronically infected with Burkholderia cepacia complex (Bcc) bacteria requires ... Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from ... Burkholderia Infections/microbiology*. *Burkholderia cepacia complex/drug effects*. *Burkholderia cepacia complex/isolation & ... cepacia, B. multivorans, and B. stabilis. The results are consistent with the notion that CF Bcc isolates are resistant to the ...
https://www.ncbi.nlm.nih.gov/pubmed/18600352?ordinalpos=3&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_DefaultReportPanel.Pubmed_RVDocSum
Table 3 - Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous...Table 3 - Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous...
By using next-generation sequencing, we documented a polyclonal B. cepacia complex outbreak affecting peritoneal dialysis ... Environmental opportunistic pathogens, including B. cepacia complex, might be included in regular surveillance as indicator ... Whether Burkholderia cepacia complex should be an objectionable organism in antiseptic solutions with acceptable total ... Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous Chlorhexidine ...
https://wwwnc.cdc.gov/eid/article/26/9/19-1746-t3
Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous Chlorhexidine -...Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous Chlorhexidine -...
Burkholderia cepacia Workgroup. Burkholderia cepacia Workgroup. Multistate outbreak of Burkholderia cepacia complex bloodstream ... Marquez L, Jones KN, Whaley EM, Koy TH, Revell PA, Taylor RS, et al. An outbreak of Burkholderia cepacia complex infections ... Biocide susceptibility of the Burkholderia cepacia complex. J Antimicrob Chemother. 2009;63:502-10. DOIPubMedGoogle Scholar ... Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous Chlorhexidine ...
https://wwwnc.cdc.gov/eid/article/26/9/19-1746_article
Eurosurveillance | Outbreak of Burkholderia cepacia complex infections associated with contaminated octenidine mouthwash...Eurosurveillance | Outbreak of Burkholderia cepacia complex infections associated with contaminated octenidine mouthwash...
Whole-genome sequencing detected genetically identical B. cepacia complex strains in patient samples, from a batch of ... Three German patients developed nosocomial pneumonia after cardiac surgery and had Burkholderia cepacia complex detected in ... Outbreak of Burkholderia cepacia complex bacteremia in a chemotherapy day care unit due to intrinsic contamination of an ... Burkholderia cepacia complex infections: more complex than the bacterium name suggest. J Infect. 2018;77(3):166-70. https://doi ...
https://www.eurosurveillance.org/content/10.2807/1560-7917.ES.2018.23.42.1800540
PRIME PubMed | Management and outcomes of Burkholderia cepacia complex bacteremia in patients without cystic fibrosis: a...PRIME PubMed | Management and outcomes of Burkholderia cepacia complex bacteremia in patients without cystic fibrosis: a...
Management and outcomes of Burkholderia cepacia complex bacteremia in patients without cystic fibrosis: a retrospective ... Burkholderia cepacia complex outbreaks among non-cystic fibrosis patients in the intensive care units: A review of adult and ... N2 - Burkholderia cepacia complex (BCC) is an emerging pathogen of nosocomial infection in chronic or critically ill patients ... Burkholderia cepacia complex (BCC) is an emerging pathogen of nosocomial infection in chronic or critically ill patients ...
https://www.unboundmedicine.com/medline/citation/32583228/Management_and_outcomes_of_Burkholderia_cepacia_complex_bacteremia_in_patients_without_cystic_fibrosis:_a_retrospective_observational_study
Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia...Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia...
P. mesoacidophila ATCC 31433 clustered most closely with Burkholderia ubonensis within the Burkholderia cepacia complex (Fig. 1 ... The multifarious, multireplicon Burkholderia cepacia complex. Nat Rev Microbiol 3:144-156. doi:10.1038/nrmicro1085. ... MLST analysis revealed that strain ATCC 31433, rather than being a pseudomonad, is a member of the Burkholderia cepacia complex ... Differentiation of species combined into the Burkholderia cepacia complex and related taxa on the basis of their fatty acid ...
https://jb.asm.org/content/199/13/e00125-17
Biochemical and functional studies on the Burkholderia cepacia complex bceN gene, encoding a GDP-D-mannose 4,6-dehydratase. |...Biochemical and functional studies on the Burkholderia cepacia complex bceN gene, encoding a GDP-D-mannose 4,6-dehydratase. |...
Biochemical and functional studies on the Burkholderia cepacia complex bceN gene, encoding a GDP-D-mannose 4,6-dehydratase.. [ ... animal and plant pathogenic isolates of the Burkholderia cepacia complex species. Vmax and Km values of 1.5±0.2 µmol.min(-1).mg ... The lack of a functional bceN gene in a mutant derived from B. cepacia IST408 slightly reduced cepacian production. However, in ... This work reports the biochemical and functional analysis of the Burkholderia cenocepacia J2315 bceN gene, encoding a protein ...
https://www.sigmaaldrich.com/catalog/papers/23460819
Burkholderia cepacia complex - Infectious Disease and Antimicrobial AgentsBurkholderia cepacia complex - Infectious Disease and Antimicrobial Agents
... cepacia complex isolates should be performed at a reference laboratory.. PATHOGENESIS. B. cepacia complex form biofilms in ... cepacia complex species among the patient populations (41). In the few studies that compared B. cepacia complex isolates from ... cepacia complex (18, 75). Among 2,621 B. cepacia complex isolates from US cystic fibrosis patients, synergy was uncommon (range ... cepacia complex isolates are of increasing concern. In a study of 119 multidrug-resistant B. cepacia complex isolates from 59 ...
http://www.antimicrobe.org/b19.asp
Prevalence of Burkholderia cepacia complex species in cystic fibrosis patients in Argentina during the period 2011-2015 |...Prevalence of Burkholderia cepacia complex species in cystic fibrosis patients in Argentina during the period 2011-2015 |...
Taxon K, a complex within the Burkholderia cepacia complex, comprises at least two novel species, Burkholderia contaminans sp. ... DNA-Based diagnostic approaches for identification of Burkholderia cepacia complex, Burkholderia vietnamiensis, Burkholderia ... Burkholderia cepacia (B. cepacia) complex is composed of 20 phylogenetically closely related bacterial species. Some species ... The bacteria that comprise the Burkholderia cepacia (B. cepacia) complex are opportunistic pathogens capable of causing ...
https://www.elsevier.es/en-revista-enfermedades-infecciosas-microbiologia-clinica-english-428-articulo-prevalence-burkholderia-cepacia-complex-species-S2529993X1830131X
Outbreak of Burkholderia Cepacia Complex Bacteremia in a Chemotherapy Day Care Unit Due to Intrinsic Contamination of an...Outbreak of Burkholderia Cepacia Complex Bacteremia in a Chemotherapy Day Care Unit Due to Intrinsic Contamination of an...
Outbreak of Burkholderia Cepacia Complex Bacteremia in a Chemotherapy Day Care Unit Due to Intrinsic Contamination of an ... India developed Burkholderia cepacia complex (BCC) blood stream infection (BSI). Objective: The objectives were to identify the ... Burkholderia Infections / epidemiology* * Burkholderia Infections / microbiology * Burkholderia cepacia complex / isolation & ...
https://pubmed.ncbi.nlm.nih.gov/25560013/
Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...
Burkholderia cepacia complex bacteria are resistant to many common antibiotics and able to acquire resistance against many more ... Burkholderia cepacia complex infections present a significant challenge for people with cystic fibrosis and their clinicians. ... Infections dominated by organisms of the Burkholderia cepacia complex, a group of at least 18 closely-related species of gram- ... these cannot be extended to Burkholderia cepacia complex infections. This review, which is an update of a previous review, aims ...
http://www.cochrane.org/CD009529/CF_which-antibiotics-are-best-treat-worsening-symptoms-people-cystic-fibrosis-persistent-burkholderia
Allicin and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia...Allicin and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia...
... allicin was found have highly effective antimicrobial properties when used against Burkholderia cepacia complex (Bcc), a highly ... and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia complex. ... and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia complex. ... and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia complex. ...
https://www.rssl.com/news-and-events/food-e-news/2015/Edition-599/4-Allicin-and-allicin-containing-garlic-extracts
Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)
Regan KH, Bhatt J. Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis. Cochrane Database of ...
https://www.ecfs.eu/resource-article/cf-literature/eradication-therapy-burkholderia-cepacia-complex-people-cystic
Exposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmidExposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmid
... K Agnoli, S Schwager, S Uehlinger ... K. Agnoli et al., "Exposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmid," MOLECULAR ... The Burkholderia cepacia complex (Bcc) consists of 17 closely related species of opportunistic bacterial pathogens, which are ... 2011). Exposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmid. MOLECULAR MICROBIOLOGY, 83 ...
https://biblio.ugent.be/publication/8517112
Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...
Burkholderia cepacia genomovar VI, a new member of the Burkholderia cepacia complex isolated from cystic fibrosis patients. Int ... Burkholderia ambifaria sp. nov., a novel member of the Burkholderia cepacia complex including biocontrol and cystic fibrosis- ... We determined the LD50s of 23 strains within the Burkholderia cepacia complex. As shown in Table 1, B. cepacia and B. ... Epidemiology of Burkholderia cepacia complex in patients with cystic fibrosis, Canada. Emerg. Infect. Dis. 8:181-187. ...
https://iai.asm.org/content/76/3/1267?ijkey=55ffb420be3df92e84f74530906f85e6b3229fc4&keytype2=tf_ipsecsha
Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in...Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in...
Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in ... Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in ... Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in ... Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in ...
https://iai.asm.org/content/82/11/4729.abstract
SpeciesPseudomonasMultivoransStrainsIsolatesBacteriaPathogensInfectionsGenomovarMembers of the Burkholderia cepaciaMultireplicon Burkholderia cepaciaOutbreaksGenusAntibioticOrganismsVirulenceAmbifariaStrainMicrobiologySyndromeColonizationTaxonomyPeople with cystic fibrosisBacteremiaBacterialPathogenicNosocomialOutbreak of BurkholderiaPatientsPathogenesisChronicOrganismCenocepacia TAtl-371ClinicalGenomic2017PneumoniaAntimicrobialContaminationGenomovarsGenome of BurkholderiaEradication
Species68
  • The Burkholderia cepacia complex (Bcc) is a collection of genetically distinct but phenotypically similar bacteria that are divided into at least nine species. (nih.gov)
  • The species complex also attacks young onion and tobacco plants, and displays a remarkable ability to digest oil. (wikipedia.org)
  • Burkholderia cepacia complex is a group of Gram-negative, non-spore forming bacilli composed of approximately 17 closely-related species which are grouped into nine genomovars. (kenyon.edu)
  • The Burkholderia cepacia complex (Bcc) is a group of closely related gram-negative bacteria comprising at least 9 species (1). (thefreelibrary.com)
  • The 15 STs identified from environmental and clinical sources belonged to 6 different Bcc species (Table): B. cepacia (4 STs), B. multivorans (2 STs), B. cenocepacia (3 STs), B. stabilis (2 STs), B. vietnamiensis (2 STs), and B. ambifaria (2 STs). (thefreelibrary.com)
  • The Burkholderia cepacia complex (Bcc) is a group of 17 closely related species of the β-proteobacteria subdivision that emerged in the 1980s as important human pathogens, especially to patients suffering from cystic fibrosis. (springer.com)
  • Bylund J, Burgess LA, Cescutti P, Ernst RK, Speert D (2006) Exopolysaccharides from Burkholderia cenocepacia inhibit neutrophil chemotaxis and scavenge reactive oxygen species. (springer.com)
  • The name B. cepacia will relate only to B. cepacia genomovar I. Strains resembling B. cepacia may belong to the B. cepacia complex, to other Burkholderia species (for instance, Burkholderia gladioli ), or to species from other genera (for instance, Ralstonia pickettii ) that share some phenotypic or genotypic similarities with the B. cepacia complex. (asm.org)
  • Since its assembly, however, several additional species within the B . cepacia complex have been described, and therefore we propose to update the previously described panel. (asm.org)
  • Extensive taxonomic studies have revealed that this method allows species-level identification of a wide range of Gram-negative nonfermenting bacteria, commonly misidentified as Bcc, and confirms the identification of putative Bcc isolates at the complex level 14 , 15 . (ersjournals.com)
  • These isolates were previously genotyped and represent 11 different strains of the species B. cenocepacia (subgroups A and B), B. cepacia, B. multivorans, and B. stabilis. (nih.gov)
  • Burkholderia cepacia is the type species of the genus Burkholderia and is a ubiquitous multidrug-resistant, motile, non-glucose-fermenting, gram-negative organism found in water and soil ( 1 ). (cdc.gov)
  • This sugar nucleotide is the intermediary necessary for the biosynthesis of GDP-D-rhamnose, one of the sugar residues of cepacian, the major exopolysaccharide produced by environmental and human, animal and plant pathogenic isolates of the Burkholderia cepacia complex species. (sigmaaldrich.com)
  • B. cepacia complex species are obligate aerobic gram-negative rods that do not ferment glucose and are catalase positive. (antimicrobe.org)
  • Although B. cepacia complex strains are frequently isolated from the natural environment, common environmental species are infrequently associated with human infection. (antimicrobe.org)
  • Burkholderia cepacia ( B. cepacia ) complex is composed of 20 phylogenetically closely related bacterial species. (elsevier.es)
  • Infections dominated by organisms of the Burkholderia cepacia complex, a group of at least 18 closely-related species of gram-negative bacteria, are particularly difficult to treat. (cochrane.org)
  • The Burkholderia cepacia complex (Bcc) consists of 17 closely related species of opportunistic bacterial pathogens, which are particularly problematic for cystic fibrosis patients and immunocompromised individuals. (ugent.be)
  • Burkholderia is an important bacterial genus with a complex taxonomy that contains species of both ecological and pathogenic importance, including nine closely related species collectively termed the Burkholderia cepacia complex (BCC). (asm.org)
  • Members of the Burkholderia cepacia complex (BCC) are closely related bacterial species that can act as opportunistic pathogens primarily affecting patients with cystic fibrosis (CF) ( 17 , 33 ). (asm.org)
  • Parallel in vitro experiments examined the growth of two Bcc species, Burkholderia cenocepacia and Burkholderia multivorans , in environments similar to those occupied by P. aeruginosa in the CF lung. (asm.org)
  • AiiA lactonase, we show that expression of antifungal activities is AHL-dependent in the large majority of the investigated strains belonging to various Burkholderia species. (uzh.ch)
  • We demonstrate that in certain strains of Burkholderia ambifaria, Burkholderia pyrrocinia and Burkholderia lata, one of the QS-regulated antifungal agents is pyrrolnitrin (prn), a common broad-spectrum antibiotic that is also produced by some Pseudomonas and Serratia species. (uzh.ch)
  • Persons with cystic fibrosis (CF) are susceptible to chronic pulmonary infection due to certain Burkholderia species, but it is not clear whether this typically involves persistent infection with the same strain or sequential infection with distinct strains. (usu.edu)
  • Burkholderia cenocepacia is the most prominent species of the B. cepacia complex (Bcc), a group of nine closely related and difficult to identify bacteria that cause serious infections in patients with cystic fibrosis. (biomedcentral.com)
  • One of the most problematic infectious agents are the microorganisms belonging to the Burkholderia cepacia complex (Bcc), a group of nine closely related bacterial species initially designated as genomovars prior to their formal naming [ 2 ]. (biomedcentral.com)
  • Other species such as Burkholderia multivorans have also been associated with 'cepacia syndrome' (Blackburn et al, 2004) and some, such as Burkholderia dolosa appear as invasive in vitro as B. cenocepacia (Caraher et al, 2007). (cysticfibrosis.online)
  • The three insertion sequences were prevalent across the nine B. cepacia complex species, although IS 402 was absent from the 16 Burkholderia anthina strains tested and IS 407 was absent from all 10 Burkholderia pyrrocinia strains. (microbiologyresearch.org)
  • Diversity and significance of Burkholderia species occupying diverse ecological niches. (microbiologyresearch.org)
  • Actually the B. cepacia is subdivided in nine different genomic species that show morphological similarity, called genomovars. (bvsalud.org)
  • The Burkholderia cepacia complex (Bcc) species are important opportunistic pathogens with intrinsic antibiotic resistance. (warwick.ac.uk)
  • MALDI-TOF MS identified 2 species of Bcc (B. cenocepacia and B. cepacia). (cdc.gov)
  • BACKGROUND: Colonization with bacterial species from the Burkholderia cepacia complex (Bcc) is associated with fast health decline among individuals with cystic fibrosis. (inrs.ca)
  • The Burkholderia cepacia complex (Bcc) is a collection of closely related, genetically distinct, ecologically diverse species known to cause life-threatening infections in cystic fibrosis (CF) patients. (cdc.gov)
  • Burkholderia comprises more than 60 species of environmental, clinical, and agro-biotechnological relevance. (springer.com)
  • Previous phylogenetic analyses of 16S rRNA, recA , gyrB , rpoB , and acdS gene sequences as well as genome sequence comparisons of different Burkholderia species have revealed two major species clusters. (springer.com)
  • The group B comprises the B. cepacia complex (opportunistic human pathogens), the B. pseudomallei subgroup, which includes both human and animal pathogens, and an assemblage of plant pathogenic species. (springer.com)
  • However, it will be necessary to analyze the full set of Burkholderia species and explore whether enough phenotypic features exist among the different clusters to propose that these groups should be considered separate genera. (springer.com)
  • We aimed to establish the prevalence of different Burkholderia species among UK cystic fibrosis (CF) and non-CF patients over a 2 year period. (ovid.com)
  • The dominance of B. multivorans in CF, the presence of a B. cepacia cluster among non-CF patients and the existence of putative novel species all highlighted the continuing role of Burkholderia species as opportunistic pathogens. (ovid.com)
  • The Burkholderia cepacia complex (Bcc) is a collection of nine genotypically distinct but phenotypically similar species. (biomedcentral.com)
  • B. cenocepacia and all 9 species of the Bcc complex tested were able to make cyanide at comparable levels to P. aeruginosa , but only when grown surface attached as colonies or during biofilm growth on glass beads. (biomedcentral.com)
  • 5 ] when 128 B. cepacia strains were analysed by genetic and phenotypic means and found to fall into at least five genomic species or genomovars. (biomedcentral.com)
  • we used a polymerase chain reaction for coagulase‐nega tive staphylococci (CoNS) andBurkholderia cepacia complex (BCC) species identification. (medworm.com)
  • The Burkholderia cepacia complex (BCC) consists of at least 18 closely related, but distinct, species of bacteria. (cysticfibrosis.ca)
  • Burkholderia species have environmental, industrial and medical significance, and are important opportunistic pathogens in individuals with cystic fibrosis (CF). Using a combination of existing and newly determined genome sequences, this study investigated prophage carriage across the species B. vietnamiensis , and also isolated spontaneously inducible prophages from a reference strain, G4. (mdpi.com)
  • A novel, inducible Mu-like phage (vB_BvM-G4P1) was isolated from B. vietnamiensis G4 that had lytic activity against strains of five Burkholderia species prevalent in CF infections, including the Boston epidemic B. dolosa strain SLC6. (mdpi.com)
  • Different species Burkholderia and Achromobacter strains all demonstrated similar BiofilmReg operon structure. (hindawi.com)
  • The most commonly identified Bcc species in newly colonised patients, Burkholderia multivorans , continues to be acquired from the environment. (mdpi.com)
  • Proportion of sequence types (STs) within each Burkholderia cepacia complex (Bcc) species from clinical, environmental, or both sources. (cdc.gov)
  • The total number of STs examined for each B. cepacia species is in parentheses. (cdc.gov)
  • Phylogenetic analysis demonstrated that P. mesoacidophila ATCC 31433 is in fact a member of the Burkholderia cepacia complex, most closely related to the species Burkholderia ubonensis Further investigation of the classification and biosynthetic potential of P. mesoacidophila ATCC 31433 is warranted. (solent.ac.uk)
  • Fourteen proteins were reproducibly identified by two-dimensional gel electrophoresis from four Bcc strains representative of two Bcc species: Burkholderia cenocepacia, the most virulent, and B. multivorans, the most frequently acquired. (maynoothuniversity.ie)
  • Although this species has been identified as the most prevalent and pathogenic of the Burkholderia cepacia complex species in CF patients ( 14 ), relatively little is known about how it adapts to a biofilm lifestyle or to the CF lung environment ( 5 , 16 ). (pnas.org)
  • Chronic infection with Burkholderia cepacia complex species remains a significant problem for clinicians treating people with cystic fibrosis. (cochrane.org)
  • No studies looking at the eradication of Burkholderia cepacia complex species were identified. (cochrane.org)
  • The representative species of rice-pathogenic Burkholderia are Burkholderia glumae, B. gladioli, and B. plantarii , which primarily cause grain rot, sheath rot, and seedling blight, respectively, resulting in severe reductions in rice production. (biomedcentral.com)
  • Though Burkholderia rice pathogens cause problems in rice-growing countries, comprehensive studies of these rice-pathogenic species aiming to control Burkholderia -mediated diseases are only in the early stages. (biomedcentral.com)
  • Furthermore, we compared the genome of three rice Burkholderia pathogens with those of other Burkholderia species such as those found in environmental habitats and those known as animal/human pathogens. (biomedcentral.com)
  • The complete genome sequence of B. plantarii ATCC 43733 T and publicly available genomes of B. glumae BGR1 and B. gladioli BSR3 enabled comprehensive comparative genome analyses among three rice-pathogenic Burkholderia species responsible for tissue rotting and seedling blight. (biomedcentral.com)
  • It also, clarifies the unique features of rice pathogenic Burkholderia species relative to other animal and human Burkholderia species. (biomedcentral.com)
  • The genus Burkholderia contains over 40 species, which occupy diverse niches and are found in a range of environmental habitats, including soil and water, and even in the hospital setting. (biomedcentral.com)
  • Recently, increasing numbers of Burkholderia species have been reported as plant-associated bacteria. (biomedcentral.com)
  • Burkholderia species can be free-living in the plant rhizosphere, or can reside within plants as endophytes or symbionts. (biomedcentral.com)
  • Under the right environmental conditions, these three pathogenic Burkholderia species can cause severe damage to rice crops in various developmental stages. (biomedcentral.com)
  • In addition to occupying remarkably diverse niches, the genomes of Burkholderia species range greatly in size, from ~3.75 to 11.29 Mbp. (biomedcentral.com)
  • Burkholderia contaminans belongs to a group of closely related bacteria called the " Burkholderia cepacia complex" ("Bcc"), specifically within a subgroup of Bcc known as "Taxon K" or "Group K." Cells of this species are non-sporulating, aerobic, and Gram-negative rods that form moist, metallic colonies when plated. (kenyon.edu)
  • One problematic group, known as the Burkholderia cepacia complex, consists of a group of closely related species known to challenge preservative systems and contaminate consumer goods. (brighttalk.com)
Pseudomonas12
  • It was first isolated in patients with cystic fibrosis (CF) in 1977, when it was known as Pseudomonas cepacia. (wikipedia.org)
  • Burns JL, Jonas M, Chi EY, Clark DK, Berger A, Griffith A (1996) Invasion of respiratory epithelial cells by Burkholderia ( Pseudomonas ) cepacia . (springer.com)
  • Although evidence-based guidelines exist for treating respiratory exacerbations involving Pseudomonas aeruginosa, these cannot be extended to Burkholderia cepacia complex infections. (cochrane.org)
  • The localization of Burkholderia cepacia complex (Bcc) bacteria in cystic fibrosis (CF) lungs, alone or during coinfection with Pseudomonas aeruginosa , is poorly understood. (asm.org)
  • Burkholderia cepacia (formerly known as Pseudomonas cepacia , a gram-negative rod [GNR]) is associated with nosocomial infections among intensive care unit patients and use of contaminated equipment and solutions ( 1--4 ). (cdc.gov)
  • The non-sterile form of Povidone iodine has a long history of intrinsic contamination with Burkholderia cepacia (aka Pseudomonas cepacia ), and other opportunistic pathogens. (wikipedia.org)
  • In summary, this bioactive strain should be designated B. cepacia complex strain ATCC 31433, pending further detailed taxonomic characterization.IMPORTANCE This work reports the complete genome sequence of Pseudomonas mesoacidophila ATCC 31433, a known producer of bioactive compounds. (solent.ac.uk)
  • These mutations in turn were surprisingly well represented among mutations that evolved in cystic fibrosis isolates of both Burkholderia and Pseudomonas . (pnas.org)
  • My group has studied the pathogenesis and ecology of bacterial opportunistic pathogens, ranging from Pseudomonas aeruginosa to mycobacteria, with a major focus on Burkholderia cepacia complex bacteria. (cardiff.ac.uk)
  • Pseudomonas and Burkholderia bacteria cause devastating infections in people with cystic fibrosis and we have used molecular biology and genomic approaches to track their ability to spread between patients, resist killing by antibiotics and cause lung disease. (cardiff.ac.uk)
  • This is where I began to developing expertise in the cystic fibrosis microbiology, working on Pseudomonas aeruginosa and Burkholderia cepacia complex bacteria that cause devastating lung infections in these individuals. (cardiff.ac.uk)
  • The Pseudomonas vial (PD-109) with the supplement (S2-BCC-S) is specific for detecting the Burkholderia cepacia complex. (neogen.com)
Multivorans10
  • Burkholderia cepacia genomovars I and VI, Burkholderia multivorans (genomovar II), Burkholderia cenocepacia (genomovar III), Burkholderia stabilis (genomovar IV), Burkholderia vietnamiensis (genomovar V), Burkholderia ambifaria (genomovar VII), Burkholderia anthina (genomovar VIII), and Burkholderia pyrrocinia (genomovar IX) ( 2 , 9 , 10 ). (asm.org)
  • Burkholderia multivorans in 1999. (ersjournals.com)
  • IS 407 copies from six strains (two Burkholderia cenocepacia strains and one strain each of Burkholderia multivorans , Burkholderia stabilis , Burkholderia vietnamiensis and B. anthina ) were mapped to the genome using hemi-nested inverse PCR. (microbiologyresearch.org)
  • Cystic fibrosis outbreak strains (Burkholderia multivorans Glasgow strain and Burkholderia cenocepacia ET12) possessed elevated chlorhexidine resistance, and Bcc bacteria were also shown to remain viable in current commercial biocide formulations. (warwick.ac.uk)
  • Wright C, Leyden R, Murphy PV, Callaghan M, Velasco-Torrijos T, McClean S. Inhibition of Burkholderia multivorans Adhesion to Lung Epithelial Cells by Bivalent Lactosides. (mdpi.com)
  • Ubonodin inhibits RNA polymerase in vitro and has potent antimicrobial activity against several pathogenic members of the Burkholderia genus, most notably B. cepacia and B. multivorans , causative agents of lung infections in cystic fibrosis patients. (princeton.edu)
  • 119, Last updated, Version 2) XX DE Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence. (univ-lyon1.fr)
  • 167422 FT /organism="Burkholderia multivorans ATCC 17616" FT /plasmid="pBMUL01" FT /strain="ATCC 17616" FT /mol_type="genomic DNA" FT /db_xref="taxon:395019" FT gene complement(2. (univ-lyon1.fr)
  • The IST439 OAg biosynthetic gene cluster contains 7 of 23 genes that are closely homologous to genes found in B. multivorans , another member of the Burkholderia cepacia complex. (frontiersin.org)
  • The comprehensive product portfolio covers the full workflow requirements for all non-sterile pharmaceutical B. cepacia product testing requirements: prepared culture media, dehydrated culture media and supplements, quality control organisms including B.cenocepacia ATCC BAA-245 and B.multivorans ATCC BAA-247, along with a full range of diagnostic products. (thermofisher.com)
Strains14
  • Currently, it is not possible to determine strains of B. cepacia that can be safely used in agriculture without potentially harming humans, which causes discourse between the scientific and agricultural communities [4] . (kenyon.edu)
  • Results of typing by random amplified polymorphic DNA analysis or pulsed-field gel electrophoresis indicated that strains of B. cepacia complex from genomovar III are the most potentially transmissible and that the B. cepacia epidemic strain marker is a robust marker for transmissibility. (nih.gov)
  • Cardona ST, Wopperer J, Eberl L, Valvano MA (2005) Diverse pathogenicity of Burkholderia cepacia complex strains in the Caenorhabditis elegans host model. (springer.com)
  • This was confirmed by several studies ( 34 , 64 , 67 , 76 , 84 , 94 ) that showed that " B. cepacia " strains can spread between CF patients via simultaneous hospital admissions or social contact outside of the hospital. (asm.org)
  • B . cepacia complex strains have also attracted attention as possible biocontrol and bioremediation agents that could be used as antagonists of soil-borne plant pathogens, as plant growth-promoting agents, and for the bioremediation of various recalcitrant xenobiotics ( 3 , 8 ). (asm.org)
  • To aid in identification, epidemiological tracking, and virulence studies, a set of strains representative of the first five known genomovars of the B . cepacia complex was assembled ( 7 ). (asm.org)
  • Four B . cepacia genomovar VI strains are included in the panel. (asm.org)
  • Remarkable heterogeneity among presumed B. cepacia strains and the lack of reliable identification schemes makes correct identification of B. cepacia colonisation a complex problem 5 , 6 . (ersjournals.com)
  • Whole-genome sequencing detected genetically identical B. cepacia complex strains in patient samples, from a batch of octenidine mouthwash solution, which had been used for nursing care, as well as in samples obtained from the manufacturer during production. (eurosurveillance.org)
  • Transmission of B. cepacia complex among cystic fibrosis patients has been reduced in recent years by stringent infection prevention and control efforts, supported by the finding that the majority of new B. cepacia complex infections involve acquisition of unique strains likely from independent environmental sources ( 63 ). (antimicrobe.org)
  • Exposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmid," MOLECULAR MICROBIOLOGY , vol. 83, no. 2, pp. 362-378, 2011. (ugent.be)
  • Distribution of MICs of ceftolozane-tazobactam, ceftazidime, and meropenem for 221 Burkholderia strains. (asm.org)
  • To investigate whether there are differences between members of the Burkholderia cepacia complex in their ability to invade human respiratory epithelial cells, 11 strains belonging to genomovars I-V were studied in an antibiotic protection assay using the A549 cell line. (brad.ac.uk)
  • In this study, we undertook a multilocus sequence analysis of 77 type and reference strains of Burkholderia using atpD , gltB , lepA , and recA genes in combination with the 16S rRNA gene sequence and employed maximum likelihood and neighbor-joining criteria to test this further. (springer.com)
Isolates15
  • Environmental Burkholderia cepacia complex isolates in human infections. (thefreelibrary.com)
  • To identify microbial clones with enhanced transmissibility, we evaluated B. cepacia complex isolates from patients with CF from throughout Canada. (nih.gov)
  • it is therefore unclear to what category the presumed B. cepacia isolates described would belong. (asm.org)
  • Salicylate is an important siderophore produced by B. cepacia complex isolates, and both extrinsic salicylate and iron starvation appear to upregulate ceoR promoter activity, as does chloramphenicol. (jci.org)
  • All 11 Belgian health facilities caring for CF patients agreed to participate in the current study and to send all B. cepacia -like isolates to the reference laboratory between February 1999 and February 2000. (ersjournals.com)
  • Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from chronically infected cystic fi. (nih.gov)
  • Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from chronically infected cystic fibrosis patients: a five-year survey in the major Portuguese treatment center. (nih.gov)
  • B. cepacia complex isolates are frequently misidentified in the clinical laboratory by conventional manual biochemical or automated testing methods. (antimicrobe.org)
  • b Includes (number of isolates) Burkholderia contaminans (11), Burkholderia dolosa (10), Burkholderia ambifaria (9), and Burkholderia stabilis (9). (asm.org)
  • Contains data for a collection of isolates that represent the total known diversity of the Burkholderia cepacia complex. (pubmlst.org)
  • B. cepacia isolates from some patients and unopened sensor canisters were indistinguishable by pulsed field gel electrophoresis analysis at the Texas Department of Health laboratory. (cdc.gov)
  • This paper reports on how these patients perceive and manage the risk of cepacia infection using Douglas and Calvez's (1990) typology of four cultures of the community (the central community, dissenting enclaves, isolates, and individualists) and Douglas' works on pollution, risk, and culture. (sussex.ac.uk)
  • In all, 1047 Burkholderia isolates were submitted for identification from 361 CF patients and 112 non-CF patients, 25 from the hospital environment and three from a commercial company. (ovid.com)
  • MICs were determined for 161 Burkholderia cepacia complex (Bcc) isolates. (ovid.com)
  • In the beginning, some of the isolates were confirmed from the International B. cepacia Working group, Belgium. (who.int)
Bacteria20
  • Bcc bacteria are now recognized as important opportunistic pathogens that can cause variable lung infections in cystic fibrosis patients, which result in asymptomatic carriage, chronic infection or 'cepacia syndrome', which is characterized by a rapid decline in lung function that can include invasive disease. (nih.gov)
  • B. cepacia complex bacteria and organisms that may be confused with them will be altogether referred to as B. cepacia -like organisms. (asm.org)
  • The treatment of cystic fibrosis (CF) patients chronically infected with Burkholderia cepacia complex (Bcc) bacteria requires extensive and aggressive antibiotics therapy, exposing these bacteria to prolonged antibiotics-selective pressure. (nih.gov)
  • One group of bacteria that can infect the lungs of people with cystic fibrosis is called the Burkholderia cepacia complex. (cochrane.org)
  • We did not find any trials which compared groups of volunteers with exacerbations who were also infected with Burkholderia cepacia complex bacteria, who were given different treatments at random. (cochrane.org)
  • More research is needed to find out which treatments are best for improving lung function and survival and for reducing side effects and length of time spent in hospital for people infected with Burkholderia cepacia complex bacteria experiencing an exacerbation. (cochrane.org)
  • Burkholderia cepacia complex bacteria are resistant to many common antibiotics and able to acquire resistance against many more. (cochrane.org)
  • Burkholderia cepacia complex bacteria are opportunistic pathogens that cause respiratory tract infections in susceptible patients, mainly people with cystic fibrosis. (semanticscholar.org)
  • Burkholderia cenocepacia is a member of the B. cepacia complex (Bcc), a group of opportunistic bacteria that infect the airways of patients with cystic fibrosis (CF) and are extraordinarily resistant to almost all clinically useful antibiotics. (microbiologyresearch.org)
  • Infections in CF patients with Bcc bacteria generally lead to a more rapid decline in lung function, and in some cases to the 'cepacia syndrome', a virtually deadly exacerbation of the lung infection with systemic manifestations. (microbiologyresearch.org)
  • While Burkholderia cepacia complex (Bcc) is one of the least prevalent bacteria causing infections among CF patients, it is one of the most dangerous. (informa.com)
  • Our obsession with bacteria from the Burkholderia cepacia complex started in the early 1990s. (cf.ac.uk)
  • The Burkholderia cepacia complex ( Bcc ) bacteria are opportunistic pathogens which cause nosocomial infections and are especially dangerous for cystic fibrosis (CF) patients. (hindawi.com)
  • Multiple sequence alignment & phylogram with closely related sequence accessions using MEGA Software revealed this naturally occurring biocontrol bacteria belongs to Burkholderia cepacia complex genomovar I based on the Biolog identification system with 16S rDNA gene sequence analysis. (scirp.org)
  • For example, our recent discovery that Burkholderia bacteria can produce novel polyketide antibiotics that target multidrug resistant bacterial infections is very exciting. (cardiff.ac.uk)
  • We are pleased to announced the forthcoming publication of a second book on Burkholderia bacteria: "Burkholderia: from genomes to function" which can be previewed at Horizon Press ( http://www.horizonpress.com/burk2 ). (cardiff.ac.uk)
  • While Burkholderia bacteria and cystic fibrosis microbiology remain major research foci, my interests are still wide and I am always getting involved in lots of very interesting molecular microbiology projects. (cardiff.ac.uk)
  • In the last few years, we made a very exciting discovery that the Burkholderia bacteria I had studied as pathogens, also make some very potent antibiotics which kill other multidrug resistant bacteria and fungi. (cardiff.ac.uk)
  • In addition to human and animal diseases, bacteria of the genus Burkholderia can cause plant diseases. (biomedcentral.com)
  • The other major group of Burkholderia human pathogens is B. cepacia complex bacteria, which are associated with severe infections in individuals with cystic fibrosis. (biomedcentral.com)
Pathogens6
  • The Burkholderia cepacia complex is an important group of pathogens in patients with cystic fibrosis (CF). Although evidence for patient-to-patient spread is clear, microbial factors facilitating transmission are poorly understood. (nih.gov)
  • Environmental opportunistic pathogens, including B. cepacia complex, might be included in regular surveillance as indicator organisms for monitoring environmental contamination. (cdc.gov)
  • Members of the genus Burkholderia are known for their ability to suppress soil-borne fungal pathogens by the production of various antibiotic compounds. (uzh.ch)
  • The risk of infection for cystic fibrosis patients from Burkholderia cepacia complex pathogens is of increasing concern to doctors and scientists. (sussex.ac.uk)
  • PCR-based detection and identification of Burkholderia cepacia complex pathogens in sputum from cystic fibrosis patients. (qub.ac.uk)
  • Burkholderia contaminans , like other members of the Burkholderia cepacia complex, are considered to be opportunistic pathogens with generally low virulence, but a large range of virulence factors. (kenyon.edu)
Infections20
  • Although co-trimoxazole has been generally considered the drug of choice for B. cepacia infections, ceftazidime, doxycycline, piperacillin, and meropenem are considered to be viable alternative options in cases where co-trimoxazole cannot be administered because of hypersensitivity reactions, intolerance, or resistance. (wikipedia.org)
  • Patients with underlying lung disease (especially cystic fibrosis) might be at increased risk for severe infections with B. cepacia complex. (cdc.gov)
  • Members of the Burkholderia cepacia complex (Bcc), found in many environments, are associated with clinical infections. (thefreelibrary.com)
  • B. cepacia " can also cause lung infections in chronic granulomatous disease patients, and infections in these patients are associated with pneumonia and septicemia and are often lethal ( 2 , 58 , 72 , 96 ). (asm.org)
  • B. cepacia " infections in immunocompetent patients occur only sporadically, but several cases of pseudoepidemics and nosocomial infections, often caused by contaminated disinfectants and anesthetic solutions, have been reported ( 3 , 43 , 50 , 107 ). (asm.org)
  • Despite the advances that have been made in the understanding of the epidemiology, " B. cepacia " infections still have a considerable impact on morbidity and mortality in CF patients ( 18 , 61 , 62 , 63). (asm.org)
  • Despite the advances that have been made in the understanding of the taxonomy and epidemiology of this group, infections of the respiratory tract with B . cepacia complex organisms still have a considerable impact on morbidity and mortality in cystic fibrosis (CF) patients ( 4 , 5 , 6 ). (asm.org)
  • Sfeir MM . Burkholderia cepacia complex infections: more complex than the bacterium name suggest. (eurosurveillance.org)
  • An outbreak of Burkholderia cepacia complex infections associated with contaminated liquid docusate. (eurosurveillance.org)
  • A multistate investigation of health care-associated Burkholderia cepacia complex infections related to liquid docusate sodium contamination, January-October 2016. (eurosurveillance.org)
  • Burkholderia cepacia complex infections present a significant challenge for people with cystic fibrosis and their clinicians. (cochrane.org)
  • Most troublesome is the fact that lung infections with BCC can culminate in a rapidly fatal condition in which patients develop a progressive, necrotizing pneumonia and sepsis commonly referred to as "cepacia syndrome" ( 23 ). (asm.org)
  • Burkholderia cepacia has been described as a cause of opportunist infections in patients with immune deficiency because of the high transmission rates. (bvsalud.org)
  • BACKGROUND: The Burkholderia cepacia complex (BCC) and Stenotrophomonas maltophilia are closely related groups of non-fermenting gram-negative bacilli (NFGNBs) having a similar spectrum of infections ranging from superficial to deep-seated and disseminated infections. (who.int)
  • Presently, Bcc eradication is complex and, in most cases, impossible, which leads to chronic infections in the lungs of CF patients. (hindawi.com)
  • Members of the Burkholderia cepacia complex (Bcc) cause chronic opportunistic lung infections in people with cystic fibrosis (CF), resulting in a gradual lung function decline and, ultimately, patient death. (maynoothuniversity.ie)
  • In this environment, we studied adaptation by a soil isolate of Burkholderia cenocepacia , an opportunistic pathogen responsible for fatal biofilm-associated lung infections in CF patients ( 14 , 15 ). (pnas.org)
  • Burkholderia cenocepacia is an opportunistic pathogen associated with chronic lung infections and increased risk of death in patients with cystic fibrosis (CF). In this work, we investigated the lipopolysaccharide (LPS) of clinical variants of B. cenocepacia that were collected from a CF patient over a period of 3.5 years, from the onset of infection until death by necrotizing pneumonia (cepacia syndrome). (frontiersin.org)
  • To identify whether treatment of Burkholderia cepacia complex infections can achieve eradication, or if treatment can prevent or delay the onset of chronic infection. (cochrane.org)
  • Randomised or quasi-randomised studies in people with cystic fibrosis of antibiotics or alternative therapeutic agents used alone or in combination, using any method of delivery and any treatment duration, to eradicate Burkholderia cepacia complex infections compared to another antibiotic, placebo or no treatment. (cochrane.org)
Genomovar4
  • An antibiotic efflux gene cluster that confers resistance to chloramphenicol, trimethoprim, and ciprofloxacin has been identified in Burkholderia cenocepacia (genomovar III), an important cystic fibrosis pathogen. (jci.org)
  • INTRODUÇÃO: Em contraste aos bons resultados do transplante pulmonar no tratamento de pacientes com doença supurativa pulmonar avançada, a colonização por Burkholderia cepacia complex (BCC), sobretudo o genomovar III, vem sendo relacionada a pior prognóstico e, por conseguinte, uma contraindicação ao procedimento em alguns centros transplantadores. (usp.br)
  • INTRODUCTION: Notwithstanding the good results of lung transplantation for treatment of patients with advanced lung suppurative disease, colonization by Burkholderia cepacia complex (BCC), especially genomovar III has been related to a worse prognosis in these patients and therefore contraindication to the procedure certain centers. (usp.br)
  • Although the clinician is faced with an increasingly complex nomenclature for Bcc, it is important to remember that the genomovar classification alone cannot predict clinical outcome in any individual patient. (cysticfibrosis.online)
Members of the Burkholderia cepacia2
  • At the beginning of this review it is essential to clarify the terminology that will be used to refer to the members of the Burkholderia cepacia complex and their relatives. (asm.org)
  • Discovery of ubonodin, an antimicrobial lasso peptide active against members of the Burkholderia cepacia complex. (princeton.edu)
Multireplicon Burkholderia cepacia1
  • The multifarious, multireplicon Burkholderia cepacia complex. (nih.gov)
Outbreaks5
  • In the 1980s, outbreaks of B. cepacia in individuals with CF were associated with a 35% death rate. (wikipedia.org)
  • B. cepacia complex can survive for long periods in water or disinfectants, and healthcare-associated outbreaks of B. cepacia complex infection have been linked to contaminated nebulized and intravenous medications and solutions, including compounded and commercially distributed products, skin care products, disinfectants, and to inadequate disinfection of reusable medical devices ( 20 , 47 , 49 , 58 ). (antimicrobe.org)
  • Background: Burkholderia cepacia complex (Bcc) has caused healthcare-associated outbreaks, often in association with contaminated products. (cdc.gov)
  • Burkholderia cepacia complex outbreaks are associated with poor outcomes and sustained mortality rates. (lww.com)
  • We report 2 consecutive outbreaks of the Burkholderia cepacia complex (Bcc) in an intensive care unit (ICU) and describe its characteristics and consequences. (cdc.gov)
Genus3
  • Burkholderia genus in 1992 on the basis of phenotypic characteristics, 16S rRNA sequences, DNA-DNA homology values, and cellular lipid and fatty acid composition [2] . (kenyon.edu)
  • The phylogenetic analysis revealed, with high supporting values, distinct lineages within the genus Burkholderia . (springer.com)
  • The distinct lineages present in Burkholderia suggest that each group might represent a different genus. (springer.com)
Antibiotic9
  • Burkholderia cepacia complex vertebral osteomyelitis has been infrequently described in the literature thus far with varied antibiotic treatment regimens. (hindawi.com)
  • There have been scarce case reports of Burkholderia cepacia complex vertebral osteomyelitis in the literature [ 6 - 8 ], and antibiotic therapy has been historically varied. (hindawi.com)
  • Caraher E, Reynolds G, Murphy P, McClean S, Callaghan M (2007) Comparison of antibiotic susceptibility of Burkholderia cepacia complex organisms when grown planktonically or as biofilm in vitro. (springer.com)
  • Multicentre randomised clinical trials are needed to assess the effectiveness of different antibiotic regimens in people with cystic fibrosis infected with organisms of the Burkholderia cepacia complex. (cochrane.org)
  • To assess the effectiveness and safety of different antibiotic regimens in people with cystic fibrosis experiencing an exacerbation and chronically infected with organisms of the Burkholderia cepacia complex. (cochrane.org)
  • In a study carried out by the University of Edinburgh, allicin was found have highly effective antimicrobial properties when used against Burkholderia cepacia complex (Bcc), a highly antibiotic resistant bacterium which since the 1980's has been identified as a serious and transmissible infection risk, with particular impact on those suffering from cystic fibrosis. (rssl.com)
  • The optimum antibiotic treatment for 'cepacia syndrome' remains unclear and mortality unfortunately remains very high. (cysticfibrosis.online)
  • Potential of metabolomics to reveal Burkholderia cepacia complex pathogenesis and antibiotic resistance. (cdc.gov)
  • We reviewed the evidence for antibiotic treatment to cure early infection with Burkholderia cepacia complex in people with cystic fibrosis and prevent it becoming permanent. (cochrane.org)
Organisms3
  • Susceptible persons can acquire B. cepacia organisms through person-to-person contact, contact with contaminated surfaces, and exposure to it in the enviroment (i.e. soil and water) [6] . (kenyon.edu)
  • Of these, BCSA agar is the most useful in supporting the growth of B. cepacia complex and suppressing the growth of other organisms. (antimicrobe.org)
  • Randomised and quasi-randomised controlled trials of treatments for exacerbations of pulmonary symptoms in people with cystic fibrosis chronically infected with organisms of the Burkholderia cepacia complex. (cochrane.org)
Virulence6
  • Bernier SP, Silo-Suh L, Woods DE, Ohman DE, Sokol PA (2003) Comparative analysis of plant and animal models for characterization of Burkholderia cepacia virulence. (springer.com)
  • Bernier SP, Nguyen DT, Sokol PA (2008) A LysR-type transcriptional regulator in Burkholderia cenocepacia influences colony morphology and virulence. (springer.com)
  • In order to more thoroughly investigate the virulence of this bacterial complex of microorganisms, alternative infection models would be useful. (asm.org)
  • Burkholderia cepacia complex: virulence characteristics, importance and relationship with cystic fibrosis. (bvsalud.org)
  • No correlation between invasiveness and other putative virulence factors of importance in B. cepacia infection in individuals with cystic fibrosis, cable pilus and B. cepacia epidemic strain marker was identified. (brad.ac.uk)
  • In cystic fibrosis epidemic Burkholderia cenocepacia strain J2315, we identified a unique TAA (BCAM0224)-encoding gene, previously described as being implicated in virulence. (asm.org)
Ambifaria3
  • Genome mining identifies cepacin as a plant-protective metabolite of the biopesticidal bacterium Burkholderia ambifaria. (pacb.com)
  • We applied phylogeny-led genome mining, metabolite analyses and biological control assays to define the efficacy of Burkholderia ambifaria, a naturally beneficial bacterium with proven biocontrol properties but potential pathogenic risk. (pacb.com)
  • For free-living, soil-borne Burkholderia ambifaria , genomic similarities responded to most of the spatial scales that the experimental sampling scheme could reveal, despite limited dispersal of the individuals. (pnas.org)
Strain5
  • A review of the literature reveals that this panel has been used extensively in various areas of research (for a complete list of publications using this panel, see http://go.to/cepacia and follow the link to B . cepacia experimental strain panel). (asm.org)
  • Burkholderia cepacia Complex in Cystic Fibrosis: Frequency of Strain R" by Scott A. Bernhardt, Theodore Spilker et al. (usu.edu)
  • Overall, a change in infecting strain was found in 24 (6.9%) of 347 patients infected with Burkholderia cepaciacomplex and in 3 (9%) of 32 patients infected with Burkholderia gladioli.Several patients were likely coinfected, at least transiently, with >1 B. cepacia complex strain. (usu.edu)
  • Draft Genome of Burkholderia cenocepacia TAtl-371, a Strain from the Burkholderia cepacia Complex Retains Antagonism in Different Carbon and Nitrogen Sources. (pacb.com)
  • OS Burkholderia cenocepacia (strain MC0-3). (univ-lyon1.fr)
Microbiology2
  • The book was edited by Tom Coenye and myself and serves as an excellent update to the highly successful first book: "Burkholderia: molecular microbiology and genomics" ( http://www.horizonpress.com/backlist/horizonbioscience/burk.html ). (cardiff.ac.uk)
  • These episodes are probably related to a complex relationship between host defence and airway microbiology that impacts on sputum production and airflow obstruction. (bmj.com)
Syndrome5
  • Pulmonary colonization of B. cepacia can cause accelerated decline in lung funtions and cause "cepacia syndrome," which is a progressive pneumonic illness that is fatal and essentially untreatable [4] . (kenyon.edu)
  • documented the increasing prevalence of " B. cepacia " colonization and infection in the Toronto, Canada, CF treatment center and described the so-called "cepacia syndrome," a severe progressive respiratory failure with bacteremia that occurs in about 20% of all infected CF patients. (asm.org)
  • Burkholderia cepacia infection is much less common, but it is notorious for being associated with cross infection and the possibility of rapid deterioration, known as the cepacia syndrome 2 - 4 . (ersjournals.com)
  • and the "cepacia" syndrome with persistently positive blood cultures and death. (antimicrobe.org)
  • Today, B. cepacia complex is a very important problem for the acquired immunodeficiency syndrome and cystic fibrosis patients. (bvsalud.org)
Colonization3
  • Cases of B. cepacia complex infection or colonization associated with use of this product should be reported to the local or state health department and CDC, telephone 800-893-0485. (cdc.gov)
  • The first detailed description of the clinical significance of " B. cepacia " colonization and infection was published in 1984 ( 47 ). (asm.org)
  • Clustering of new cases in some centers and the decrease of colonization of new patients following segregation of colonized and noncolonized patients in other centers suggested that " B. cepacia " could be transmitted between CF patients. (asm.org)
Taxonomy1
  • For microbiologists, hospital infection control officers, caregivers, and most of all the CF community, the changes in our understanding of the taxonomy, epidemiology and pathogenesis of the bacterium 'B. cepacia' are complex. (cf.ac.uk)
People with cystic fibrosis5
  • Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia complex lung infection? (cochrane.org)
  • One of these bugs, Burkholderia cepacia , causes a lot of problems for people with cystic fibrosis because it is very difficult to treat and makes their lung disease deteriorate faster than it otherwise would. (cochrane.org)
  • We looked for studies of treatments which could eliminate Burkholderia cepacia from the lungs of people with cystic fibrosis. (cochrane.org)
  • This review highlights an urgent need for more research into new ways of treating long-term Burkholderia cepacia infection in people with cystic fibrosis. (cochrane.org)
  • This review aims to examine the current treatment options for people with cystic fibrosis with acute infection with Burkholderia cepacia complex and to identify an evidence-based strategy that is both safe and effective. (cochrane.org)
Bacteremia2
  • Burkholderia cepacia complex (BCC) is an emerging pathogen of nosocomial infection in chronic or critically ill patients without cystic fibrosis (CF). The objective was to evaluate the management and outcomes of BCC bacteremia in patients without CF. We conducted a retrospective study of non-CF adult patients with BCC bacteremia between January 1997 and December 2016 at 4 tertiary hospitals in South Korea. (unboundmedicine.com)
  • Outbreak of Burkholderia cepacia bacteremia traced to contaminated hospital water used for dilution of an alcohol skin antiseptic. (cdc.gov)
Bacterial4
  • Whether Burkholderia cepacia complex should be an objectionable organism in antiseptic solutions with acceptable total bacterial counts is controversial. (cdc.gov)
  • Originally described by Burkholder as a causative agent of bacterial rot of onion bulbs (Latin, cepacia = onion). (unboundmedicine.com)
  • The objective of this review is to describe Burkholderia cepacia as a bacterial complex with high pathogenicity and variability of habitats. (bvsalud.org)
  • The activation of this system triggers a cascade of protein deposition on the bacterial surface, resulting in the assembly of the membrane attack complex and opsonization of the pathogen, followed by phagocytosis. (asm.org)
Pathogenic1
  • Burkholderia cepacia complex should be considered among pathogenic etiologies of pyogenic vertebral osteomyelitis, particularly among patients with intravenous drug use. (hindawi.com)
Nosocomial2
  • Three German patients developed nosocomial pneumonia after cardiac surgery and had Burkholderia cepacia complex detected in respiratory specimens. (eurosurveillance.org)
  • Investigation of Burkholderia cepacia nosocomial outbreak with high fatality in patients suffering from diseases other than cystic fibrosis. (cdc.gov)
Outbreak of Burkholderia2
  • Outbreak of Burkholderia cepacia pseudobacteraemia caused by intrinsically contaminated commercial 0.5% chlorhexidine solution in neonatal intensive care units. (eurosurveillance.org)
  • An outbreak of Burkholderia cepacia complex associated with intrinsically contaminated nasal spray. (eurosurveillance.org)
Patients14
  • Clinicians should be aware that patients using product from this lot number might have been exposed to B. cepacia complex. (cdc.gov)
  • B. cepacia has emerged as a human respiratory opportunistic pathogen in individuals with weakened immune systems or chronic lung disease, espeically cystic fibrosis (CS) patients, within the past 30 years and has therefore recieved increased attention from the scientific community. (kenyon.edu)
  • Because of these factors, management of B. cepacia complex patients is difficult [4] . (kenyon.edu)
  • Reports of B. cepacia in CF patients appeared in the late 1970s and early 1980s. (kenyon.edu)
  • Pulmonary infection with Burkholderia cepacia complex (BCC) in patients with CF is often associated with a more rapid decline in lung function. (clinicaltrials.gov)
  • four B. cepacia patients died and none of the control patients died. (ersjournals.com)
  • By using next-generation sequencing, we documented a polyclonal B. cepacia complex outbreak affecting peritoneal dialysis patients in Hong Kong that was caused by contaminated chlorhexidine solutions. (cdc.gov)
  • The B. cepacia complex is a recognised respiratory pathogen in patients with cystic fibrosis. (elsevier.es)
  • In the end of 2009, a large number of patients with cancer undergoing chemotherapy at the day care unit of a private hospital in Mumbai, India developed Burkholderia cepacia complex (BCC) blood stream infection (BSI). (nih.gov)
  • In August 2004, the Texas Department of Health received reports of positive cultures for B. cepacia from respiratory samples of 13 intensive care unit patients receiving mechanical ventilation at a hospital in Texas during April--August 2004. (cdc.gov)
  • None of the patients had cystic fibrosis, a condition commonly associated with B. cepacia . (cdc.gov)
  • Clinicians should be aware that patients exposed to these probes might have been exposed to various GNRs, including B. cepacia . (cdc.gov)
  • Burkholderia cepacia complex (Bcc) is an opportunistic pathogen in cystic fibrosis patients which is inherently resistant to antimicrobial agents. (mdpi.com)
  • With the improving survival of patients with cystic fibrosis (CF), the clinical spectrum of this complex multisystem disease continues to evolve. (bmj.com)
Pathogenesis1
  • Burkholderia cepacia epidemiology and pathogenesis: implications for infection control. (cdc.gov)
Chronic2
  • B. cepacia is an opportunistic human pathogen that most often causes pneumonia in immunocompromised individuals with underlying lung disease (such as cystic fibrosis or chronic granulomatous disease). (wikipedia.org)
  • B. cepacia complex is an important cause of chronic respiratory infection among persons with cystic fibrosis ( 40 ) and of pneumonia, septicemia, and soft tissue abscesses among persons with chronic granulomatous disease ( 52 , 59 ). (antimicrobe.org)
Organism6
  • The organism is usually cultured in Burkholderia cepacia agar (BC agar), which contains crystal violet and bile salts to inhibit the growth of Gram-positive cocci, and ticarcillin and polymyxin B to inhibit the growth of other Gram-negative bacilli. (wikipedia.org)
  • However, the efficiency of infection control measures are determined by the accuracy with which " B. cepacia " is diagnosed, and poor laboratory proficiency in identification of this organism still prevails ( 17 , 40 , 75 ). (asm.org)
  • There is a lack of consensus on whether B. cepacia should be considered an objectionable organism in nonsterile pharmaceutics according to guidelines for the United States and Europe ( 27 - 30 ). (cdc.gov)
  • Historically regarded as an organism of low pathogenicity, B. cepacia complex can be transmitted person to person in both healthcare and non-healthcare settings, and both direct and indirect contact with infectious secretions and droplet spread have been implicated in transmission ( 25 , 31 , 32 , 39 , 63 ). (antimicrobe.org)
  • Ait-Tayeb L, Lefevre M, Passet V, Diancourt L, Brisse S, Grimont PAD (2008) Comparative phylogenies of Burkholderia , Ralstonia , Comamonas , Brevundimonas and related organism derived from rpoB , gyrB and rrs gene sequences. (springer.com)
  • We describe a case of an otherwise healthy, community-dwelling man who presented with subacute cavitary lung disease, the causative organism of which turned out to be Burkholderia cepacia complex. (medworm.com)
Cenocepacia TAtl-3711
  • Burkholderia cenocepacia TAtl-371 was isolated from the rhizosphere of a tomato plant growing in Atlatlahucan, Morelos, Mexico . (bvsalud.org)
Clinical2
  • Cescutti P, Bosco M, Picotti F, Impallomeni G, Leitão JH, Richau JA, Sá-Correia I (2000) Structural study of the exopolysaccharide produced by a clinical isolate of Burkholderia cepacia . (springer.com)
  • The Canadian Burkholderia cepacia Complex Research and Referral Repository ( CBCCRRR ) serves as a Cystic Fibrosis Canada-funded core facility to the CF clinical and research communities across the country. (cysticfibrosis.ca)
Genomic1
  • This study highlights how genomic characterization of Burkholderia prophages can lead to the discovery of novel bacteriophages with potential therapeutic or biotechnological applications. (mdpi.com)
20171
  • In May 2017, the FDA advised on Contamination Risk for Burkholderia cepacia concerning water-based drug products to remind drug manufacturers of non-sterile products to establish suitable methods to prevent objectionable microorganisms contamination. (smi-online.co.uk)
Pneumonia1
  • Of onions and men: Report of cavitary community acquired pneumonia due to Burkholderia cepacia complex in an immunocompetent patient and review of the literature. (medworm.com)
Antimicrobial1
  • Since " B. cepacia " is resistant to most antimicrobial agents, effective therapies are not straightforward and management efforts are therefore aimed at prevention of infection ( 35 , 63 ). (asm.org)
Contamination1
  • CDC has been notified of a voluntary recall of over-the-counter oxymetazoline HCl 0.05% nasal spray because of intrinsic contamination with Burkholderia cepacia complex. (cdc.gov)
Genomovars1
  • Several distinct genomovars are collectively referred to as B. cepacia complex (Bcc) 7 . (ersjournals.com)
Genome of Burkholderia1
  • The genome of Burkholderia cenocepacia has 3 putative HCN synthase encoding ( hcnABC ) gene clusters. (biomedcentral.com)
Eradication1
  • Without further comprehensive studies, it is difficult to draw conclusions about a safe and effective management strategy for Burkholderia cepacia complex eradication in cystic fibrosis. (cochrane.org)
JCDR - Burkholderia cepacia complex, Mass spectrometry, Periprosthetic tissue
JCDR - Burkholderia cepacia complex, Mass spectrometry, Periprosthetic tissue (jcdr.net)
Bacterial Lung Infections in Cystic Fibrosis Patients: An Up... : The Pediatric Infectious Disease Journal
Bacterial Lung Infections in Cystic Fibrosis Patients: An Up... : The Pediatric Infectious Disease Journal (journals.lww.com)
Burkholderia cepacia complex - microbewiki
Burkholderia cepacia complex - microbewiki (microbewiki.kenyon.edu)
Objectionable Organisms - What, Why, Who, How? : Pharmaceuticals : All
Objectionable Organisms - What, Why, Who, How? : Pharmaceuticals : All (smi-online.co.uk)
Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical Microbiology
Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical Microbiology (jcm.asm.org)
Phylogenetic Analysis of Burkholderia Species by Multilocus Sequence Analysis | SpringerLink
Phylogenetic Analysis of Burkholderia Species by Multilocus Sequence Analysis | SpringerLink (link.springer.com)
Pathogenicity, virulence factors, and strategies to fight against Burkholderia cepacia complex pathogens and related species |...
Pathogenicity, virulence factors, and strategies to fight against Burkholderia cepacia complex pathogens and related species |... (link.springer.com)
Diagnostically and Experimentally Useful Panel of Strains from the Burkholderia cepacia Complex | Journal of Clinical...
Diagnostically and Experimentally Useful Panel of Strains from the Burkholderia cepacia Complex | Journal of Clinical... (jcm.asm.org)
Epidemiology of Burkholderia cepacia complex colonisation in cystic fibrosis patients | European Respiratory Society
Epidemiology of Burkholderia cepacia complex colonisation in cystic fibrosis patients | European Respiratory Society (erj.ersjournals.com)
Povidone-iodine - Wikipedia
Povidone-iodine - Wikipedia (en.wikipedia.org)
Tangled bank of experimentally evolved Burkholderia biofilms reflects selection during chronic infections | PNAS
Tangled bank of experimentally evolved Burkholderia biofilms reflects selection during chronic infections | PNAS (pnas.org)
Evaluation of the FilmArray Blood Culture Identification Panel: Results of a Multicenter Controlled Trial | Journal of Clinical...
Evaluation of the FilmArray Blood Culture Identification Panel: Results of a Multicenter Controlled Trial | Journal of Clinical... (jcm.asm.org)
The Rate and Molecular Spectrum of Spontaneous Mutations in the GC-Rich Multichromosome Genome of Burkholderia cenocepacia |...
The Rate and Molecular Spectrum of Spontaneous Mutations in the GC-Rich Multichromosome Genome of Burkholderia cenocepacia |... (genetics.org)
Frontiers | Lectin-Like Bacteriocins | Microbiology
Frontiers | Lectin-Like Bacteriocins | Microbiology (frontiersin.org)
Infection by Ralstonia Species in Cystic Fibrosis Patients: Identification of R. pickettii and R. mannitolilytica by Polymerase...
Infection by Ralstonia Species in Cystic Fibrosis Patients: Identification of R. pickettii and R. mannitolilytica by Polymerase... (wwwnc.cdc.gov)
Volume 13, Number 3-March 2007 - Emerging Infectious Diseases journal - CDC
Volume 13, Number 3-March 2007 - Emerging Infectious Diseases journal - CDC (wwwnc.cdc.gov)
Healthcare Water System Repair|Natural Disasters and Severe Weather
Healthcare Water System Repair|Natural Disasters and Severe Weather (cdc.gov)
Reduce Risk from Water | HAI | CDC
Reduce Risk from Water | HAI | CDC (cdc.gov)
Frontiers | Structure of O-Antigen and Hybrid Biosynthetic Locus in Burkholderia cenocepacia Clonal Variants Recovered from a...
Frontiers | Structure of O-Antigen and Hybrid Biosynthetic Locus in Burkholderia cenocepacia Clonal Variants Recovered from a... (frontiersin.org)
Frontiers | The One Health Concept: 10 Years Old and a Long Road Ahead | Veterinary Science
Frontiers | The One Health Concept: 10 Years Old and a Long Road Ahead | Veterinary Science (frontiersin.org)
Propionibacterium ( Cutibacterium) acnes Bacteriophage Therapy in Acne: Current Evidence and Future Perspectives | SpringerLink
Propionibacterium ( Cutibacterium) acnes Bacteriophage Therapy in Acne: Current Evidence and Future Perspectives | SpringerLink (link.springer.com)
University of Manitoba - Medical Microbiology and Infectious Diseases - Faculty
University of Manitoba - Medical Microbiology and Infectious Diseases - Faculty (umanitoba.ca)
Table of Contents | Journal of Clinical Microbiology
Table of Contents | Journal of Clinical Microbiology (jcm.asm.org)
Exacerbations in cystic fibrosis · 1: Epidemiology and pathogenesis | Thorax
Exacerbations in cystic fibrosis · 1: Epidemiology and pathogenesis | Thorax (thorax.bmj.com)
Lung function is abnormal in 3-month-old infants with cystic fibrosis diagnosed by newborn screening | Thorax
Lung function is abnormal in 3-month-old infants with cystic fibrosis diagnosed by newborn screening | Thorax (thorax.bmj.com)
A demonstration of the susceptibility of clinical isolates obtained from cystic fibrosis patients to manuka honey | SpringerLink
A demonstration of the susceptibility of clinical isolates obtained from cystic fibrosis patients to manuka honey | SpringerLink (link.springer.com)
Canada articles, all-time results - Emerging Infectious Diseases journal - CDC
Canada articles, all-time results - Emerging Infectious Diseases journal - CDC (wwwnc.cdc.gov)
Volume 8, Number 2-February 2002 - Emerging Infectious Diseases journal - CDC
Volume 8, Number 2-February 2002 - Emerging Infectious Diseases journal - CDC (wwwnc.cdc.gov)
Frontiers | Understanding the Entanglement: Neutrophil Extracellular Traps (NETs) in Cystic Fibrosis | Cellular and Infection...
Frontiers | Understanding the Entanglement: Neutrophil Extracellular Traps (NETs) in Cystic Fibrosis | Cellular and Infection... (frontiersin.org)
The Genome of Burkholderia cenocepacia J2315, an Epidemic Pathogen of Cystic Fibrosis Patients | Journal of Bacteriology
The Genome of Burkholderia cenocepacia J2315, an Epidemic Pathogen of Cystic Fibrosis Patients | Journal of Bacteriology (jb.asm.org)
Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...
Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and... (iai.asm.org)