AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsAnthropology, Education, Sociology and Social PhenomenaTechnology, Industry, AgricultureInformation ScienceHealth Care
Burkholderia cepacia complexBurkholderia cepaciaBurkholderia InfectionsBurkholderiaCystic FibrosisBurkholderia cenocepaciaBurkholderia pseudomalleiRec A RecombinasesBacterial Typing TechniquesHydrogen CyanideOnionsDNA, BacterialSputumEnvironmental MicrobiologyBiofilmsPolymorphism, Restriction Fragment LengthPyrrolnitrinBenzethoniumMelioidosisOpportunistic InfectionsSequence Analysis, DNASodium BenzoateRNA, Ribosomal, 16SPolymerase Chain ReactionTobramycinRandom Amplified Polymorphic DNA Technique4-ButyrolactoneVirulencePhylogenyElectrophoresis, Gel, Pulsed-FieldMolecular Sequence DataSoil MicrobiologyQuorum SensingDNA, RibosomalAnti-Bacterial AgentsGram-Negative Bacterial InfectionsBacterial ProteinsSpecies SpecificityGenes, BacterialMicrobial ViabilityBurkholderia gladioliDNA FingerprintingMicrobial Sensitivity Tests2,4,5-Trichlorophenoxyacetic AcidCulture MediaGlandersPolysaccharides, BacterialDrug Resistance, BacterialGene Expression Regulation, BacterialGenome, BacterialVirulence FactorsBase SequencePseudomonasBiodegradation, EnvironmentalPseudomonas aeruginosaGenotype
Burkholderia cepacia complex: A group of phenotypically similar but genotypically distinct species (genomovars) in the genus BURKHOLDERIA. They are found in water, soil, and the rhizosphere of crop plants. They can act as opportunistic human pathogens and as plant growth promoting and biocontrol agents.Burkholderia cepacia: A species of BURKHOLDERIA considered to be an opportunistic human pathogen. It has been associated with various types of infections of nosocomial origin.Burkholderia Infections: Infections with bacteria of the genus BURKHOLDERIA.Burkholderia: A genus of gram-negative, aerobic, rod-shaped bacteria. Organisms in this genus had originally been classified as members of the PSEUDOMONAS genus but overwhelming biochemical and chemical findings indicated the need to separate them from other Pseudomonas species, and hence, this new genus was created.Cystic Fibrosis: An autosomal recessive genetic disease of the EXOCRINE GLANDS. It is caused by mutations in the gene encoding the CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR expressed in several organs including the LUNG, the PANCREAS, the BILIARY SYSTEM, and the SWEAT GLANDS. Cystic fibrosis is characterized by epithelial secretory dysfunction associated with ductal obstruction resulting in AIRWAY OBSTRUCTION; chronic RESPIRATORY INFECTIONS; PANCREATIC INSUFFICIENCY; maldigestion; salt depletion; and HEAT PROSTRATION.Burkholderia cenocepacia: A species of gram-negative bacteria that causes disease in plants. It is found commonly in the environment and is an opportunistic pathogen in humans.Burkholderia pseudomallei: A species of gram-negative, aerobic bacteria that causes MELIOIDOSIS. It has been isolated from soil and water in tropical regions, particularly Southeast Asia.Rec A Recombinases: A family of recombinases initially identified in BACTERIA. They catalyze the ATP-driven exchange of DNA strands in GENETIC RECOMBINATION. The product of the reaction consists of a duplex and a displaced single-stranded loop, which has the shape of the letter D and is therefore called a D-loop structure.Bacterial Typing Techniques: Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.Hydrogen Cyanide: Hydrogen cyanide (HCN); A toxic liquid or colorless gas. It is found in the smoke of various tobacco products and released by combustion of nitrogen-containing organic materials.Onions: Herbaceous biennial plants and their edible bulbs, belonging to the Liliaceae.DNA, Bacterial: Deoxyribonucleic acid that makes up the genetic material of bacteria.Sputum: Material coughed up from the lungs and expectorated via the mouth. It contains MUCUS, cellular debris, and microorganisms. It may also contain blood or pus.Environmental Microbiology: The study of microorganisms living in a variety of environments (air, soil, water, etc.) and their pathogenic relationship to other organisms including man.Biofilms: Encrustations, formed from microbes (bacteria, algae, fungi, plankton, or protozoa) embedding in extracellular polymers, that adhere to surfaces such as teeth (DENTAL DEPOSITS); PROSTHESES AND IMPLANTS; and catheters. Biofilms are prevented from forming by treating surfaces with DENTIFRICES; DISINFECTANTS; ANTI-INFECTIVE AGENTS; and antifouling agents.Polymorphism, Restriction Fragment Length: Variation occurring within a species in the presence or length of DNA fragment generated by a specific endonuclease at a specific site in the genome. Such variations are generated by mutations that create or abolish recognition sites for these enzymes or change the length of the fragment.Pyrrolnitrin: 3-Chloro-4-(3-chloro-2-nitrophenyl)pyrrole. Antifungal antibiotic isolated from Pseudomonas pyrrocinia. It is effective mainly against Trichophyton, Microsporium, Epidermophyton, and Penicillium.Benzethonium: Bactericidal cationic quaternary ammonium surfactant used as a topical anti-infective agent. It is an ingredient in medicaments, deodorants, mouthwashes, etc., and is used to disinfect apparatus, etc., in the food processing and pharmaceutical industries, in surgery, and also as a preservative. The compound is toxic orally as a result of neuromuscular blockade.Melioidosis: A disease of humans and animals that resembles GLANDERS. It is caused by BURKHOLDERIA PSEUDOMALLEI and may range from a dormant infection to a condition that causes multiple abscesses, pneumonia, and bacteremia.Opportunistic Infections: An infection caused by an organism which becomes pathogenic under certain conditions, e.g., during immunosuppression.Sequence Analysis, DNA: A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.Sodium Benzoate: The sodium salt of BENZOIC ACID. It is used as an antifungal preservative in pharmaceutical preparations and foods. It may also be used as a test for liver function.RNA, Ribosomal, 16S: Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.Polymerase Chain Reaction: In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.Tobramycin: An aminoglycoside, broad-spectrum antibiotic produced by Streptomyces tenebrarius. It is effective against gram-negative bacteria, especially the PSEUDOMONAS species. It is a 10% component of the antibiotic complex, NEBRAMYCIN, produced by the same species.Random Amplified Polymorphic DNA Technique: Technique that utilizes low-stringency polymerase chain reaction (PCR) amplification with single primers of arbitrary sequence to generate strain-specific arrays of anonymous DNA fragments. RAPD technique may be used to determine taxonomic identity, assess kinship relationships, analyze mixed genome samples, and create specific probes.4-Butyrolactone: One of the FURANS with a carbonyl thereby forming a cyclic lactone. It is an endogenous compound made from gamma-aminobutyrate and is the precursor of gamma-hydroxybutyrate. It is also used as a pharmacological agent and solvent.Virulence: The degree of pathogenicity within a group or species of microorganisms or viruses as indicated by case fatality rates and/or the ability of the organism to invade the tissues of the host. The pathogenic capacity of an organism is determined by its VIRULENCE FACTORS.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Electrophoresis, Gel, Pulsed-Field: Gel electrophoresis in which the direction of the electric field is changed periodically. This technique is similar to other electrophoretic methods normally used to separate double-stranded DNA molecules ranging in size up to tens of thousands of base-pairs. However, by alternating the electric field direction one is able to separate DNA molecules up to several million base-pairs in length.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Soil Microbiology: The presence of bacteria, viruses, and fungi in the soil. This term is not restricted to pathogenic organisms.Quorum Sensing: A phenomenon where microorganisms communicate and coordinate their behavior by the accumulation of signaling molecules. A reaction occurs when a substance accumulates to a sufficient concentration. This is most commonly seen in bacteria.DNA, Ribosomal: DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.Anti-Bacterial Agents: Substances that reduce the growth or reproduction of BACTERIA.Gram-Negative Bacterial Infections: Infections caused by bacteria that show up as pink (negative) when treated by the gram-staining method.Bacterial Proteins: Proteins found in any species of bacterium.Species Specificity: The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.Genes, Bacterial: The functional hereditary units of BACTERIA.Microbial Viability: Ability of a microbe to survive under given conditions. This can also be related to a colony's ability to replicate.Burkholderia gladioli: A species of gram-negative, aerobic bacteria that acts as both a human and plant pathogen.DNA Fingerprinting: A technique for identifying individuals of a species that is based on the uniqueness of their DNA sequence. Uniqueness is determined by identifying which combination of allelic variations occur in the individual at a statistically relevant number of different loci. In forensic studies, RESTRICTION FRAGMENT LENGTH POLYMORPHISM of multiple, highly polymorphic VNTR LOCI or MICROSATELLITE REPEAT loci are analyzed. The number of loci used for the profile depends on the ALLELE FREQUENCY in the population.Microbial Sensitivity Tests: Any tests that demonstrate the relative efficacy of different chemotherapeutic agents against specific microorganisms (i.e., bacteria, fungi, viruses).2,4,5-Trichlorophenoxyacetic Acid: An herbicide with strong irritant properties. Use of this compound on rice fields, orchards, sugarcane, rangeland, and other noncrop sites was terminated by the EPA in 1985. (From Merck Index, 11th ed)Culture Media: Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.Glanders: A contagious disease of horses that can be transmitted to humans. It is caused by BURKHOLDERIA MALLEI and characterized by ulceration of the respiratory mucosa and an eruption of nodules on the skin.Polysaccharides, Bacterial: Polysaccharides found in bacteria and in capsules thereof.Drug Resistance, Bacterial: The ability of bacteria to resist or to become tolerant to chemotherapeutic agents, antimicrobial agents, or antibiotics. This resistance may be acquired through gene mutation or foreign DNA in transmissible plasmids (R FACTORS).Gene Expression Regulation, Bacterial: Any of the processes by which cytoplasmic or intercellular factors influence the differential control of gene action in bacteria.Genome, Bacterial: The genetic complement of a BACTERIA as represented in its DNA.Virulence Factors: Those components of an organism that determine its capacity to cause disease but are not required for its viability per se. Two classes have been characterized: TOXINS, BIOLOGICAL and surface adhesion molecules that effect the ability of the microorganism to invade and colonize a host. (From Davis et al., Microbiology, 4th ed. p486)Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Pseudomonas: A genus of gram-negative, aerobic, rod-shaped bacteria widely distributed in nature. Some species are pathogenic for humans, animals, and plants.Biodegradation, Environmental: Elimination of ENVIRONMENTAL POLLUTANTS; PESTICIDES and other waste using living organisms, usually involving intervention of environmental or sanitation engineers.Pseudomonas aeruginosa: A species of gram-negative, aerobic, rod-shaped bacteria commonly isolated from clinical specimens (wound, burn, and urinary tract infections). It is also found widely distributed in soil and water. P. aeruginosa is a major agent of nosocomial infection.Genotype: The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.

Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia). (1/151)

An antibiotic efflux gene cluster that confers resistance to chloramphenicol, trimethoprim, and ciprofloxacin has been identified in Burkholderia cenocepacia (genomovar III), an important cystic fibrosis pathogen. Five open reading frames have been identified in the cluster. There is apparently a single transcriptional unit, with llpE encoding a lipase-like protein, ceoA encoding a putative periplasmic linker protein, ceoB encoding a putative cytoplasmic membrane protein, and opcM encoding a previously described outer membrane protein. A putative LysR-type transcriptional regulatory gene, ceoR, is divergently transcribed upstream of the structural gene cluster. Experiments using radiolabeled chloramphenicol and salicylate demonstrated active efflux of both compounds in the presence of the gene cluster. Salicylate is an important siderophore produced by B. cepacia complex isolates, and both extrinsic salicylate and iron starvation appear to upregulate ceoR promoter activity, as does chloramphenicol. These results suggest that salicylate is a natural substrate for the efflux pump in B. cenocepacia and imply that the environment of low iron concentration in the cystic fibrosis lung can induce efflux-mediated resistance, even in the absence of antibiotic selective pressure.  (+info)

The Burkholderia cepacia epidemic strain marker is part of a novel genomic island encoding both virulence and metabolism-associated genes in Burkholderia cenocepacia. (2/151)

The Burkholderia cepacia epidemic strain marker (BCESM) is a useful epidemiological marker for virulent B. cenocepacia strains that infect patients with cystic fibrosis. However, there was no evidence that the original marker, identified by random amplified polymorphic DNA fingerprinting, contributed to pathogenicity. Here we demonstrate that the BCESM is part of a novel genomic island encoding genes linked to both virulence and metabolism. The BCESM was present on a 31.7-kb low-GC-content island that encoded 35 predicted coding sequences (CDSs): an N-acyl homoserine lactone (AHL) synthase gene (cciI) and corresponding transcriptional regulator (cciR), representing the first time cell signaling genes have been found on a genomic island; fatty acid biosynthesis genes; an IS66 family transposase; transcriptional regulator CDSs; amino acid metabolism genes; and a group of hypothetical genes. Mutagenesis of the AHL synthase, amidase (amiI), and porin (opcI) genes on the island was carried out. Testing of the isogenic mutants in a rat model of chronic lung infection demonstrated that the amidase played a role in persistence, while the AHL synthase and porin were both involved in virulence. The island, designated the B. cenocepacia island (cci), is the first genomic island to be defined in the B. cepacia complex and its discovery validates the original epidemiological correlation of the BCESM with virulent CF strains. The features of the cci, which overlap both pathogenicity and metabolism, expand the concept of bacterial pathogenicity islands and illustrate the diversity of accessory functions that can be acquired by lateral gene transfer in bacteria.  (+info)

Importance of the ornibactin and pyochelin siderophore transport systems in Burkholderia cenocepacia lung infections. (3/151)

Previously, orbA, the gene encoding the outer membrane receptor for ferric-ornibactin, was identified in Burkholderia cenocepacia K56-2, a strain which produces ornibactin, salicylic acid, and negligible amounts of pyochelin. A K56-2 orbA mutant was less virulent than the parent strain in a rat agar bead infection model. In this study, an orbA mutant of B. cenocepacia Pc715j which produces pyochelin in addition to ornibactin and salicylic acid was constructed. The gene encoding the outer membrane receptor for ferric-pyochelin (fptA) was also identified. An fptA mutant was constructed in Pc715j and shown to be deficient in [(59)Fe]pyochelin uptake. A 75-kDa iron-regulated protein was identified in outer membrane preparations of Pc715j that was absent in outer membrane preparations of Pc715jfptA::tp. Pc715jfptA::tp and Pc715jorbA::tp produced smaller amounts of their corresponding siderophores. Both Pc715jorbA::tp and Pc715jfptA::tp were able to grow in iron starvation conditions in vitro. In the agar bead model, the Pc715jorbA::tp mutant was cleared from the lung, indicating that the pyochelin uptake system does not compensate for the absence of a functional ornibactin system. Pc715jfptA::tp persisted in rat lung infections in numbers similar to those of the parent strain, indicating that the ferric-ornibactin uptake system could compensate for the defect in ferric-pyochelin uptake in vivo. These studies suggest that the ornibactin uptake system is the most important siderophore-mediated iron transport system in B. cenocepacia lung infections.  (+info)

Genetic characterization of a multicomponent signal transduction system controlling the expression of cable pili in Burkholderia cenocepacia. (4/151)

Cable pili are peritrichous organelles expressed by certain strains of Burkholderia cenocepacia, believed to facilitate colonization of the lower respiratory tract in cystic fibrosis patients. The B. cenocepacia cblBACDS operon encodes the structural and accessory proteins required for the assembly of cable pili, as well as a gene designated cblS, predicted to encode a hybrid sensor kinase protein of bacterial two-component signal transduction systems. In this study we report the identification of two additional genes, designated cblT and cblR, predicted to encode a second hybrid sensor kinase and a response regulator, respectively. Analyses of the deduced amino acid sequences of the cblS and cblT gene products revealed that both putative sensor kinases have transmitter and receiver domains and that the cblT gene product has an additional C-terminal HPt domain. Mutagenesis of the cblS, cblT, or cblR gene led to a block in expression of CblA, the major pilin subunit, and a severe decrease in cblA transcript abundance. Using transcriptional fusion analyses, the decrease in the abundance of the cblA transcript in the cblS, cblT, and cblR mutants was shown to be due to a block in transcription from the cblB-proximal promoter, located upstream of the cblBACDS operon. Furthermore, ectopic expression of either cblS or cblR in wild-type B. cenocepacia strain BC7 led to a significant increase, while ectopic expression of cblT resulted in a dramatic decrease, in abundance of the CblA major pilin and the cblA transcript. Our results demonstrate that the B. cenocepacia cblS, cblT, and cblR genes are essential for cable pilus expression and that their effect is exerted at the level of transcription of the cblBACDS operon. These findings are consistent with the proposed function of the cblSTR gene products as a multicomponent signal transduction pathway controlling the expression of cable pilus biosynthetic genes in B. cenocepacia.  (+info)

Identification of Burkholderia cenocepacia genes required for bacterial survival in vivo. (5/151)

Burkholderia cenocepacia (formerly Burkholderia cepacia complex genomovar III) causes chronic lung infections in patients with cystic fibrosis. In this work, we used a modified signature-tagged mutagenesis (STM) strategy for the isolation of B. cenocepacia mutants that cannot survive in vivo. Thirty-seven specialized plasposons, each carrying a unique oligonucleotide tag signature, were constructed and used to examine the survival of 2,627 B. cenocepacia transposon mutants, arranged in pools of 37 unique mutants, after a 10-day lung infection in rats by using the agar bead model. The recovered mutants were screened by real-time PCR, resulting in the identification of 260 mutants which presumably did not survive within the lungs. These mutants were repooled into smaller pools, and the infections were repeated. After a second screen, we isolated 102 mutants unable to survive in the rat model. The location of the transposon in each of these mutants was mapped within the B. cenocepacia chromosomes. We identified mutations in genes involved in cellular metabolism, global regulation, DNA replication and repair, and those encoding bacterial surface structures, including transmembrane proteins and cell surface polysaccharides. Also, we found 18 genes of unknown function, which are conserved in other bacteria. A subset of 12 representative mutants that were individually examined using the rat model in competition with the wild-type strain displayed reduced survival, confirming the predictive value of our STM screen. This study provides a blueprint to investigate at the molecular level the basis for survival and persistence of B. cenocepacia within the airways.  (+info)

Production of exopolysaccharide by Burkholderia cenocepacia results in altered cell-surface interactions and altered bacterial clearance in mice. (6/151)

Despite the characterization of some Burkholderia cepacia complex exopolysaccharides (EPSs), little is known about the role of EPSs in the pathogenicity of B. cepacia complex organisms. We describe 2 Burkholderia cenocepacia (genomovar III) isolates obtained from a patient with cystic fibrosis (CF): the nonmucoid isolate C8963 and the mucoid isolate C9343. Both isolates had identical random amplified polymorphic DNA patterns. C9343 produced a capsule composed of the EPSs PS-I and PS-II, as well as alpha -1,6-glucan. These isolates exhibited several phenotypic differences: C8963 synthesized octanoyl-homoserine lactone and produced biofilms, but C9343 did not; in a mouse model of pulmonary infection, C8963 was cleared more rapidly than was C9343; and C9343 interacted poorly with macrophages and neutrophils, compared with C8963, suggesting that the C9343 capsule interfered with cell-surface interactions. Overproduction of EPS by C9343 resulted in a mucoid appearance and interfered with cell-surface interactions and clearance in an animal model. This mucoid colonial appearance could enhance the persistence and virulence of this important CF-related pathogen.  (+info)

Involvement of a plasmid-encoded type IV secretion system in the plant tissue watersoaking phenotype of Burkholderia cenocepacia. (7/151)

Burkholderia cenocepacia strain K56-2, a representative of the Burkholderia cepacia complex, is part of the epidemic and clinically problematic ET12 lineage. The strain produced plant tissue watersoaking (ptw) on onion tissue, which is a plant disease-associated trait. Using plasposon mutagenesis, mutants in the ptw phenotype were generated. The translated sequence of a disrupted gene (ptwD4) from a ptw-negative mutant showed homology to VirD4-like proteins. Analysis of the region proximal to the transfer gene homolog identified a gene cluster located on the 92-kb resident plasmid that showed homology to type IV secretion systems. The role of ptwD4, ptwC, ptwB4, and ptwB10 in the expression of ptw activity was determined by conducting site-directed mutagenesis. The ptw phenotype was not expressed by K56-2 derivatives with a disruption in ptwD4, ptwB4, or ptwB10 but was observed in a derivative with a disruption in ptwC. Complementation of ptw-negative K56-2 derivatives in trans resulted in complete restoration of the ptw phenotype. In addition, analysis of culture supernatants revealed that the putative ptw effector(s) was a secreted, heat-stable protein(s) that caused plasmolysis of plant protoplasts. A second chromosomally encoded type IV secretion system with complete homology to the VirB-VirD system was identified in K56-2. Site-directed mutagenesis of key secretory genes in the VirB-VirD system did not affect expression of the ptw phenotype. Our findings indicate that in strain K56-2, the plasmid-encoded Ptw type IV secretion system is responsible for the secretion of a plant cytotoxic protein(s).  (+info)

Burkholderia cepacia genomovar III and Burkholderia vietnamiensis double infection in a cystic fibrosis child. (8/151)

Herein we report a case of a cystic fibrosis child who was simultaneously infected with Burkholderia cepacia genomovar III and Burkholderia vietnamiensis. After antimicrobial therapy only B. cepacia genomovar III persisted.  (+info)

Social interactions in the Burkholderia cepacia complex: biofilms and quorum sensing. - Semantic ScholarSocial interactions in the Burkholderia cepacia complex: biofilms and quorum sensing. - Semantic Scholar
Burkholderia cepacia complex bacteria are opportunistic pathogens that cause respiratory tract infections in susceptible patients, mainly people with cystic fibrosis. There is convincing evidence that B. cepacia complex bacteria can form biofilms, not only on abiotic surfaces (e.g., glass and plastics), but also on biotic surfaces such as epithelial cells, leading to the suggestion that biofilm formation plays a key role in persistent infection of cystic fibrosis lungs. This article presents an overview of the molecular mechanisms involved in B. cepacia complex biofilm formation, the increased resistance of sessile B. cepacia complex cells and the role of quorum sensing in B. cepacia complex biofilm formation.
A General Protein O-glycosylation System Within the Burkholderia Cepacia Complex Is Involved in Motility and Virulence - PubMedA General Protein O-glycosylation System Within the Burkholderia Cepacia Complex Is Involved in Motility and Virulence - PubMed
Bacteria of the Burkholderia cepacia complex (Bcc) are pathogens of humans, plants, and animals. Burkholderia cenocepacia is one of the most common Bcc species infecting cystic fibrosis (CF) patients and its carriage is associated with poor prognosis. In this study, we characterized a general O-link …
Azithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.govAzithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.gov
Pulmonary infection with Burkholderia cepacia complex (BCC) in patients with CF is often associated with a more rapid decline in lung function. Because of the resistance of BCC to many antibiotics, treatment options are often limited. New therapies to improve outcomes for patients infected with BCC are needed.. However, because of the unpredictable nature of this pulmonary infection in CF, patients with BCC infection have been excluded from many CF therapeutic trials.. Recent published trials in the United States, Australia, and the United Kingdom have all demonstrated clinical benefits from prolonged administration of azithromycin in CF. In these trials, the vast majority of patients were chronically infected with Pseudomonas aeruginosa.. Patients with BCC were excluded from the US and UK trials, and only four patients with BCC infection were enrolled in the Australian trial. Thus, the effectiveness of azithromycin in CF patients infected with BCC is largely unknown and deserves further ...
Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)
Regan KH, Bhatt J. Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis. Cochrane Database of Systematic Reviews 2016, Issue 11. Art. No.: CD009876. DOI: 10.1002/14651858.CD009876.pub3 ...
Burkholderia cepacia complex | Johns Hopkins ABX GuideBurkholderia cepacia complex | Johns Hopkins ABX Guide
Burkholderia cepacia complex answers are found in the Johns Hopkins ABX Guide powered by Unbound Medicine. Available for iPhone, iPad, Android, and Web.
burkholderia cepacia complex Archives - PacBioburkholderia cepacia complex Archives - PacBio
By downloading, copying, or making any use of the images located on this website ("Site") you acknowledge that you have read and understand, and agree to, the terms of this Image Usage Agreement, as well as the terms provided on the Legal Notices webpage, which together govern your use of the images as provided below. If you do not agree to such terms, do not download, copy or use the images in any way, unless you have written permission signed by an authorized Pacific Biosciences representative.. Subject to the terms of this Agreement and the terms provided on the Legal Notices webpage (to the extent they do not conflict with the terms of this Agreement), you may use the images on the Site solely for (a) editorial use by press and/or industry analysts, (b) in connection with a normal, peer-reviewed, scientific publication, book or presentation, or the like. You may not alter or modify any image, in whole or in part, for any reason. You may not use any image in a manner that misrepresents the ...
Targeting the bacterial cytoskeleton of CF pathogens for antimicrobial development - A cautionary tale? - ePrints - Newcastle...Targeting the bacterial cytoskeleton of CF pathogens for antimicrobial development - A cautionary tale? - ePrints - Newcastle...
AbstractBackground Burkholderia cepacia complex (BCC) bacteria are opportunistic pathogens that cause severe lung infections in cystic fibrosis (CF). Treatment of BCC infections is difficult due to the inherent multidrug resistance of BCC. There is a pressing need to find new bacterial targets for antimicrobials. We have previously shown that the novel compound Q22, which is related to A22 and inhibits the bacterial cytoskeletal protein MreB, inhibits growth of BCC bacteria.Aims We aimed to further analyse the phenotypic effects of Q22 treatment on BCC virulence traits to assess its feasibility as an antimicrobial.Methods BCC bacteria were grown in the presence of Q22 and a broad phenotypic analysis was performed, including resistance to H2O2 induced oxidative stress, changes in inflammatory potential of cell surface components and in vivo drug toxicity studies. The influence of Q22 treatment on inflammatory potential was measured by monitoring the cytokine responses of BCC whole cell lysates, ...
Marine Drugs | Free Full-Text | Antimicrobial Activity of Monoramnholipids Produced by Bacterial Strains Isolated from the Ross...Marine Drugs | Free Full-Text | Antimicrobial Activity of Monoramnholipids Produced by Bacterial Strains Isolated from the Ross...
Microorganisms living in extreme environments represent a huge reservoir of novel antimicrobial compounds and possibly of novel chemical families. Antarctica is one of the most extraordinary places on Earth and exhibits many distinctive features. Antarctic microorganisms are well known producers of valuable secondary metabolites. Specifically, several Antarctic strains have been reported to inhibit opportunistic human pathogens strains belonging to Burkholderia cepacia complex (Bcc). Herein, we applied a biodiscovery pipeline for the identification of anti-Bcc compounds. Antarctic sub-sea sediments were collected from the Ross Sea, and used to isolate 25 microorganisms, which were phylogenetically affiliated to three bacterial genera (Psychrobacter, Arthrobacter, and Pseudomonas) via sequencing and analysis of 16S rRNA genes. They were then subjected to a primary cell-based screening to determine their bioactivity against Bcc strains. Positive isolates were used to produce crude extracts from microbial
Synthesis of 4-Amino-4-Deoxy-L-Arabinose C-Phosphonate Esters as Transferase Inhibitors | EUROCARB 2019Synthesis of 4-Amino-4-Deoxy-L-Arabinose C-Phosphonate Esters as Transferase Inhibitors | EUROCARB 2019
The group of 17 opportunistic pathogens linked to severe infections in cystic fibrosis and other immunocompromised conditions has been known as the Burkholderia cepacia complex.[1] The inner Kdo residue of Burkholderia lipopolysaccharide (LPS), which is highly conserved across the genus, is flanked by 4-amino-4-deoxy-L-arabinose units (Ara4N).[2] Furthermore, the binding of Ara4N to the phosphate groups of lipid A has been purported as one of the reasons for hindered interaction with cationic agents and consequently, to induce antibiotic resistance.[3] We set out to synthesize a series of tenable Ara4N transferase (ArnT) inhibitors with the prospect of impeding the biosynthetic pathway towards activated Ara4N species.[4] By the same token, we intend to inhibit the transfer of Ara4N residues both to Burkholderia LPS core and lipid A in vitro. Our synthetic endeavours en route to C-glycosidic derivatives mimicking either the transition state of glycosyl transfer or ArnT natural substrate will be ...
CAZy - BacteriaCAZy - Bacteria
Lineage: cellular organisms; Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderia cepacia complex; Burkholderia ...
ecorn-cf: Question singleecorn-cf: Question single
The advantages of MALDI-TOF are that identification from pure culture can take minutes and is relatively cost-effective- other than the cost of the machine (approx. $200,000), relatively few reagents are required to process a sample. A recent paper investigating the use of MALDI-TOF to identify common CF pathogens, estimated that 71% of Pseudomonas aeruginosa isolates were identified by MALDI-TOF by day 2 of incubation, at which stage none had been identified by conventional culture2. Similarly, with Staphylococcus aureus, 89% were identified using MALDI-TOF by day 1 of incubation, whereas only 68% had been identified by culture on day 2. It can also identify bacteria which are slow growing much more quickly than by using standard culture techniques. In addition, it can also be used to identify yeasts and fungi, which are commonly found in CF patients. It can also determine differences between species of bacteria, such as those in the Burkholderia cepacia complex, which prove problematic for ...
KEGG T00771: BCAL0647KEGG T00771: BCAL0647
bcj:BCAL0647 K00799 glutathione S-transferase [EC:2.5.1.18] , (GenBank) putative glutathione S-transferase (A) MKLYYWPKTRAFRALWMLEELGVVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSAP FAESGAVLLYLADRCPGAGLGVAPDDPLRGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA FGWGNIARVQRALAQALAHSRWLVGDRFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR AEDRDAFRRAVAIEQREAARLLHA ...
KEGG SSDB Paralog Search Result: bur:Bcep18194 A5156KEGG SSDB Paralog Search Result: bur:Bcep18194 A5156
T00286 (aalt,achr,actc,amyb,amyc,asw,cmos,cthd,dfn,fek,fva,hta,kak,kmx,kpnk,lei,lsh,lys,mcol,msub,mtab,noe,oor,paru,pje,png,ptd,rpln,sclo,sera,sfz,slb,snl,srub,taj : calculation not yet completed ...
Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical MicrobiologyUpdated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical Microbiology
The Burkholderia cepacia complex consists of nine closely related species: Burkholderia cepacia genomovars I and VI, Burkholderia multivorans (genomovar II), Burkholderia cenocepacia (genomovar III), Burkholderia stabilis (genomovar IV), Burkholderia vietnamiensis (genomovar V), Burkholderia ambifaria (genomovar VII), Burkholderia anthina (genomovar VIII), and Burkholderia pyrrocinia (genomovar IX) (2, 9, 10). Despite the advances that have been made in the understanding of the taxonomy and epidemiology of this group, infections of the respiratory tract with B. cepacia complex organisms still have a considerable impact on morbidity and mortality in cystic fibrosis (CF) patients (4, 5, 6). B. cepacia complex strains have also attracted attention as possible biocontrol and bioremediation agents that could be used as antagonists of soil-borne plant pathogens, as plant growth-promoting agents, and for the bioremediation of various recalcitrant xenobiotics (3, 8). To aid in identification, ...
Taxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical MicrobiologyTaxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical Microbiology
At the beginning of this review it is essential to clarify the terminology that will be used to refer to the members of the Burkholderia cepacia complex and their relatives. The name B. cepacia will relate only to B. cepacia genomovar I. Strains resembling B. cepacia may belong to the B. cepacia complex, to otherBurkholderia species (for instance, Burkholderia gladioli), or to species from other genera (for instance,Ralstonia pickettii) that share some phenotypic or genotypic similarities with the B. cepacia complex. B. cepacia complex bacteria and organisms that may be confused with them will be altogether referred to as B. cepacia-like organisms. Most previous reports regarding these organisms were published before the recognition of the complicated taxonomic relationships between the different members of the B. cepacia complex; it is therefore unclear to what category the presumed B. cepacia isolates described would belong. For that reason, when such literature is cited, the name "B. cepacia" ...
A Decade of Burkholderia cenocepacia Virulence Determinant Research<...A Decade of Burkholderia cenocepacia Virulence Determinant Research<...
TY - JOUR. T1 - A Decade of Burkholderia cenocepacia Virulence Determinant Research. AU - Loutet, S.A.. AU - Valvano, Miguel. PY - 2010/10. Y1 - 2010/10. N2 - The Burkholderia cepacia complex (Bcc) is a group of genetically related environmental bacteria that can cause chronic opportunistic infections in patients with cystic fibrosis (CF) and other underlying diseases. These infections are difficult to treat due to the inherent resistance of the bacteria to antibiotics. Bacteria can spread between CF patients through social contact and sometimes cause cepacia syndrome, a fatal pneumonia accompanied by septicemia. Burkholderia cenocepacia has been the focus of attention because initially it was the most common Bcc species isolated from patients with CF in North America and Europe. Today, B. cenocepacia, along with Burkholderia multivorans, is the most prevalent Bcc species in patients with CF. Given the progress that has been made in our understanding of B. cenocepacia over the past decade, we ...
Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...
Review question We looked for evidence of which antibiotics are best to treat a flare up of symptoms in people with cystic fibrosis with persistent Burkholderia cepacia complex lung infection.. Background Cystic fibrosis is a common inherited condition where the lungs often become blocked with mucus. This harms the lungs defences and often results in chronic, persistent infections that cannot be cleared by antibiotics. People with cystic fibrosis often need courses of antibiotics to reduce their symptoms (for instance cough, excess mucus and breathlessness) when these flare up or worsen. Such episodes are called exacerbations, and are usually treated with intravenous antibiotics (given through a drip into a vein). One group of bacteria that can infect the lungs of people with cystic fibrosis is called the Burkholderia cepacia complex. These closely-related bacteria are found widely in the environment and do not cause infections in healthy people who do not have cystic fibrosis. They are ...
EMBL: CP000871EMBL: CP000871
ID CP000871; SV 1; circular; genomic DNA; STD; PRO; 167422 BP. XX AC CP000871; AAVB01000000-AAVB01000037; XX PR Project:PRJNA17407; XX DT 16-NOV-2007 (Rel. 93, Created) DT 12-DEC-2013 (Rel. 119, Last updated, Version 2) XX DE Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence. XX KW . XX OS Burkholderia multivorans ATCC 17616 OC Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; OC Burkholderiaceae; Burkholderia; Burkholderia cepacia complex. OG Plasmid pBMUL01 XX RN [1] RP 1-167422 RG US DOE Joint Genome Institute RA Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E., RA Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., RA Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J., RA Richardson P.; RT "Complete sequence of plasmid1 of Burkholderia multivorans ATCC 17616"; RL Unpublished. XX RN [2] RP 1-167422 RG US DOE Joint Genome Institute RA Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., ...
Phase variation has a role in Burkholderia ambifaria niche adaptation - Espace INRSPhase variation has a role in Burkholderia ambifaria niche adaptation - Espace INRS
Members of the Burkholderia cepacia complex (Bcc), such as B. ambifaria, are effective biocontrol strains, for instance, as plant growth-promoting bacteria; however, Bcc isolates can also cause severe respiratory infections in people suffering from cystic fibrosis (CF). No distinction is known between isolates from environmental and human origins, suggesting that the natural environment is a potential source of infectious Bcc species. While investigating the presence and role of phase variation in B. ambifaria HSJ1, an isolate recovered from a CF patient, we identified stable variants that arose spontaneously irrespective of the culture conditions. Phenotypic and proteomic approaches revealed that the transition from wild-type to variant types affects the expression of several putative virulence factors. By using four different infection models (Drosophila melanogaster, Galleria mellonella, macrophages and Dictyostelium discoideum), we showed that the wild-type was more virulent than the ...
Treatments to cure long-term infections with Burkholderia cepacia in people with cystic fibrosis | CochraneTreatments to cure long-term infections with Burkholderia cepacia in people with cystic fibrosis | Cochrane
Review question. We reviewed the evidence for antibiotic treatment to cure early infection with Burkholderia cepacia complex in people with cystic fibrosis and prevent it becoming permanent.. Background. Cystic fibrosis is an inherited disease and people who have this disease produce large amounts of thick mucus which is difficult to clear. This mucus blocks up their lungs and digestive systems. People with cystic fibrosis suffer from lots of chest infections, which cause scarring of their airways. Eventually, they develop infections that cant be cured with antibiotics, so their lungs always contain lots of bugs, this is described as being chronically infected. One of these bugs, Burkholderia cepacia, causes a lot of problems for people with cystic fibrosis because it is very difficult to treat and makes their lung disease deteriorate faster than it otherwise would. This is an updated version of the review.. Search date. We last searched for any evidence on 12 March 2019.. Study ...
Items where Author is Nicholson, Audrey - Northumbria Research LinkItems where Author is "Nicholson, Audrey" - Northumbria Research Link
Nicholson, Audrey, Perry, John, James, Arthur, Stanforth, Stephen, Carnell, Sonya, Wilkinson, Kathryn, Khan, Anjam, de Soyza, Anthony and Gould, Kate (2012) In vitro activity of S-(3,4-dichlorobenzyl) isothiourea hydrochloride and novel structurally related compounds against multidrug-resistant bacteria, including Pseudomonas aeruginosa and Burkholderia cepacia complex. International Journal of Antimicrobial Agents, 39 (1). pp. 27-32. ISSN 0924-8579 de Soyza, Anthony, Meachery, Gerard, Hester, Katy, Nicholson, Audrey, Parry, Gareth, Tocewicz, Krzysztof, Pillay, Thasee, Clark, Stephen, Lordan, James, Schueler, Stephan, Fisher, Andrew, Dark, John, Gould, Kate and Corris, Paul (2010) Lung transplantation for patients with cystic fibrosis and Burkholderia cepacia complex infection: A single-center experience. The Journal of Heart and Lung Transplantation, 29 (12). pp. 1395-1404. ISSN 1053 2498 Meachery, Gerard, de Soyza, Anthony, Nicholson, Audrey, Parry, Gareth, Hasan, Asif, Tocewicz, Krzysztof, ...
Burkholderia cenocepacia ATCC ® BAA-245D-5™Burkholderia cenocepacia ATCC ® BAA-245D-5™
Burkholderia cenocepacia ATCC ® BAA-245D-5™ Designation: Genomic DNA from Burkholderia cenocepacia strain LMG 16656 TypeStrain=False Application:
https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310
Free Online Library: Environmental Burkholderia cepacia complex isolates in human infections.(DISPATCHES) by Emerging Infectious Diseases; Health, general Infection Health aspects
Genome-wide transcription start site profiling in biofilm-grown Burkholderia cenocepacia J2315Genome-wide transcription start site profiling in biofilm-grown Burkholderia cenocepacia J2315
Mapping transcription start sites across the B. cenocepacia genome added relevant information to the J2315 annotation. Genes and novel regulatory RNAs putatively involved in B. cenocepacia biofilm formation were identified. These findings will help in understanding regulation of B. cenocepacia biofi …
KEGG PATHWAY: Glycolysis / Gluconeogenesis - Burkholderia cenocepacia J2315KEGG PATHWAY: Glycolysis / Gluconeogenesis - Burkholderia cenocepacia J2315
Glycolysis is the process of converting glucose into pyruvate and generating small amounts of ATP (energy) and NADH (reducing power). It is a central pathway that produces important precursor metabolites: six-carbon compounds of glucose-6P and fructose-6P and three-carbon compounds of glycerone-P, glyceraldehyde-3P, glycerate-3P, phosphoenolpyruvate, and pyruvate [MD:M00001]. Acetyl-CoA, another important precursor metabolite, is produced by oxidative decarboxylation of pyruvate [MD:M00307]. When the enzyme genes of this pathway are examined in completely sequenced genomes, the reaction steps of three-carbon compounds from glycerone-P to pyruvate form a conserved core module [MD:M00002], which is found in almost all organisms and which sometimes contains operon structures in bacterial genomes. Gluconeogenesis is a synthesis pathway of glucose from noncarbohydrate precursors. It is essentially a reversal of glycolysis with minor variations of alternative paths [MD:M00003 ...
Recombinant Burkholderia vietnamiensis UPF0060 membrane protein Bcep1808 1236 (Bcep1808 1236) - CusabioRecombinant Burkholderia vietnamiensis UPF0060 membrane protein Bcep1808 1236 (Bcep1808 1236) - Cusabio
Purchase Recombinant Burkholderia vietnamiensis UPF0060 membrane protein Bcep1808_1236 (Bcep1808_1236). It is produced in Yeast. High purity. Good price.
bcscV - Type III secretion system protein - Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 ...bcscV - Type III secretion system protein - Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
hisS - Histidine--tRNA ligase - Burkholderia cenocepacia (strain AU 1054) - hisS gene & proteinhisS - Histidine--tRNA ligase - Burkholderia cenocepacia (strain AU 1054) - hisS gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Pre GI: GenePre GI: Gene
General Information: Burkholderia cenocepacia MC0-3 was isolated from soil associated with maize roots. This species (genomovar III) is part of the Burkholderia cepacia complex, which consists of 9 closely related species, also known as genomovars. These organisms are commonly found in soil and all are opportunistic pathogens espcially in cystic fibrosis patients. ...
Profile | Biosciences | University of ExeterProfile | Biosciences | University of Exeter
The species that presently constitute the Burkholderia cepacia complex (Bcc) have multiple roles; they include soil and water saprophytes, bioremediators, and plant, animal and human pathogens. Since the first description of pathogenicity in the Bcc was based on sour skin rot of onion bulbs, this study returned to this plant host to investigate the onion-associated phenotype of the Bcc. Many Bcc isolates, which were previously considered to be non-mucoid, produced copious amounts of exopolysaccharide (EPS) when onion tissue was provided as the sole nutrient. EPS production was not species-specific, was observed in isolates from both clinical and environmental sources, and did not correlate with the ability to cause maceration of onion tissue. Chemical analysis suggested that the onion components responsible for EPS induction were primarily the carbohydrates sucrose, fructose and fructans. Additional sugars were investigated, and all alcohol sugars tested were able to induce EPS production, in ...
Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia...Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia...
TY - JOUR. T1 - Reclassification of the Specialized Metabolite Producer Pseudomonas mesoacidophila ATCC 31433 as a Member of the Burkholderia cepacia Complex. AU - Loveridge, E Joel. AU - Jones, Cerith. AU - Bull, Matthew J. AU - Moody, Suzy C. AU - Kahl, Małgorzata W. AU - Khan, Zainab. AU - Neilson, Louis. AU - Tomeva, Marina. AU - Adams, Sarah E. AU - Wood, Andrew C. AU - Rodriguez-Martin, Daniel. AU - Pinel, Ingrid. AU - Parkhill, Julian. AU - Mahenthiralingam, Eshwar. AU - Crosby, John. N1 - Copyright © 2017 Loveridge et al.. PY - 2017/7/1. Y1 - 2017/7/1. N2 - Pseudomonas mesoacidophila ATCC 31433 is a Gram-negative bacterium, first isolated from Japanese soil samples, that produces the monobactam isosulfazecin and the β-lactam-potentiating bulgecins. To characterize the biosynthetic potential of P. mesoacidophila ATCC 31433, its complete genome was determined using single-molecule real-time DNA sequence analysis. The 7.8-Mb genome comprised four replicons, three chromosomal (each ...
Pre GI: GenePre GI: Gene
General Information: This organism (AU 1054) was isolated from the blood of a patient with CF. This microbe has three chromosomes. Opportunistic pathogen. This species (genomovar III) is part of the Burkholderia cepacia complex, which consists of 9 closely related species, also known as genomovars. These organisms are commonly found in soil and all are opportunistic pathogens espcially in cystic fibrosis patients. ...
Predicted Orthologs - RBBHPredicted Orthologs - RBBH
Please Note: Ortholuge cannot be used for certain RBB analyses involving closely-related strains (e.g. Burkholderia cenocepacia J2315 versus Burkholderia cenocepacia AU 1054) because the phylogenetic distance between each ingroup protein is very small in relation to the phylogenetic distance between each ingroup protein and the associated outgroup protein. In these cases, the "Ortholuge Classification" value will be left blank which indicates Ortholuge analysis was not peformed, however the two proteins may very well be orthologs. In other cases, only some rows will be missing Ortholuge classifications, which can occur when a suitable gene could not be found in the outgroup species ...
Priebe Laboratory | Boston Childrens HospitalPriebe Laboratory | Boston Children's Hospital
The Priebe Laboratory, located in the Enders Research Building of Boston Childrens Hospital, studies the bacterial pathogens Pseudomonas aeruginosa and the Burkholderia cepacia complex, with the long-term goal of developing vaccines and new antimicrobials. Techniques used in Priebes group span multiple fields, including microbiology, molecular biology, genomics, cellular and molecular immunology, and animal models of infection.. ...
orange complex bacteria (OCB) - Allie: Abbreviation / Long Form Info.orange complex bacteria (OCB) - Allie: Abbreviation / Long Form Info.
Search for abbreviations and long forms in lifescience, results along with the related PubMed / MEDLINE information and co-occurring abbreviations.
Burkholderia ambifaria Putative membrane protein|gentaur.comBurkholderia ambifaria Putative membrane protein|gentaur.com
Product information: Burkholderia ambifaria Putative membrane protein insertion efficiency factor BamMC406_3100 - Gentaur.com - Product info
Grasses of the BCEP - Butte Creek Ecological Preserve - CSU, ChicoGrasses of the BCEP - Butte Creek Ecological Preserve - CSU, Chico
collected off of dredge tailings in a recently opened oak/brush woodland, north-east portion of preserve. not usually collected below 2500 ...
Scientific Articles - The International Burkholderia cepacia Working GroupScientific Articles - The International Burkholderia cepacia Working Group
Glowicz J, Crist M, Gould C, Moulton-Meissner H, Noble-Wang J, de Man TJB, Perry KA, Miller Z, Yang WC, Langille S, Ross J, Garcia B, Kim J, Epson E, Black S, Pacilli M, LiPuma JJ, Fagan R, B. cepacia Investigation Workgroup. 2018. A multistate investigation of health care-associated Burkholderia cepacia complex infections related to liquid docusate sodium contamination, January-October 2016. Am J Infect Control 46:649-655.. Brooks RB, Mitchell PK, Miller JR, Vasquez AM, Havlicek J, Lee H, Quinn M, Adams E, Baker D, Greeley R, Ross K, Daskalaki I, Walrath J, Moulton-Meissner H, Crist MB, Burkholderia cepacia Workgroup. 2018. Multistate Outbreak of Burkholderia cepacia Complex Bloodstream Infections After Exposure to Contaminated Saline Flush Syringes - United States, 2016-2017. Clin Infect Dis Off Publ Infect Dis Soc Am.. Becker SL, Berger FK, Feldner SK, Karliova I, Haber M, Mellmann A, Schäfers H-J, Gärtner B. 2018. Outbreak of Burkholderia cepacia complex infections associated with ...
Inhibition of co-colonizing cystic fibrosis-associated pathogens by Pseudomonas aeruginosa and Burkholderia multivorans. -...Inhibition of co-colonizing cystic fibrosis-associated pathogens by Pseudomonas aeruginosa and Burkholderia multivorans. -...
Cystic fibrosis (CF) is a recessive genetic disease characterized by chronic respiratory infections and inflammation causing permanent lung damage. Recurrent infections are caused by Gram-negative antibiotic-resistant bacterial pathogens such as Pseudomonas aeruginosa, Burkholderia cepacia complex (Bcc) and the emerging pathogen genus Pandoraea. In this study, the interactions between co-colonizing CF pathogens were investigated. Both Pandoraea and Bcc elicited potent pro-inflammatory responses that were significantly greater than Ps. aeruginosa. The original aim was to examine whether combinations of pro-inflammatory pathogens would further exacerbate inflammation. In contrast, when these pathogens were colonized in the presence of Ps. aeruginosa the pro-inflammatory response was significantly decreased. Real-time PCR quantification of bacterial DNA from mixed cultures indicated that Ps. aeruginosa significantly inhibited the growth of Burkholderia multivorans, Burkholderia cenocepacia, Pandoraea
Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...
In this study, we compare our results for a G. mellonella infection model with previously published BCC data from other infection models, taking care to use many of the identical BCC strains previously tested in order to ensure valid comparison. We observed that G. mellonella, as an infection model for the BCC, possessed several advantages over other infection models. Using G. mellonella, we obtained similar results to both mouse and other alternative infection models with identical BCC strains. In our experience, no other alternative infection models as tested were as sensitive, accurate (with respect to mice and rat lung model results), or as robust or simple to use as the G. mellonella model. This was despite the fact G. mellonella possesses a relatively complex innate immune response, which is lacking in plant infection models. Furthermore, due to ethical and regulatory issues, it is now difficult to perform LD50 experiments with mice. In addition, amoebae and C. elegans are somewhat more ...
WI67 05460 protein (Burkholderia cepacia) - STRING interaction networkWI67 05460 protein (Burkholderia cepacia) - STRING interaction network
Other names: ATCC 25416, B. cepacia, Burkholderia cepacia, Burkholderia cepacia genomovar I, CCUG 12691, CCUG 13226, CFBP 2227, CIP 80.24, DSM 7288, ICMP 5796, IFO 14074, JCM 5964, NBRC 14074, NCCB 76047, NCPPB 2993, NCTC 10743, NRRL B-14810, Pseudomonas cepacia, Pseudomonas kingii, Pseudomonas multivorans, strain 717-ICPB 25, strain Ballard 717 ...
WI67 11880 protein (Burkholderia cepacia) - STRING interaction networkWI67 11880 protein (Burkholderia cepacia) - STRING interaction network
Other names: ATCC 25416, B. cepacia, Burkholderia cepacia, Burkholderia cepacia genomovar I, CCUG 12691, CCUG 13226, CFBP 2227, CIP 80.24, DSM 7288, ICMP 5796, IFO 14074, JCM 5964, NBRC 14074, NCCB 76047, NCPPB 2993, NCTC 10743, NRRL B-14810, Pseudomonas cepacia, Pseudomonas kingii, Pseudomonas multivorans, strain 717-ICPB 25, strain Ballard 717 ...
Hong Kong investigates invasive Burkholderia cepacia cluster - Outbreak News TodayHong Kong investigates invasive Burkholderia cepacia cluster - Outbreak News Today
The affected persons involved eight males and one female aged 46 to 69, who were admitted to Caritas Medical Centre from February 2017 to August 2018 respectively for management. Among them, seven were discharged, one remains hospitalized and one passed away in 2017.. The clinical diagnoses of the patients were infective spondylitis (4), sepsis (2), septic arthritis (2) and infective endocarditis (1).. Separately, the Burkholderia cepacia isolates from seven of the nine patients were found to be genetically identical upon laboratory testing.. "Preliminary investigation revealed that all affected patients were people who injected drugs. Investigations are ongoing," a health department spokesman said.. Burkholderia cepacia is a bacteria which are commonly found in water, soil, and moist environments. It is generally not pathogenic to healthy person but those who have weakened immune system or chronic lung diseases may be more susceptible to infection with the bacteria.. The spokesman appealed that ...
Burkholderia cepacia (Palleroni and Holmes) Yabuuchi et al. ATCC ®Burkholderia cepacia (Palleroni and Holmes) Yabuuchi et al. ATCC ®
Burkholderia cepacia ATCC ® 17616D-5™ Designation: Genomic DNA from Burkholderia cepacia strain 249 TypeStrain=False Application:
The intracellular behaviour of Burkholderia cenocepacia in murine macrophages by Jennifer S. Tolman"The intracellular behaviour of Burkholderia cenocepacia in murine macrophages" by Jennifer S. Tolman
Burkholderia cenocepacia is an opportunistic pathogen causing life-threatening infections in cystic fibrosis and other immunocompromised patients. The bacterium survives within macrophages by interfering with typical endocytic trafficking, resulting in delayed maturation of a B. cenocepacia-containing phagosome. We hypothesize that B. cenocepacia alters gene expression after internalization by macrophages, inducing genes involved in intracellular survival and host adaptation. Furthermore, we hypothesize that specialized bacterial secretion systems are involved in the interactions between intracellular bacteria and macrophages. In this work, we characterize later-stage infection of macrophages by B. cenocepacia, showing replication within an acidified endosomal compartment suggestive of a phagolysosome. We examine differential gene expression by intracellular B. cenocepacia using selective capture of transcribed sequences (SCOTS) with both competitive enrichment and microarray analysis. We identified 766
Outcomes of lung transplantation for cystic fibrosis in a large UK cohort - Northumbria Research LinkOutcomes of lung transplantation for cystic fibrosis in a large UK cohort - Northumbria Research Link
Background: Lung transplantation is an important option to treat patients with advanced cystic fibrosis (CF) lung disease. The outcomes of a large UK cohort of CF lung transplantation recipients is reported.. Methods: Retrospective review of case notes and transplantation databases.. Results: 176 patients with CF underwent lung transplantation at our centre. The majority (168) had bilateral sequential lung transplantation. Median age at transplantation was 26 years. Diabetes was common pretransplantation (40%). Polymicrobial infection was common in individual recipients. A diverse range of pathogens were encountered, including the Burkholderia cepacia complex (BCC). The bronchial anastomotic complication rate was 2%. Pulmonary function (forced expiratory volume in 1 s % predicted) improved from a pretransplantation median of 0.8 l (21% predicted) to 2.95 l (78% predicted) at 1 year following transplantation. We noted an acute rejection rate of 41% within the first month. Our survival values were ...
British Library EThOS: Antimicrobial strategies against Burkholderia cepaciaBritish Library EThOS: Antimicrobial strategies against Burkholderia cepacia
The aim of this project was to investigate novel antimicrobial strategies against B. cepacia, based on natural antimicrobial compounds present in plants and human airways as protection against bacterial disease. The project focused on a panel of 20 strains of B. cepacia complex. Isolates included strains representing major epidemic clones of B. cepacia and exhibiting a range of susceptibilities to all classes of conventional antibiotics. The project is focused on two major themes. First, a study of antimicrobials from plants and second, examination of the antimicrobial activities of cationic peptides present in human airway secretions. The susceptibility of the B. cepacia strain panel to plant extracts was investigated, in particular the activity of aqueous garlic extract (AGE) and thyme oil. The MIC of thyme oil for all 20 strains was found to be 0.01%. MICs of AGE ranged from 0.25%-3%. Killing curves suggesting that AGE produces a slow killing effect over a twenty four hour period, whereas ...
Nurse Assist recalls I.V. Flush Syringes: Possibly linked to Burkholderia cepacia outbreak - Outbreak News TodayNurse Assist recalls I.V. Flush Syringes: Possibly linked to Burkholderia cepacia outbreak - Outbreak News Today
Nurse Assist voluntarily recalled its I.V. Flush Syringes after becoming aware of patients that developed Burkholderia cepacia bloodstream infections while receiving intravenous care using prepackaged saline flushes from Nurse Assist. Nurse Assist is notifying its distributors and customers via email, phone call, and certified mail. Customers will receive instructions for returning product. For freight collect shipping information, please contact the Customer Service Team at 1-800-649-6800 ext. 10.. Nurse Assist is actively investigating the possible link to the infections with the Food and Drug Administration, the U.S. Centers for Disease Control, and various state health departments to ensure that the products are safe for their intended use. Until an investigation can be completed, Nurse Assist urges all healthcare facilities with affected product to discontinue use and return the product to the supplier.. Consumers with questions may contact the company via telephone at 1-800-649-6800 ext. ...
SWISS-MODEL Repository | A0K321SWISS-MODEL Repository | A0K321
SWISS-MODEL Repository entry for A0K321 (GCSP_BURCH), Glycine dehydrogenase (decarboxylating). Burkholderia cenocepacia (strain HI2424)
Complex bacterium writes new evolutionary story | EurekAlert! Science NewsComplex bacterium writes new evolutionary story | EurekAlert! Science News
A University of Queensland-led international study has discovered a new type of bacterial structure which has previously only been seen in more complex cells. Research team leader UQ School of Chemistry and Molecular Biosciences microbiologist Emeritus Professor John Fuerst said the study had found pore-like structures in a bacterium called Gemmata obscuriglobus.
CiNii Articles - A cross-sectional study on the periodontal status and prevalence of red complex periodontal...CiNii Articles - A cross-sectional study on the periodontal status and prevalence of red complex periodontal...
p,This large-scale study cross-sectionally examined the periodontal status and prevalence of "red complex" bacteria (,i,Porphyromonas gingivalis,/i,, ,i,Treponema denticola,/i,, and ,i,Tannerella forsythia,/i,) in Japanese adults. A total of 977 participants were enrolled in the study. Probing depth (PD), bleeding on probing (BOP), and bone crest level (BCL) were recorded, and the presence of red complex bacteria in the saliva was examined using polymerase chain reaction. The mean BCL value and the percentage of sites with a PD ≥4 mm or the presence of BOP were significantly higher in older participants. The detection rates of ,i,P. gingivalis,/i,, ,i,T. denticola,/i,, and ,i,T. forsythia,/i, were 46.3%, 76.4%, and 61.1%, respectively. The ,i,P. ,i,gingivalis,/i, detection rate significantly increased with age, while those of ,i,T. denticola,/i, and ,i,T. forsythia,/i, were comparably high for all age groups. A close correlation between ,i,P. gingivalis,/i, and the percentage of sites with PD ...
Burkholderia cepacia NCTC 10661 | TM Media - Titan Biotech Ltd.Burkholderia cepacia NCTC 10661 | TM Media - Titan Biotech Ltd.
A valid e-mail address. All e-mails from the system will be sent to this address. The e-mail address is not made public and will only be used if you wish to receive a new password or wish to receive certain news or notifications by e-mail ...
Lyme Disease TherapiesLyme Disease Therapies
Borellia burgdorferi, the cause of Lyme disease, is a complex bacteria. Our naturopaths have the expertise to plan strategic therapies for effective treatment.
10 brands of baby wipes recalled due to pneumonia-causing bacteria contamination | Reclaim Our Republic10 brands of baby wipes recalled due to pneumonia-causing bacteria contamination | Reclaim Our Republic
November 11, 2014 by: Julie Wilson staff writer (NaturalNews) Ten brands of baby wipes produced by the Pennsylvania-based Nutek Disposables, Inc., were recalled on October 25, 2014, following complaints of foul odor and discoloration. Upon further testing, the baby wipe and adult washcloth manufacturer discovered that some of their products contained Burkholderia cepacia, a…
Survival curves for D. melanogaster infected with B. ce | Open-iSurvival curves for D. melanogaster infected with B. ce | Open-i
Survival curves for D. melanogaster infected with B. cenocepacia strains.Pricking assays were performed with a minimum of 30 flies for each strain. Statistical
perf-regression/margo-p2p-latency-avg-only.patch · 477c28bcc75f5800c32414b659ec142757c12e04 · sds / sds-tests · GitLabperf-regression/margo-p2p-latency-avg-only.patch · 477c28bcc75f5800c32414b659ec142757c12e04 · sds / sds-tests · GitLab
Test cases for the Mochi project. Includes regression tests that we may want to build separately from the actual Mochi components.
Povidone-iodinePovidone-iodine
Ceftazidime/avibactamCeftazidime/avibactam
Claire WainwrightClaire Wainwright
OsteomyelitisOsteomyelitis
Walter H. BurkholderWalter H. Burkholder
BCCBCC
List of MeSH codes (B03)List of MeSH codes (B03)
Human herpesvirus 6Human herpesvirus 6
Kronisk granulomatøs sygdom, den frie encyklopædiKronisk granulomatøs sygdom, den frie encyklopædi
BurkholderiaBurkholderia
Burkholderia arborisBurkholderia arboris
Burkholderia dolosaBurkholderia dolosa
Burkholderia territoriiBurkholderia territorii
Burkholderia anthinaBurkholderia anthina
Burkholderia metallicaBurkholderia metallica
Burkholderia pyrrociniaBurkholderia pyrrocinia
Burkholderia pseudomultivoransBurkholderia pseudomultivorans
Burkholderia seminalisBurkholderia seminalis
Burkholderia gladioliBurkholderia gladioli
Burkholderia latensBurkholderia latens
Burkholderia diffusaBurkholderia diffusa
Burkholderia contaminansBurkholderia contaminans
Burkholderia lataBurkholderia lata
Burkholderia cenocepaciaBurkholderia cenocepacia
Burkholderia cepacia complexBurkholderia cepacia complex
Urinary tract infectionUrinary tract infection
CholeraCholera
Travelers diarrheaTraveler's diarrhea
Meningococcal diseaseMeningococcal disease
Chromobacteriosis infectionChromobacteriosis infection
ടൈഫോയ്ഡ് - വിക്കിപീഡിയടൈഫോയ്ഡ് - വിക്കിപീഡിയ
ಜಠರ/ಜಠರೀಯ ಹುಣ್ಣು/ವ್ರಣ - ವಿಕಿಪೀಡಿಯಜಠರ/ಜಠರೀಯ ಹುಣ್ಣು/ವ್ರಣ - ವಿಕಿಪೀಡಿಯ
EnterobacteriaceaeEnterobacteriaceae
BetaproteobacteriaBetaproteobacteria
List of infectious diseasesList of infectious diseases
কলেরা - উইকিপিডিয়াকলেরা - উইকিপিডিয়া
List of parasites of humansList of parasites of humans
Klebsiella aerogenesKlebsiella aerogenes
Typhoid feverTyphoid fever
Peptic ulcer diseasePeptic ulcer disease
Neisseria meningitidisNeisseria meningitidis
Microbial symbiosis and immunityMicrobial symbiosis and immunity
Lung microbiomeLung microbiome
AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsAnthropology, Education, Sociology and Social PhenomenaTechnology, Industry, AgricultureInformation ScienceHealth Care
Burkholderia cepacia complexBurkholderia cepaciaBurkholderia InfectionsBurkholderiaCystic FibrosisBurkholderia cenocepaciaBurkholderia pseudomalleiRec A RecombinasesBacterial Typing TechniquesHydrogen CyanideOnionsDNA, BacterialSputumEnvironmental MicrobiologyBiofilmsPolymorphism, Restriction Fragment LengthPyrrolnitrinBenzethoniumMelioidosisOpportunistic InfectionsSequence Analysis, DNASodium BenzoateRNA, Ribosomal, 16SPolymerase Chain ReactionTobramycinRandom Amplified Polymorphic DNA Technique4-ButyrolactoneVirulencePhylogenyElectrophoresis, Gel, Pulsed-FieldMolecular Sequence DataSoil MicrobiologyQuorum SensingDNA, RibosomalAnti-Bacterial AgentsGram-Negative Bacterial InfectionsBacterial ProteinsSpecies SpecificityGenes, BacterialMicrobial ViabilityBurkholderia gladioliDNA FingerprintingMicrobial Sensitivity Tests2,4,5-Trichlorophenoxyacetic AcidCulture MediaGlandersPolysaccharides, BacterialDrug Resistance, BacterialGene Expression Regulation, BacterialGenome, BacterialVirulence FactorsBase SequencePseudomonasBiodegradation, EnvironmentalPseudomonas aeruginosaGenotype
Azithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.govAzithromycin in Patients With CF, Infected With Burkholderia Cepacia Complex - Full Text View - ClinicalTrials.gov
Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)Eradication therapy for Burkholderia cepacia complex in people with cystic fibrosis | European Cystic Fibrosis Society (ECFS)
Social interactions in the Burkholderia cepacia complex: biofilms and quorum sensing. - Semantic ScholarSocial interactions in the Burkholderia cepacia complex: biofilms and quorum sensing. - Semantic Scholar
burkholderia cepacia complex Archives - PacBioburkholderia cepacia complex Archives - PacBio
Burkholderia cepacia complex | Johns Hopkins ABX GuideBurkholderia cepacia complex | Johns Hopkins ABX Guide
Synthesis of 4-Amino-4-Deoxy-L-Arabinose C-Phosphonate Esters as Transferase Inhibitors | EUROCARB 2019Synthesis of 4-Amino-4-Deoxy-L-Arabinose C-Phosphonate Esters as Transferase Inhibitors | EUROCARB 2019
Targeting the bacterial cytoskeleton of CF pathogens for antimicrobial development - A cautionary tale? - ePrints - Newcastle...Targeting the bacterial cytoskeleton of CF pathogens for antimicrobial development - A cautionary tale? - ePrints - Newcastle...
Burkholderia cepacia complex - WikipediaBurkholderia cepacia complex - Wikipedia
The multifarious, multireplicon Burkholderia cepacia complex. - PubMed - NCBIThe multifarious, multireplicon Burkholderia cepacia complex. - PubMed - NCBI
Burkholderia cepacia complex Cervical Osteomyelitis in an Intravenous Drug UserBurkholderia cepacia complex Cervical Osteomyelitis in an Intravenous Drug User
Notice to Readers: Manufacturers Recall of Nasal Spray Contaminated with <I>Burkholderia cepacia<...Notice to Readers: Manufacturer's Recall of Nasal Spray Contaminated with <I>Burkholderia cepacia<...
Burkholderia cepacia complex - microbewikiBurkholderia cepacia complex - microbewiki
https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310https://www.thefreelibrary.com/Environmental+Burkholderia+cepacia+complex+isolates+in+human...-a0161011310
Epidemiology of Burkholderia cepacia complex in patients with cystic fibrosis, CanadaEpidemiology of Burkholderia cepacia complex in patients with cystic fibrosis, Canada
Pathogenicity, virulence factors, and strategies to fight against Burkholderia cepacia complex pathogens and related species |...Pathogenicity, virulence factors, and strategies to fight against Burkholderia cepacia complex pathogens and related species |...
Taxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical MicrobiologyTaxonomy and Identification of the Burkholderia cepacia Complex | Journal of Clinical Microbiology
Updated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical MicrobiologyUpdated Version of the Burkholderia cepacia Complex Experimental Strain Panel | Journal of Clinical Microbiology
Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from...Variation of the antimicrobial susceptibility profiles of Burkholderia cepacia complex clonal isolates obtained from...
Table 3 - Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous...Table 3 - Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous...
Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous Chlorhexidine -...Polyclonal Burkholderia cepacia Complex Outbreak in Peritoneal Dialysis Patients Caused by Contaminated Aqueous Chlorhexidine -...
PRIME PubMed | Management and outcomes of Burkholderia cepacia complex bacteremia in patients without cystic fibrosis: a...PRIME PubMed | Management and outcomes of Burkholderia cepacia complex bacteremia in patients without cystic fibrosis: a...
Biochemical and functional studies on the Burkholderia cepacia complex bceN gene, encoding a GDP-D-mannose 4,6-dehydratase. |...Biochemical and functional studies on the Burkholderia cepacia complex bceN gene, encoding a GDP-D-mannose 4,6-dehydratase. |...
Prevalence of Burkholderia cepacia complex species in cystic fibrosis patients in Argentina during the period 2011-2015 |...Prevalence of Burkholderia cepacia complex species in cystic fibrosis patients in Argentina during the period 2011-2015 |...
Outbreak of Burkholderia Cepacia Complex Bacteremia in a Chemotherapy Day Care Unit Due to Intrinsic Contamination of an...Outbreak of Burkholderia Cepacia Complex Bacteremia in a Chemotherapy Day Care Unit Due to Intrinsic Contamination of an...
Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...Which antibiotics are best to treat worsening symptoms in people with cystic fibrosis with persistent Burkholderia cepacia...
Allicin and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia...Allicin and allicin-containing garlic extracts possess inhibitory and bactericidal activities against the Burkholderia Cepacia...
Exposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmidExposing the third chromosome of Burkholderia cepacia complex strains as a virulence plasmid
Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...Development of Galleria mellonella as an Alternative Infection Model for the Burkholderia cepacia Complex | Infection and...
Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in...Localization of Burkholderia cepacia Complex Bacteria in Cystic Fibrosis Lungs and Interactions with Pseudomonas aeruginosa in...
In Vitro Activity of Ceftolozane-Tazobactam and Other Antimicrobial Agents against Burkholderia cepacia Complex and...In Vitro Activity of Ceftolozane-Tazobactam and Other Antimicrobial Agents against Burkholderia cepacia Complex and...
Production of the antifungal compound pyrrolnitrin is quorum sensing-regulated in members of the Burkholderia cepacia complex ...Production of the antifungal compound pyrrolnitrin is quorum sensing-regulated in members of the Burkholderia cepacia complex ...
Growth in Stewarts medium is a simple, rapid and inexpensive screening tool for the identification of Burkholderia cepacia...Growth in Stewart's medium is a simple, rapid and inexpensive screening tool for the identification of Burkholderia cepacia...
JCDR - Burkholderia cepacia complex, Mass spectrometry, Periprosthetic tissueJCDR - Burkholderia cepacia complex, Mass spectrometry, Periprosthetic tissue
Burkholderia cepacia Complex in Cystic Fibrosis: Frequency of Strain R by Scott A. Bernhardt, Theodore Spilker et al."Burkholderia cepacia Complex in Cystic Fibrosis: Frequency of Strain R" by Scott A. Bernhardt, Theodore Spilker et al.
AnatomyOrganismsDiseasesChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsAnthropology, Education, Sociology and Social PhenomenaTechnology, Industry, AgricultureInformation ScienceHealth Care
Burkholderia cepacia complexBurkholderia cepaciaBurkholderia InfectionsBurkholderiaCystic FibrosisBurkholderia cenocepaciaBurkholderia pseudomalleiRec A RecombinasesBacterial Typing TechniquesHydrogen CyanideOnionsDNA, BacterialSputumEnvironmental MicrobiologyBiofilmsPolymorphism, Restriction Fragment LengthPyrrolnitrinBenzethoniumMelioidosisOpportunistic InfectionsSequence Analysis, DNASodium BenzoateRNA, Ribosomal, 16SPolymerase Chain ReactionTobramycinRandom Amplified Polymorphic DNA Technique4-ButyrolactoneVirulencePhylogenyElectrophoresis, Gel, Pulsed-FieldMolecular Sequence DataSoil MicrobiologyQuorum SensingDNA, RibosomalAnti-Bacterial AgentsGram-Negative Bacterial InfectionsBacterial ProteinsSpecies SpecificityGenes, BacterialMicrobial ViabilityBurkholderia gladioliDNA FingerprintingMicrobial Sensitivity Tests2,4,5-Trichlorophenoxyacetic AcidCulture MediaGlandersPolysaccharides, BacterialDrug Resistance, BacterialGene Expression Regulation, BacterialGenome, BacterialVirulence FactorsBase SequencePseudomonasBiodegradation, EnvironmentalPseudomonas aeruginosaGenotype
CenocepaciaBacteriaOpportunisticGenomeInfectionBiofilmInhibitOnionViewTitleInfectionsPathogenMembers of the Burkholderia cepaciaGenusAntibioticOutbreaksGenomovarAmbifariaMicrobiologyTaxonomyInfection with Burkholderia cepaciaOutbreakVirulenceStrainOrganismsBacterialPathogenesisPulmonaryPeople with cystic fibrosisBacteremiaNosocomialColonizationPathogenicSyndromeEradicationBiofilmsClinicalIntrinsic contaminationAntimicrobial agentsGenomic
Cenocepacia1
Bacteria2
Opportunistic1
Genome2
  • Genome mining identifies cepacin as a plant-protective metabolite of the biopesticidal bacterium Burkholderia ambifaria. (pacb.com)
  • We applied phylogeny-led genome mining, metabolite analyses and biological control assays to define the efficacy of Burkholderia ambifaria, a naturally beneficial bacterium with proven biocontrol properties but potential pathogenic risk. (pacb.com)
Infection1
Biofilm1
Inhibit1
Onion1
View1
Title1
Infections20
Pathogen6
Members of the Burkholderia cepacia2
Genus3
Antibiotic9
Outbreaks3
Genomovar1
  • Although the clinician is faced with an increasingly complex nomenclature for Bcc, it is important to remember that the genomovar classification alone cannot predict clinical outcome in any individual patient. (cysticfibrosis.online)
Ambifaria3
  • Genome mining identifies cepacin as a plant-protective metabolite of the biopesticidal bacterium Burkholderia ambifaria. (pacb.com)
  • We applied phylogeny-led genome mining, metabolite analyses and biological control assays to define the efficacy of Burkholderia ambifaria, a naturally beneficial bacterium with proven biocontrol properties but potential pathogenic risk. (pacb.com)
  • For free-living, soil-borne Burkholderia ambifaria , genomic similarities responded to most of the spatial scales that the experimental sampling scheme could reveal, despite limited dispersal of the individuals. (pnas.org)
Microbiology2
  • The book was edited by Tom Coenye and myself and serves as an excellent update to the highly successful first book: "Burkholderia: molecular microbiology and genomics" ( http://www.horizonpress.com/backlist/horizonbioscience/burk.html ). (cardiff.ac.uk)
  • These episodes are probably related to a complex relationship between host defence and airway microbiology that impacts on sputum production and airflow obstruction. (bmj.com)
Taxonomy1
  • For microbiologists, hospital infection control officers, caregivers, and most of all the CF community, the changes in our understanding of the taxonomy, epidemiology and pathogenesis of the bacterium ' B. cepacia ' are complex. (microbiologyresearch.org)
Infection with Burkholderia cepacia2
Outbreak3
Virulence4
Strain3
Organisms2
  • Susceptible persons can acquire B. cepacia organisms through person-to-person contact, contact with contaminated surfaces, and exposure to it in the enviroment (i.e. soil and water) . (kenyon.edu)
  • Randomised and quasi-randomised controlled trials of treatments for exacerbations of pulmonary symptoms in people with cystic fibrosis chronically infected with organisms of the Burkholderia cepacia complex. (cochrane.org)
Bacterial3
Pathogenesis2
Pulmonary2
  • Pulmonary colonization of B. cepacia can cause accelerated decline in lung funtions and cause "cepacia syndrome," which is a progressive pneumonic illness that is fatal and essentially untreatable . (kenyon.edu)
  • Other glucose nonfermenters, like Stenotrophomonas maltophilia , Alcaligenes xylosoxidans , R. pickettii , and Burkholderia gladioli , can frequently be found as well, but their role in the decline of pulmonary function is unclear ( 14 , 19 , 30 ). (asm.org)
People with cystic fibrosis4
Bacteremia1
  • documented the increasing prevalence of " B. cepacia " colonization and infection in the Toronto, Canada, CF treatment center and described the so-called "cepacia syndrome," a severe progressive respiratory failure with bacteremia that occurs in about 20% of all infected CF patients. (asm.org)
Nosocomial1
Colonization3
  • Cases of B. cepacia complex infection or colonization associated with use of this product should be reported to the local or state health department and CDC, telephone 800-893-0485. (cdc.gov)
  • The first detailed description of the clinical significance of " B. cepacia " colonization and infection was published in 1984 ( 47 ). (asm.org)
  • Clustering of new cases in some centers and the decrease of colonization of new patients following segregation of colonized and noncolonized patients in other centers suggested that " B. cepacia " could be transmitted between CF patients. (asm.org)
Pathogenic1
  • Burkholderia cepacia complex should be considered among pathogenic etiologies of pyogenic vertebral osteomyelitis, particularly among patients with intravenous drug use. (hindawi.com)
Syndrome2
Eradication1
Biofilms2
Clinical3
Intrinsic contamination1
Antimicrobial agents1
  • Since " B. cepacia " is resistant to most antimicrobial agents, effective therapies are not straightforward and management efforts are therefore aimed at prevention of infection ( 35 , 63 ). (asm.org)
Genomic1
  • This study highlights how genomic characterization of Burkholderia prophages can lead to the discovery of novel bacteriophages with potential therapeutic or biotechnological applications. (mdpi.com)