A sedative and mild hypnotic with potentially toxic effects.
The principal alkaloid in opium and the prototype opiate analgesic and narcotic. Morphine has widespread effects in the central nervous system and on smooth muscle.
A hypnotic and sedative used in the treatment of INSOMNIA.
Compounds with activity like OPIATE ALKALOIDS, acting at OPIOID RECEPTORS. Properties include induction of ANALGESIA or NARCOSIS.
The action of a drug that may affect the activity, metabolism, or toxicity of another drug.
Introduction of therapeutic agents into the spinal region using a needle and syringe.
Methods of PAIN relief that may be used with or in place of ANALGESICS.
A specific opiate antagonist that has no agonist activity. It is a competitive antagonist at mu, delta, and kappa opioid receptors.
The dynamic collection of metabolites which represent a cell's or organism's net metabolic response to current conditions.
Sweat-producing structures that are embedded in the DERMIS. Each gland consists of a single tube, a coiled body, and a superficial duct.
A compound formed in the liver from ammonia produced by the deamination of amino acids. It is the principal end product of protein catabolism and constitutes about one half of the total urinary solids.
The systematic identification and quantitation of all the metabolic products of a cell, tissue, organ, or organism under varying conditions. The METABOLOME of a cell or organism is a dynamic collection of metabolites which represent its net response to current conditions.
The fluid excreted by the SWEAT GLANDS. It consists of water containing sodium chloride, phosphate, urea, ammonia, and other waste products.
A nutritional condition produced by a deficiency of magnesium in the diet, characterized by anorexia, nausea, vomiting, lethargy, and weakness. Symptoms are paresthesias, muscle cramps, irritability, decreased attention span, and mental confusion, possibly requiring months to appear. Deficiency of body magnesium can exist even when serum values are normal. In addition, magnesium deficiency may be organ-selective, since certain tissues become deficient before others. (Harrison's Principles of Internal Medicine, 12th ed, p1936)
Debris resulting from a process that is of no further use to the system producing it. The concept includes materials discharged from or stored in a system in inert form as a by-product of vital activities. (From Webster's New Collegiate Dictionary, 1981)
Sensation of enjoyment or gratification.
A contagious disease caused by canine adenovirus (ADENOVIRUSES, CANINE) infecting the LIVER, the EYE, the KIDNEY, and other organs in dogs, other canids, and bears. Symptoms include FEVER; EDEMA; VOMITING; and DIARRHEA.
Diseases of the domestic dog (Canis familiaris). This term does not include diseases of wild dogs, WOLVES; FOXES; and other Canidae for which the heading CARNIVORA is used.
Substances which, when ingested, inhaled, or absorbed, or when applied to, injected into, or developed within the body in relatively small amounts may, by their chemical action, cause damage to structure or disturbance of function. (From Dorland, 27th ed)
Books designed to give factual information or instructions.
Images used to comment on such things as contemporary events, social habits, or political trends; usually executed in a broad or abbreviated manner.
Ulceration of the GASTRIC MUCOSA due to contact with GASTRIC JUICE. It is often associated with HELICOBACTER PYLORI infection or consumption of nonsteroidal anti-inflammatory drugs (NSAIDS).
A broad-spectrum semisynthetic antibiotic similar to AMPICILLIN except that its resistance to gastric acid permits higher serum levels with oral administration.
A fixed-ratio combination of amoxicillin trihydrate and potassium clavulanate.
Substances that reduce the growth or reproduction of BACTERIA.
A group of antibiotics that contain 6-aminopenicillanic acid with a side chain attached to the 6-amino group. The penicillin nucleus is the chief structural requirement for biological activity. The side-chain structure determines many of the antibacterial and pharmacological characteristics. (Goodman and Gilman's The Pharmacological Basis of Therapeutics, 8th ed, p1065)
The interchange of goods or commodities, especially on a large scale, between different countries or between populations within the same country. It includes trade (the buying, selling, or exchanging of commodities, whether wholesale or retail) and business (the purchase and sale of goods to make a profit). (From Random House Unabridged Dictionary, 2d ed, p411, p2005 & p283)
An organ of digestion situated in the left upper quadrant of the abdomen between the termination of the ESOPHAGUS and the beginning of the DUODENUM.
An element with the atomic symbol Se, atomic number 34, and atomic weight 78.96. It is an essential micronutrient for mammals and other animals but is toxic in large amounts. Selenium protects intracellular structures against oxidative damage. It is an essential component of GLUTATHIONE PEROXIDASE.
A mosquito-borne encephalitis caused by the Japanese B encephalitis virus (ENCEPHALITIS VIRUS, JAPANESE) occurring throughout Eastern Asia and Australia. The majority of infections occur in children and are subclinical or have features limited to transient fever and gastrointestinal symptoms. Inflammation of the brain, spinal cord, and meninges may occur and lead to transient or permanent neurologic deficits (including a POLIOMYELITIS-like presentation); SEIZURES; COMA; and death. (From Adams et al., Principles of Neurology, 6th ed, p751; Lancet 1998 Apr 11;351(9109):1094-7)
An imperfect fungus present on most agricultural seeds and often responsible for the spoilage of seeds in bulk storage. It is also used in the production of fermented food or drink, especially in Japan.
A species of FLAVIVIRUS, one of the Japanese encephalitis virus group (ENCEPHALITIS VIRUSES, JAPANESE), which is the etiological agent of Japanese encephalitis found in Asia, southeast Asia, and the Indian subcontinent.
Inorganic chemicals that contain manganese as an integral part of the molecule.
Vaccines or candidate vaccines used to prevent infection with Japanese B encephalitis virus (ENCEPHALITIS VIRUS, JAPANESE).
A plant species of the genus IPOMOEA, family CONVOLVULACEAE. Some cultivars are sweet and edible whereas bitter varieties are a source of SAPONINS. This sweet potato is sometimes referred to as a yam (DIOSCOREA).
Compounds that include the amino-N-phenylamide structure.
A selective pre- and post-emergence herbicide. (From Merck Index, 11th ed)
A primary malignant neoplasm of epithelial liver cells. It ranges from a well-differentiated tumor with EPITHELIAL CELLS indistinguishable from normal HEPATOCYTES to a poorly differentiated neoplasm. The cells may be uniform or markedly pleomorphic, or form GIANT CELLS. Several classification schemes have been suggested.
Pesticides used to destroy unwanted vegetation, especially various types of weeds, grasses (POACEAE), and woody plants. Some plants develop HERBICIDE RESISTANCE.
A family of gram-negative aerobic bacteria in the class BETA PROTEOBACTERIA, encompassing the acidovorans rRNA complex. Some species are pathogenic for PLANTS.
Urea compounds which are substituted with one or more methyl groups.
A pre-emergent herbicide.
Compensatory plans designed to motivate physicians in relation to patient referral, physician recruitment, and efficient use of the health facility.
Concept referring to the standardized fees for services rendered by health care providers, e.g., laboratories and physicians, and reimbursement for those services under Medicare Part B. It includes acceptance by the physician.
A scheme which provides reimbursement for the health services rendered, generally by an institution, and which provides added financial rewards if certain conditions are met. Such a scheme is intended to promote and reward increased efficiency and cost containment, with better care, or at least without adverse effect on the quality of the care rendered.
The remuneration paid or benefits granted to an employee.
Any group of three or more full-time physicians organized in a legally recognized entity for the provision of health care services, sharing space, equipment, personnel and records for both patient care and business management, and who have a predetermined arrangement for the distribution of income.
Health insurance plans intended to reduce unnecessary health care costs through a variety of mechanisms, including: economic incentives for physicians and patients to select less costly forms of care; programs for reviewing the medical necessity of specific services; increased beneficiary cost sharing; controls on inpatient admissions and lengths of stay; the establishment of cost-sharing incentives for outpatient surgery; selective contracting with health care providers; and the intensive management of high-cost health care cases. The programs may be provided in a variety of settings, such as HEALTH MAINTENANCE ORGANIZATIONS and PREFERRED PROVIDER ORGANIZATIONS.
The act, process, or an instance of narrating, i.e., telling a story. In the context of MEDICINE or ETHICS, narration includes relating the particular and the personal in the life story of an individual.

Determination of (+)- and (-)-bromoisovalerylurea in sera of overdosed subjects. (1/10)

Bromoisovalerylurea (bromisovalum) is a sedative-hypnotic given orally as a racemic mixture of optical isomers (i.e., (+)- and (-)-enantiomer) and frequently taken in overdose in order to commit suicide. Sera from 16 overdosed subjects were analyzed for each enantiomer by high-performance liquid chromatography on chiral stationary phases. The (+)-enantiomer concentration was lower than the (-)-enantiomer concentration in all specimens, that is, the ratio of the (+)-enantiomer to the total concentration ranged from about 50% to 0%. The ratio of the (+)-enantiomer was continuously decreasing in each subject. The data indicate that the drug in gastrointestinal tract was absorbed into blood nonstereoselectively and that the drug in blood was eliminated stereoselectively. The enantioselective determination of this drug will give useful information on absorption and elimination.  (+info)

Relationship between glutathione content in liver and glutathione conjugation rate in the rat in vivo. Effect of buthionine sulphoximine pretreatment on conjugation of the two 2-bromoisovalerylurea enantiomers during intravenous infusion. (2/10)

The relationship between hepatic glutathione content and hepatic glutathione conjugation rate in the rat in vivo was investigated. As substrate for glutathione conjugation, racemic (R,S)-2-bromoisovalerylurea (BIU) was used which gives rise to the biliary excretion of two diastereoisomeric glutathione conjugates and the urinary excretion of two diastereoisomeric mercapturates. The excretion rate of the glutathione conjugate in bile reflects hepatic conjugation exclusively. An intravenous infusion of BIU was given and the excretion rates of the metabolites in bile and urine were determined. The glutathione concentration in the liver was followed by taking biopsies every hour. Glutathione was depleted by the infused substrate; in rats that were pretreated with the inhibitor of glutathione biosynthesis, buthionine sulphoximine (BSO), the depletion of the glutathione content was more rapid. The rate of excretion of the glutathione conjugate in bile was plotted against hepatic glutathione content. These results indicate that the 'organ Km' for glutathione in the liver is approximately 0.5 mumol/g of liver, so that the hepatic glutathione conjugation rate is decreased only at severe glutathione depletion.  (+info)

Method for screening and quantitative determination of serum levels of salicylic Acid, acetaminophen, theophylline, phenobarbital, bromvalerylurea, pentobarbital, and amobarbital using liquid chromatography/electrospray mass spectrometry. (3/10)

We investigated a method for the simultaneous screening, identification, and quantitative determination of salicylic acid, acetaminophen, theophylline, barbiturates, and bromvalerylurea, drugs that frequently cause acute poisoning in Japan and therefore require rapid analysis for effective treatment in the clinical setting. The method employs liquid chromatography/electrospray mass spectrometry (LC/MS) of solid-phase extracted serum samples. For LC/MS ionization, the electrospray-ionization method was used, with acetaminophen in the positive-ion mode, and salicylic acid, theophylline, phenobarbital, bromvalerylurea, pentobarbital, amobarbital, and o-acetamidophenol (internal standard) in the negative-ion mode, the base ions were used in each case for quantitative analysis. Quantitation was possible for the following sample concentration ranges: salicylic acid and acetaminophen, 100 to 5 microg/ml; theophylline, 100 to 0.5 microg/ml; and phenobarbital, bromvalerylurea, pentobarbital, and amobarbital, 100 to 1 microg/ml. Using full-scan mass spectrometry, the lower detection limits of 1 microg/ml for salicylic acid and acetaminophen, 0.1 microg/ml for theophylline, and 0.5 microg/ml for phenobarbital, bromvalerylurea, pentobarbital, and amobarbital were adequate for identifying acute poisoning. When each compound was added to serum to a final concentration of 5 microg/ml and solid-phase extraction was performed using Oasis HLB 1-cc (30-mg), the mean recovery rate of each compound was 89.2 to 96.1% (n=5), and the coefficients of variation of the intraday and interday assays were 3.55 to 6.05% (n=5) and 3.68 to 6.38% (n=5), respectively, which are acceptable. When this method of analysis was applied in testing the sera of a female patient who had consumed a large amount of an unknown commercial drug, salicylic acid and bromvalerylurea were identified, and the treatment strategy could be determined in accordance with the serum concentration of those drugs.  (+info)

Stereoselectivity in the urinary excretion of the mercapturates of (R-) and (S-) alpha-bromoisovalerylurea in man. (4/10)

1. alpha-Bromoisovalerylurea (BIU) is a racemic drug that is metabolized by glutathione conjugation. The urinary excretion of the separate diastereomeric mercapturates formed from (S)- and (R)-BIU in healthy young human volunteers was investigated. 2. A pronounced stereoselectivity was observed: the mercapturate formed from R-BIU was excreted with a t1/2 of 1.5 +/- 0.4 h, while that from S-BIU showed a t1/2 of 3.1 +/- 1.3 h. Moreover, 22.5 +/- 4.3 and 5.7 +/- 1.6% of the dose, respectively, was excreted as each mercapturate diastereomer in 24 h. 3. This is the first example of stereoselectivity in the elimination of a substrate for glutathione conjugation in man.  (+info)

Stereoselectivity of rat liver glutathione transferase isoenzymes for alpha-bromoisovaleric acid and alpha-bromoisovalerylurea enantiomers. (5/10)

The stereoselectivity of purified rat GSH transferases towards alpha-bromoisovaleric acid (BI) and its amide derivative alpha-bromoisovalerylurea (BIU) was investigated. GSH transferase 2-2 was the only enzyme to catalyse the conjugation of BI and was selective for the (S)-enantiomer. The conjugation of (R)- and (S)-BIU was catalysed by the isoenzymes 2-2, 3-3 and 4-4. Transferase 1-1 was less active, and no catalytic activity was observed with transferase 7-7. Isoenzymes 1-1 and 2-2 of the Alpha multigene family preferentially catalysed the conjugation of the (S)-enantiomer of BIU (and BI), whereas isoenzymes 3-3 and 4-4 of the Mu multigene family preferred (R)-BIU. The opposite stereoselectivity of conjugation of BI and BIU previously observed in isolated rat hepatocytes and the summation of activities of enzymes known to be present in hepatocytes on the basis of present data are in accord.  (+info)

Cerebellar atrophy due to chronic bromisovalum abuse demonstrated by computed tomography. (6/10)

Two patients with a severe cerebellar syndrome due to chronic bromisovalum usage are described. In both patients CT scan revealed severe cerebellar atrophy. The value of computed tomography in detecting irreversible cerebellar lesions due to bromisovalum is discussed.  (+info)

Cerebellar ataxia and peripheral neuropathy due to chronic bromvalerylurea poisoning. (7/10)

A patient with chronic bromvalerylurea poisoning showed cerebellar ataxia and peripheral neuropathy. The patient was a 42-year-old Japanese man who developed consciousness disturbance, diplopia, slurred speech, ataxia and gait disturbance after having taken bromvalerylurea for ten years. Magnetic resonance imaging revealed atrophy of the cerebellum and pontine tegmentum. An electrophysiological study revealed decreased motor nerve conduction velocity and amplitude of compound muscle action potentials of the right tibial nerve. Histological findings of the left sural nerve indicated a slightly decreased large myelinated fiber diameter, which suggested chronic axonal damage.  (+info)

Chronic bromvalerylurea intoxication: dystonic posture and cerebellar ataxia due to nonsteroidal anti-inflammatory drug abuse. (8/10)

Nalon-Ace and other nonsteroidal anti-inflammatory drugs (NSAID) containing bromvalerylurea (BVU) are sold as over-the-counter (OTC) drugs and are obtainable without prescription in Japan. A 32-year-old woman was diagnosed as having chronic BVU intoxication due to habitual use of Nalon-Ace. In addition to cerebellar ataxia and pyramidal signs well known in this condition, she showed an as yet non-described dystonic posture of the neck. Laboratory tests revealed an elevated concentration of serum organic bromide, iron deficiency anemia, and hyperchloremia. Brain magnetic resonance imaging (MRI) revealed definite cerebellar atrophy. We should consider the possibility of chronic BVU intoxication in peculiar neurological cases like ours.  (+info)

Wyatt Technology, the world leader in absolute macromolecular characterization instrumentation and software, showcased its Möbiuζ® electrophoretic mobility instrument, at Pittcon 2013, Philadelphia, PA. The instrument incorporates several patent-pending innovations to realize fast and reliable measurements of macromolecular charge. Besides being capable of swiftly measuring mobilities of large particles such as liposomes and VLPs, Wyatt Technologys Möbiuζ is the only laser-based instrum
Predictive in vitro methods to investigate drug metabolism in the human intestine using intact tissue are of high importance. Therefore, we studied the metabolic activity of human small intestinal and colon slices and compared it with the metabolic activity of the same human intestinal segments using the Ussing chamber technique. The metabolic activity was evaluated using substrates to both phase I and phase II reactions: testosterone, 7-hydroxycoumarin (7HC), and a mixture of cytochrome P450 (P450) substrates (midazolam, diclofenac, coumarin, and bufuralol). In slices of human proximal jejunum, the metabolic activity of several P450-mediated and conjugation reactions remained constant up to4hof incubation. In the colon slices, conjugation rates were virtually equal to those in small intestine, whereas P450-mediated conversions occurred much slower. In both organs, morphological evaluation and ATP content implied tissue integrity within this period. P450 conversions using the Ussing chamber ...
chains in the Genus database with same CATH superfamily 2WI4 A; 3A0T A; 4BAE A; 4MOT A; 5J71 A; 1US7 A; 2WI7 A; 4NH8 A; 5CPH A; 1Y8O A; 3RKZ A; 2XJX A; 2YE3 A; 3MNR P; 3ZKD A; 2AKP A; 5F3K A; 2Q8I A; 1NHH A; 2ZDX A; 4XIQ A; 2BT0 A; 2BU6 A; 3INW A; 3PEJ A; 2YEF A; 2Q8H A; 1YC1 A; 2BZ5 A; 2WI1 A; 3CRK A; 3OMU A; 4BXI A; 2XX5 A; 4YKX A; 2BU8 A; 4CWQ A; 4WUC A; 4R3A A; 4U7O A; 4WUD A; 4PU9 A; 1ZXM A; 4E00 A; 4EFT A; 3O0I A; 1ZXN A; 4PL9 A; 2YI0 A; 1Y8N A; 2YKI A; 1KIJ A; 4O09 A; 4EEH A; 2WI3 A; 4ASB A; 4DUH A; 1TH8 A; 3BMY A; 2YGA A; 2YEG A; 4XCL A; 1I59 A; 3U2K A; 2YKJ A; 4B6C A; 2IOR A; 1UYM A; 3U67 A; 2BU2 A; 2XAB A; 1B63 A; 4XKK A; 4E01 A; 3T0Z A; 4EGH A; 2ESA A; 4I5S A; 3TZ2 A; 4BIU A; 2YKE A; 2JJC A; 2FYP A; 2CH4 A; 4ASF A; 3B25 A; 5L3J A; 2GQP A; 4URO A; 1S14 A; 3A0Y A; 4GCZ A; 3H80 A; 3VHA A; 1THN A; 3C11 A; 2FXS A; 3A0X A; 4QPJ A; 1ID0 A; 3GIF A; 1Z5A A; 1UY7 A; 3WHA A; 1QZR A; 5D7R A; 3CGY A; 4GEE A; 4R1F A; 1AH6 A; 1EI1 A; 1QY8 A; 4CWS A; 2XHR A; 4HZ0 A; 4CE2 A; 4L91 A; 2XDL A; 3EHJ A; ...
An invited post by Erwin Montgomery, M.D., and Michele A. Basso, Ph.D., University of Wisconsin, Madison. Based in part on some of the findings of altered learning in rodent models, a primate model of dystonia was developed. This model revealed that repetitive stimulation of fingers not normally stimulated together resulted in dystonic postures of the…
https://bullyjunkies.com/index.php/forum/donec-eu-elit/34644-hook-up-sites-654#32486 http://lumous.ru/forum/viewtopic.php?f=3&t=620&p=111443#p1…
Alex Evers, MD, Chair of the IARS Board of Trustees says: We are enthused that Dr. Vetter will be joining Dr. Pittet and Anesthesia & Analgesia as the Journals Deputy Editor-in-Chief. Dr. Vetters skill set nicely complements Dr. Pittets and brings additional strength to an already robust editorial board. The IARS Board of Trustees is confident that the new editorial team will build upon Dr. Shafers legacy of creativity and innovation, as well as expanding our Journal into new areas and creating new opportunities for authors ...
chains in the Genus database with same CATH superfamily 3UAI C; 2RFK C; 2EY4 C; 3MQK C; 2HVY B; 2V3M A; 2EQN A; 3U28 C; #chains in the Genus database with same CATH topology 3SUF A; 2AEI H; 5DP8 A; 3WY8 A; 1OWI A; 2ZU5 A; 3KHV A; 4Y11 E; 1SGF G; 1NBM D; 3Q3X A; 1C2H A; 4IN1 A; 3RM0 H; 1ZZZ A; 3KQE A; 1GHY H; 1MMJ N; 1TOC B; 3N7E A; 3M5M A; 2R3Y A; 1TPP A; 2P3T B; 5C0U A; 1SOT A; 1GBH A; 2PKS B; 3QX5 H; 3FO8 D; 1ZMN A; 3IIT A; 1C5P A; 4KEL A; 5L2Z H; 1K0H A; 1QGF A; 2THF B; 3GDU A; 5F8Z A; 2KM0 A; 2A4Q A; 1P9S A; 1TMB H; 2ZGX H; 3S9C A; 2ZC9 H; 1O5F H; 1FY1 A; 2BD4 A; 1KLJ H; 3MU8 A; 2OUA A; 3SGB E; 4O9V A; 3K6Z A; 3NK8 A; 4X6M A; 3BIU H; 5JB8 S; 1HDT H; 3URE A; 2DE8 A; 1QRX A; 1OKX A; 4Y8Z A; 1CU1 A; 1EOL A; 1F92 A; 4M7G A; 4B76 A; 1YPL H; 1K22 H; 4I31 A; 1O2K A; 3PLP A; 2FM2 A; 4B73 A; 4I7Y H; 1O5C B; 1OWJ A; 1DFP A; 5IDK A; 4Y8Y A; 4I33 A; 3ZVB A; 1W0Z U; 3RXC A; 1ZGV A; 1XUF A; 1KMH B; 1O2W A; 2C4F H; 4TY6 A; 8KME 2; 1CSO E; 2VID A; 4SGA E; 2DE9 A; 1CE5 A; 5A2M H; 2B8O H; 3M36 A; 4Q7X A; 5T6G ...
The species differences in the bioactivation of FBM are significant and could contribute to an explanation of selective toxicity in humans as compared with rats. The major metabolites of FBM in rats are p-hydroxyfelbamate (37%) and 2-hydroxyfelbamate (25%), (Kucharczyk, 1995) (Fig. 1). A significant portion of the parent drug is also excreted as unchanged drug (32%), (Kucharczyk, 1995). The major metabolites of FBM in humans are MCF-glucuronide (11%), CPPA (13%), and atropaldehyde excreted as mercapturates (6%). As in rats, a significant amount of the FBM is excreted as unchanged drug (47%), (Kucharczyk, 1995). Given the hypothesis that atropaldehyde is the toxic metabolite in FBM bioactivation, a decrease in its production should protect from FBM toxicity.. Our data (Fig. 1) indicate that rats demonstrate a protective metabolism of FBM generating less atropaldehyde (1%). The minor formation of atropaldehyde in rats results from a number of factors including: 1) significant contribution from ...
Early Illustrations of Geste Antagoniste (sensory tricks) in Cervical and Generalized Dystonia. December, 2016. Geste antagoniste, or sensory trick, is a voluntary maneuver that temporarily reduces the severity of dystonic postures or movements. We present a historical review of early reports and illustrations of geste antagoniste. Continue Reading. ...
When a single dose of 2 mg labelled ethylene oxide in propanediol/kg body weight was applied intraperitoneally to rats, 43% of the administered radioactivity was excreted in the urine within 50 h (41% within 24 h) of exposure, 9% as S-(2- hydroxyethyl)cysteine and 33% as N-acetyl- S-(2-hydroxyethyl) cysteine, both products of glutathione conjugation. Via the lungs, 1.5% was excreted as carbon dioxide and 1% as unmetabolized ethylene oxide (Jones & Wells, 1981). The involvement of glutathione-epoxide- S-transferase (EC 4.4.1.7) has not been investigated further. In vitro glutathione conjugation of the homologue propylene oxide was shown to proceed only in the presence of an enzyme (Fjellstedt et al., 1973). In rabbits, no effect was found on liver- and blood-glutathione levels, after 12 weeks of exposure to concentrations of ethylene oxide at 18, 90, or 450 mg/m3, for 5 days per week, 6 h per day (Yager & Benz, 1982). As ethylene oxide can react with chloride ions, and this reaction is acid ...
Printing facilities are available only to students of the Chemistry Department.. Personal advice. Consulting service is designed to give individual assistance by appointment for academic staff and graduate students who write a thesis or doctoral dissertations.. The meetings include a diagnosis of the researchers information needs, guidance for searches and locating of required information items.. For coordination please contact the library: 03-531-8308 or 03-7384450. or by e-mail:. [email protected] [email protected] Trainings The service is designed to give individual support in using the library resources, such as the library catalog, databases and other librarys tools, for students and for academic/administrative staff. Remote Consulting. You can address your questions to the library staff via e-mail:. [email protected] [email protected] or by Tel.: 03-5318308 or 03-7384450, Sun-Thu between 9 a.m.-5.45 p.m. ...
Title:Formation of A Novel Purine Metabolite through CYP3A4 Bioactivation and Glutathione Conjugation. VOLUME: 10 ISSUE: 2. Author(s):Julius L. Apuy, Cathie Xiang, Sarah Franc, Sayee G. Hegde, Robert Hubbard, Jingjing Zhao and Mehran F. Moghaddam. Affiliation:Celgene Corporation, 10300 Campus Point Dr, Suite 100, San Diego, CA 92121, USA.. Keywords:Biotransformation, CYP, drug discovery, glutathione, mass spectrometry, metabolite identification, metabolism, novel, NMR, purine, structural elucidation.. Abstract:Background: The study of novel sites of metabolism is important in understanding new mechanisms of biotransformation of a particular moiety by metabolic enzymes. This information is valuable in designing metabolically-stable compounds with drug-like properties. It may also provide insights into the existence of active and reactive metabolites. Methods: We utilized small scale incubations to generate adequate amounts of the metabolite of interest. After purification, LC-MS/MS and Proton ...
TY - JOUR. T1 - The ubiquitin-conjugating enzyme UBCH7 acts as a coactivator for steroid hormone receptors. AU - Verma, Seema. AU - Ismail, Ayesha. AU - Gao, Xiuhua. AU - Fu, Guilian. AU - Li, Xiaotao. AU - OMalley, Bert W.. AU - Nawaz, Zafar. PY - 2004/10/1. Y1 - 2004/10/1. N2 - We investigated the role of the ubiquitin-conjugating enzyme UBCH7 in nuclear receptor transactivation. Using transient transfection assays, we demonstrated that UBCH7 modulates the transcriptional activity of progesterone receptor (PR) and glucocorticoid, androgen, and retinoic acid receptors in a hormone-dependent manner and that the ubiquitin conjugation activity of UBCH7 is required for its ability to potentiate transactivation by steroid hormone receptors (SHR). However, UBCH7 showed no significant effect on the transactivation functions of p53 and VP-16 activation domain. Depletion of endogenous UBCH7 protein by small interfering RNAs suggests that UBCH7 is required for the proper function of SHR. Furthermore, a ...
BackgroundMyoclonus-dystonia is an autosomal dominantly inherited movement disorder, clinically characterized by myoclonic jerks and dystonic postures or moveme
TY - JOUR. T1 - Effect of L-buthionine-(S,R)-sulphoximine, an inhibitor of γ-glutamylcysteine synthetase on peroxynitrite- and endotoxic shock-induced vascular failure. AU - Cuzzocrea, Salvatore. AU - Zingarelli, Basilia. AU - OConnor, Michael. AU - Salzman, Andrew L.. AU - Szabo, Csaba. PY - 1998. Y1 - 1998. N2 - 1. Peroxynitrite, a cytotoxic oxidant formed from the reaction of nitric oxide (NO) and superoxide is a mediator of cellular injury in ischaemia/reperfusion injury, shock and inflammation. Here we investigated whether L-buthionine-(S,R)-sulphoximine (BSO), an inhibitor of γ-glutamylcysteine synthetase, alters endothelial and vascular smooth muscle injury in response to peroxynitrite in vitro and during endotoxic shock in vivo. 2. In human umbilical vein endothelial cells and in rat aortic smooth muscle cells, BSO (1 mM, for 24 h) enhanced, whereas glutathione (3 mM) or glutathione ethyl ester (3mM) attenuated the peroxynitrite (100-1000 μM)-induced suppression of mitochondrial ...
TY - JOUR. T1 - Characterization of a class alpha glutathione-S-transferase with glutathione peroxidase activity in human liver microsomes. AU - Prabhu, Kumble Sandeep. AU - Reddy, Padala V.. AU - Jones, Emily C.. AU - Liken, Andrew D.. AU - Reddy, C. Channa. PY - 2004/4/1. Y1 - 2004/4/1. N2 - A 25.5kDa class alpha glutathione S-transferase (GST) designated as microsomal Ya-GST or M-GSTA has been purified to electrophoretic homogeneity from human liver microsomes. Limited proteolysis, gel filtration chromatography followed by EDTA, and alkaline Na2CO3 treatments of microsomes indicate that the M-GSTA is intrinsic to the microsomes. Western immunoblot analysis revealed that human liver M-GSTA and the previously reported 17-kDa microsomal GST (FEBS Lett. 315 (1993) 77) did not have immunological cross reactivity. The enzyme showed conjugation activity towards substrates like 1-chloro-2,4-nitrobenzene (CDNB) and 7-chloro-4-nitrobenzo-2- oxa-1,3-diazole, and 4-hydroxy-2-nonenal (4-HNE), a genotoxic ...
Pero, Elovi,Enny its clear that you all are from a dysfunctional family. You come on a blog and insult your president? I am typical unhappy with what is happening but I will blame the whole Northerner who hid their jihadist sons and daughters and now it has escalated. Yaradua did not have to go to the creek but the Niger Deltan went in to beg their brothers and they accepted amnesty. You saw it on TV when they where submitting guns and all their armoury. Jonathan against our individual wishes stooped to offer all these but they refused asking that the only solution is that they want to Islamise Nigeria. Why hasnt the Northerners agreed to work with the president? Lots of u want Jonathan personal in Biu and Baga. Americans came here to search but couldnt find any. If Buhari wins the Boko boys will instantly rejaoice Allah Wakubah. The Northern are revolting against southern leadership. Why will your husband,father,son show jihadist trait and you would not report to the army or police? Senator ...
Read research to better understand how mutations impact stereoselectivity in evolved ketoreductases and how it can be important in the development of new biocatalysts.
Karak syndrome is a neurological degenerative disorder involving excess cerebral iron accumulation. The family who the disease was discovered in their siblings lived in Karak, a town in southern Jordan. It is characterized by ataxia, inverted feet (talipes calcaneovarus), dysarthric scanning speech with dystonic features, dystonic movement of the tongue and facial muscles and choreiform movement was present in both upper and lower limbs, being more marked in the lower limbs, along with dystonic posture of the distal feet, bradykinesia present in both upper and lower limbs, dysmetria, dysdiadochokinesia, and intentional tremor were bilateral and symmetrical. Neurodegeneration with brain iron accumulation Iron overload Mubaidin A, Roberts E, Hampshire D, et al. (July 2003). Karak syndrome: a novel degenerative disorder of the basal ganglia and cerebellum. J. Med. Genet. 40 (7): 543-6. doi:10.1136/jmg.40.7.543. PMC 1735513 . PMID 12843330. Retrieved 2009-07-07 ...
A 28-year-old woman with generalized dystonia for years visited our outpatient clinic. She was born preterm at 9 months, and her development slowly decelerated after birth, resulting in microcephaly, short stature, cognitive decline, and dysarthria. However, she was able to uneventfully manage her daily activities and had a cleaning job at a welfare center. She had no family history of dystonia or other neurological disorders. She developed right laterocollis and right torticollis with a mobile portion at the age of 27, which then slowly spread to her trunk and bilateral arms (Supplementary Video 1 and 2 in the online-only Data Supplement). The dystonic postures rapidly exacerbated, severely affecting her walking and sitting. Although a sensory trick was noted, it was insufficient for recovery to the neutral position. She described some sleep benefits, but there was no definite fluctuation of the dystonia. The Burke-Fahn-Marsden Dystonia Rating Scale (BFMDRS) score was 30 of 120 on the dystonia ...
Bestelmeyer, P.E.G., Latinus, M., Bruckert, L., Rouger, J., Crabbe, F., & Belin, P. (2012). Implicitly perceived vocal attractiveness modulates prefrontal cortex activity. Cerebral Cortex.22,1263-1270. Bläsing, B., Calvo-Merino, B., Cross, E. S., Honisch, J., Jola, C., & Stevens, C. Neurocognitive control in dance perception and performance. (2012). Acta Psychologica, 139(2), 300-308.. Cross, E. S.,Cohen, N. R., Hamilton, A. F. de C., Ramsey, R., Wolford, G. & Grafton, S. T. (2012).Physical experience leads to enhanced object perception in parietal cortex: Insights from knot tying. Neuropsychologia, 50(14), 3207-3217. * Faculty of 1000 recommended by Patrick Haggard, 12 December 2012 *. Cross, E. S., & Ticini, L. F. (2012). Neuroaesthetics and beyond: New horizons in applying the science of the brain to the art of dance. Phenomenology and the Cognitive Sciences, 11(1), 5 - 16.. Cross, E. S., Liepelt, R., Hamilton, A. F., Parkinson, J., Ramsey, R., Stadler, W., & Prinz, W. (2012). Robotic ...
mm mUU Am TUESDAY, FEBRUARY 1 1, 1837. SEMI-WEEKLY, No. 37, Vol. XXV I Whole No. 1452 PRINTED ANU PUBLISHED UY SCOTT JcW RIGHT. Office on fltnio-slreirt, third door went oftlic Clinton Hank. J. BAll.II VUIIE, EDITOR. From the NowOrlenni Times. THE INVISIBLE GENTLEMAN. Unseen lie slls at your fireside Pursues you closely In your dally walks And with Hire ear, keen eye, and arllve mind, Unserves and solves your every word and net . From time to time lio roughly scrllitilcs .these For Ills memento, and for your comment. Tub Printer; thero ho stands at his case; his eyes fixed on his copy, while his lingers, obedient to biu will, collect thu loiters from their various boxes, and place them together so 9B to iurm words, sentences; cumpleto articles of news, politics, or literature. The musician at the piano can hardly compete wilh the printer in rupidity und precision of his digital motion; like the pianist who pluys with his music box and instrument boforchim, thu printer sees mid comprehends at a ...
one of the first subjects to be taught at the inauguration of BIU in October 1955. Two major changes in recent years have propelled the department forward. Twelve new faculty members have been recruited in a variety of disciplines of chemistry. The department now possesses new capabilites in fields such as computational chemistry, structural biology, magnetic resonance, bio-inorganic chemistry, and nano-materials and devices, alongside the more established fields of medicinal chemistry, organic, inorganic and physical chemistry. No less important was the founding in 2007 of BINA, the Bar-Ilan Institute of Nanotechnology and Advanced Materials. This enterprise, with which 12 chemistry research groups are affiliated, is committed to advancing scientific achievements in the areas of nano-materials, nano-medicine, nano-Energy, nano-magnetism, nano-photonics, and nano-cleantech. In October 2009 six research groups moved into state-of-the-art laboratories in the Nanotechnology Triplex building. The ...
Kenji Watanabe and co-workers from the University of Shizuoka have reported in ACIE on an enzyme system (PsoE (glutathione S-transferase) and PsoF (flavin-containing monooxygenase)) that involves glutathione conjugation of a polyolefinic natural product (presynerazol) to form a glutathione adduct intermediate, which in turn is oxidized to the sulfoxide (by flavin hydroperoxide) and eliminates to form…
Pray for the work of Maitaimako Medical Mission in Nigeria. The organizations January 2018 outreach in Biu Borno state provided eye surgeries to 54 people. Pray for patients who required referrals for treatment and for the next outreach effort in May. ...
Benzoquinone ansamycin (BQA) Hsp90 inhibitors such as 17-DMAG and 17-AAG have off-target toxicities in clinical trials including hepatotoxicity. Mechanisms underlying the toxicity of quinones are a function of their ability to redox cycle and/or arylate cellular nucleophiles at the unsubstituted 19-position of the molecule. Therefore, we designed 19-substituted BQAs to prevent glutathione conjugation and non-specific interactions with protein thiols as an approach to reduce the hepatotoxicity and minimize off-target effects of the BQA class of Hsp90 inhibitors. In this study, the results showed that 19-substituted BQAs did not react with glutathione at the 19-position, while marked reactivity was observed using parent BQAs. Importantly, while parent 17-DMAG induced cell death in primary and cultured mouse hepatocytes, 19-phenyl and 19-methyl 17-DMAG showed reduced toxicity, validating the overall approach. There was no significant difference between the redox cycling ability of either 19-phenyl ...
bvu:BVU_4143 K01186 sialidase-1 [EC:3.2.1.18] , (GenBank) glycoside hydrolase family 33, candidate sialidase (A) MRNPSLLLLIVVFILAPFKLSAAADTVVVRETRIPVLIERQDNELFHLRIEATQSQMLNE VKLDFGKDVNLNEIESVKLYYGGTESVERRGKTYFAPVDYISNNTPGKTLAANTSYSVLK SEVKAPKREVVLKADQKLFPGVNYFWISLQMKPVASILSKVSAEVVEAKIDGQVAPLKIA RKADTHYMGIGVRHAGDDGAAAYRIPGLATSNKGTLLGVYDVRYNNSADLQEYVEIGLSR STDGGQTWEKMRIPMAFGEYDGLPKAQNGVGDPAILVDKKTGTIWIVAAWTHGMGNGRAW WNSQTGMDRNHTAQLMMVKSDDDGKTWSEPMNITEQVKDPSWYFLLQGPGRGISMEDGTL VFASQYIGNDRIPNAGIIYSKDHGKTWNISTLARTNTTESQVAEVEPGVLMLNMRDNRGG SRAVSTTTDLGKTWKEHESSRTALQEPVCMASLISVKAKENVLGKDILLFSNPNDAKNRH SITIKASLDGGVTWLPENQLLLDAGWGWGYSCLTMIDKETVGILYESSVAHMTFQAIKLK DIIKTK ...
Seizures can happen anytime and without warning, it is commonly taken as an oral medicine to prevent the disorder. However, the users may take the drug excessively which can lead to addiction.. When taking amobarbital it is important to take it in moderation because it can generates addiction. Users can easily develop dependency because it can relieve a large amount of pain. Once dependence and tolerance develops, users have a higher risk of drug overdose. Also, users may need to undergo a treatment program to safely withdraw from this drug.. Doctors do not prescribe this drug for lone-term use because of its potential for misuse. The United States law does not permit an individual sale of this drug. The law can punish those people who transfer their prescription to others who seek the drug.. ...
Amobarbital: Search drug information, interaction, images & medical diagnosis. The most comprehensive database of medicines available in China, Hong Kong, ...
stile sideswipers diesis amobarbital bridlers overconfidently distender behoove scalene pathicism unantiquated whamming scrimmages unjuiced absentness mandrake jackpots overnarrowness degusted speciational [email protected] ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
The preparation of hepatocytes using the two-stage perfusion technique usually involves the use of collagenase (CII) alone or in combination with dispase (C/D) or trypsin inhibitor (CA/TI) as digestion enzymes. The effect of CII, C/D and CA/TI on cell viability, yield, cytochrome P450 mediated oxidation of testosterone, glucuronidation and sulfation of 7-hydroxycoumarin, glutathione content, glutathione-S-transferase activity and glutathione-conjugation capacity of hepatocytes has been assessed. Cytochrome P450 mediated oxidation of testosterone was significantly (p , 0.05) decreased with CII isolated hepatocytes (81.7 +/- 3.3 nmol/10(6) cells, mean +/- S.E.M., n = 3), compared with those isolated using CA/TI (96.6 +/- 1.9 nmol/10(6) cells) or C/D (95.1 +/- 2.1 nmol/10(6) cells). In contrast, glutathione conjugation of the non-specific substrate 1-chloro-2,4-dinitrobenzene was significantly (p , 0.05) increased with CII isolated hepatocytes (56.9 +/- 5.9 nmol/10(6) cells, mean +/- S.E.M., n = ...
Bromizoval (bromvalerilureja) je hipnotik i sedativ koji je bio otkriven 1907.[4] One je u prodaji na slobodno u Aziji pod mnoštvom naziva (kao što je Brovarin[5]). On se obično koristi u kombinaciji sa nesteroidnim antiinflamatornim lekovima. Hronična upotreba bromizovala je vezana za trovanje bromom.[6][7][8][9] ...
Cerebellar atrophy due to chronic bromisovalum abuse demonstrated by computed tomography. A. J.L.M. van Balkom, B. J.M. van De ... Cerebellar atrophy due to chronic bromisovalum abuse demonstrated by computed tomography. / van Balkom, A. J.L.M.; van De ... N2 - Two patients with a severe cerebellar syndrome due to chronic bromisovalum usage are described. In both patients CT scan ... AB - Two patients with a severe cerebellar syndrome due to chronic bromisovalum usage are described. In both patients CT scan ...
It was with great pleasure that I accepted the invitation to write the foreword for Drugs and Poisons in Humans. A Handbook of Practical Analysis. Dr. Osamu Suzuki and Dr. Mikio Yashiki, two outstanding Japanese scientists, f rst published the Handbook in Japanese in 2002. Specialists throughout
Bromovalerylurea (JP17); Bromisoval (INN); Bromisovalum; Bromovalerylurea (TN); Bromural (TN); Brovarin (TN). (P) unclassified ...
Bromisovalum. HMDB. Bubber shet. HMDB. Calmurid. HMDB. Calmurid HC. HMDB. Carbaderm. HMDB. ...
It was with great pleasure that I accepted the invitation to write the foreword for Drugs and Poisons in Humans. A Handbook of Practical Analysis. Dr. Osamu Suzuki and Dr. Mikio Yashiki, two outstandi
Valocordin is on the FDAs import alert list and is banned because it contains the controlled substances bromisovalum and ...
Bromisovalum Current Synonym true false 496780018 Bromisoval Current Synonym true false 89492016 Bromisovalum Current Synonym ...
... bromisovalum, bromociclen, bromocriptine, bromodiphenhydramine, bromofenofos, bromopride, bromoxandide, bromperidol, ...
Cerebellar atrophy due to chronic bromisovalum abuse demonstrated by computed tomography. van Balkom, A. J. L. M., van De ...
Bromisovalum - Preferred Concept UI. M0002944. Scope note. A sedative and mild hypnotic with potentially toxic effects. ...
Bromisovalum. *Panafil. *Ultra Mide 25. *Murine ear wax removal system/murine ear drops ...
Disclaimer All content on this website, including dictionary, thesaurus, literature, geography, and other reference data is for informational purposes only. This information should not be considered complete, up to date, and is not intended to be used in place of a visit, consultation, or advice of a legal, medical, or any other professional.. ...
Bromisovalum .. (alpha-Bromoisovaleryl)urea .. Bromoisovalerylurea .. Bromvaleton .. Bromyl .. Sedes A .. Bromisoval .. ... D02.948.160 Bromisovalum .. D03 Heterocyclic Compounds .. D03.132 Alkaloids .. D03.132.960 Xanthines .. D03.132.960.751 ...
Bromoisovalerylurea (bromisovalum) is a sedative-hypnotic given orally as a racemic mixture of optical isomers (i.e., (+)- and ... Bromoisovalerylurea (bromisovalum) is a sedative-hypnotic given orally as a racemic mixture of optical isomers (i.e., (+)- and ...
bromisovalum dosage for amoxicillin. *awa 500 mg amoxicillin. *dog bite antibiotics amoxicillin for ear ...
成份:ETHENZAMIDE (ETHOXYBENZAMIDE);;ACETAMINOPHEN (EQ TO PARACETAMOL);;BROMISOVALUM ( EQ TO BROMOVALERYLU ...
Bromisovalum Medicine & Life Sciences * Microglia Medicine & Life Sciences * Hypnotics and Sedatives Medicine & Life Sciences ...
成份:ETHENZAMIDE (ETHOXYBENZAMIDE);;ACETAMINOPHEN (EQ TO PARACETAMOL);;BROMISOVALUM ( EQ TO BROMOVALERYLU ...
Bromizoval (bromvalerilureja) je hipnotik i sedativ koji je bio otkriven 1907.[4] One je u prodaji na slobodno u Aziji pod mnoštvom naziva (kao što je Brovarin[5]). On se obično koristi u kombinaciji sa nesteroidnim antiinflamatornim lekovima. Hronična upotreba bromizovala je vezana za trovanje bromom.[6][7][8][9] ...
Yarchoan M, Agarwal P, Villanueva A, Rao S, Dawson LA, Llovet JM, Finn RS, Groopman JD, El-Serag HB, Monga SP, Wang XW, Karin M, Schwartz RE, Tanabe KK, Roberts LR, Gunaratne PH, Tsung A, Brown KA, Lawrence TS, Salem R, Singal AG, Kim AK, Rabiee A, Resar L, Hoshida Y, He AR, Ghoshal K, Ryan PB, Jaffee EM, Guha C, Mishra L, Coleman CN, Ahmed MM. Recent Developments and Therapeutic Strategies against Hepatocellular Carcinoma. Cancer Res. 2019 09 01; 79(17):4326-4330 ...
... bromisovalum, captodiamine, capuride, carbcloral, carbromal, chloral betaine, enciprazine, flesinoxan, ipsapiraone, lesopitron ...
Looking for bromobenzene? Find out information about bromobenzene. C6H5Br A heavy, colorless liquid with a pleasant odor; used as a solvent, in motor fuels and top-cylinder compounds, and to make other chemicals Explanation of bromobenzene
Bromisovalum Isovex - Ethaverine Isovue - Iopamidol 184 Chapter 11: Complications [10] Buechel FFS, Buechel FFJ, Pappas MJ ( ... Bromisovalum Isobutil - Oxyphenbutazone Isocain - Procaine Isocaine - Mepivacaine Isocaine - Piperocaine Isocalsin - ...
Bromisovalum [D02.065.950.160] Bromisovalum * Carbamide Peroxide [D02.065.950.278] Carbamide Peroxide * Hydroxyurea [D02.065. ...
Nelson PT, Estus S, Abner EL, Parikh I, Malik M, Neltner JH, Ighodaro E, Wang WX, Wilfred BR, Wang LS, Kukull WA, Nandakumar K, Farman ML, Poon WW, Corrada MM, Kawas CH, Cribbs DH, Bennett DA, Schneider JA, Larson EB, Crane PK, Valladares O, Schmitt FA, Kryscio RJ, Jicha GA, Smith CD, Scheff SW, Sonnen JA, Haines JL, Pericak-Vance MA, Mayeux R, Farrer LA, Van Eldik LJ, Horbinski C, Green RC, Gearing M, Poon LW, Kramer PL, Woltjer RL, Montine TJ, Partch AB, Rajic AJ, Richmire K, Monsell SE. ABCC9 gene polymorphism is associated with hippocampal sclerosis of aging pathology. Acta Neuropathol. 2014; 127(6):825-43 ...
alpha-Bromoisovaleryl)urea use Bromisovalum (beta 1-(2-Deoxyribopyranosyl))thymidine use Deoxyuridine ...
alpha-Bromoisovaleryl)urea use Bromisovalum (beta 1-(2-Deoxyribopyranosyl))thymidine use Deoxyuridine ...
alpha-Bromoisovaleryl)urea use Bromisovalum (beta 1-(2-Deoxyribopyranosyl))thymidine use Deoxyuridine ...
alpha-Bromoisovaleryl)urea use Bromisovalum (beta 1-(2-Deoxyribopyranosyl))thymidine use Deoxyuridine ...
136.8992096 BROMISOVALUM BrC6H11N2O2 223.06774 BROMO FLUOROACETONITRILE Br2C2FN 216.8345032 BROMOACETIC ACID Br3C2HO2 296.74014 ...

No FAQ available that match "bromisovalum"