A complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2. It inhibits DNA metabolism and is used as an antineoplastic, especially for solid tumors.
A process in which normal lung tissues are progressively replaced by FIBROBLASTS and COLLAGEN causing an irreversible loss of the ability to transfer oxygen into the bloodstream via PULMONARY ALVEOLI. Patients show progressive DYSPNEA finally resulting in death.
Chemical substances, produced by microorganisms, inhibiting or preventing the proliferation of neoplasms.
An antineoplastic agent derived from BLEOMYCIN.
A hydroxylated form of the imino acid proline. A deficiency in ASCORBIC ACID can result in impaired hydroxyproline formation.
Antitumor alkaloid isolated from Vinca rosea. (Merck, 11th ed.)
Water-soluble, copper-containing low molecular weight polypeptides obtained from the culture medium of Streptomyces verticillus. They are specific inhibitors of DNA synthesis in bacteria and have been found to act as antitumor agents. They have also been used against rust fungi of plants.
Either of the pair of organs occupying the cavity of the thorax that effect the aeration of the blood.
An antitumor alkaloid isolated from VINCA ROSEA. (Merck, 11th ed.)
A treatment modality that uses pulsed electrical currents to permeabilize cell membranes (ELECTROPORATION) and thereby enhance the uptake of chemotherapeutic agents, vaccines, or genes into the body's cells.
A semisynthetic derivative of PODOPHYLLOTOXIN that exhibits antitumor activity. Etoposide inhibits DNA synthesis by forming a complex with topoisomerase II and DNA. This complex induces breaks in double stranded DNA and prevents repair by topoisomerase II binding. Accumulated breaks in DNA prevent entry into the mitotic phase of cell division, and lead to cell death. Etoposide acts primarily in the G2 and S phases of the cell cycle.
An antineoplastic agent used primarily in combination with mechlorethamine, vincristine, and prednisone (the MOPP protocol) in the treatment of Hodgkin's disease.
Tumors or cancer of the TESTIS. Germ cell tumors (GERMINOMA) of the testis constitute 95% of all testicular neoplasms.
A malignant disease characterized by progressive enlargement of the lymph nodes, spleen, and general lymphoid tissue. In the classical variant, giant usually multinucleate Hodgkin's and REED-STERNBERG CELLS are present; in the nodular lymphocyte predominant variant, lymphocytic and histiocytic cells are seen.
The administration of therapeutic agents drop by drop, as eye drops, ear drops, or nose drops. It is also administered into a body space or cavity through a catheter. It differs from THERAPEUTIC IRRIGATION in that the irrigate is removed within minutes, but the instillate is left in place.
Antineoplastic antibiotic obtained from Streptomyces peucetius. It is a hydroxy derivative of DAUNORUBICIN.
A biologic alkylating agent that exerts its cytotoxic effects by forming DNA ADDUCTS and DNA interstrand crosslinks, thereby inhibiting rapidly proliferating cells. The hydrochloride is an antineoplastic agent used to treat HODGKIN DISEASE and LYMPHOMA.
An inorganic and water-soluble platinum complex. After undergoing hydrolysis, it reacts with DNA to produce both intra and interstrand crosslinks. These crosslinks appear to impair replication and transcription of DNA. The cytotoxicity of cisplatin correlates with cellular arrest in the G2 phase of the cell cycle.
Injections introduced directly into localized lesions.
Unstable isotopes of cobalt that decay or disintegrate emitting radiation. Co atoms with atomic weights of 54-64, except 59, are radioactive cobalt isotopes.
An antineoplastic agent. It has significant activity against melanomas. (from Martindale, The Extra Pharmacopoeia, 31st ed, p564)
The use of two or more chemicals simultaneously or sequentially in the drug therapy of neoplasms. The drugs need not be in the same dosage form.
Neoplasms composed of primordial GERM CELLS of embryonic GONADS or of elements of the germ layers of the EMBRYO, MAMMALIAN. The concept does not refer to neoplasms located in the gonads or present in an embryo or FETUS.
A malignant neoplasm of the germinal tissue of the GONADS; MEDIASTINUM; or pineal region. Germinomas are uniform in appearance, consisting of large, round cells with vesicular nuclei and clear or finely granular eosinophilic-staining cytoplasm. (Stedman, 265th ed; from DeVita Jr et al., Cancer: Principles & Practice of Oncology, 3d ed, pp1642-3)
A synthetic anti-inflammatory glucocorticoid derived from CORTISONE. It is biologically inert and converted to PREDNISOLONE in the liver.
An enediyne that alkylates DNA and RNA like MITOMYCIN does, so it is cytotoxic.
A common interstitial lung disease of unknown etiology, usually occurring between 50-70 years of age. Clinically, it is characterized by an insidious onset of breathlessness with exertion and a nonproductive cough, leading to progressive DYSPNEA. Pathological features show scant interstitial inflammation, patchy collagen fibrosis, prominent fibroblast proliferation foci, and microscopic honeycomb change.
Inorganic binary compounds of iodine or the I- ion.
Unstable isotopes of iodine that decay or disintegrate emitting radiation. I atoms with atomic weights 117-139, except I 127, are radioactive iodine isotopes.
Exclusive legal rights or privileges applied to inventions, plants, etc.
A condition in which the FORAMEN OVALE in the ATRIAL SEPTUM fails to close shortly after birth. This results in abnormal communications between the two upper chambers of the heart. An isolated patent ovale foramen without other structural heart defects is usually of no hemodynamic significance.
Techniques for labeling a substance with a stable or radioactive isotope. It is not used for articles involving labeled substances unless the methods of labeling are substantively discussed. Tracers that may be labeled include chemical substances, cells, or microorganisms.
Damage to any compartment of the lung caused by physical, chemical, or biological agents which characteristically elicit inflammatory reaction. These inflammatory reactions can either be acute and dominated by NEUTROPHILS, or chronic and dominated by LYMPHOCYTES and MACROPHAGES.
Washing liquid obtained from irrigation of the lung, including the BRONCHI and the PULMONARY ALVEOLI. It is generally used to assess biochemical, inflammatory, or infection status of the lung.
A general term for various neoplastic diseases of the lymphoid tissue.
Tumors or cancer of the UTERINE CERVIX.
Substances that inhibit or prevent the proliferation of NEOPLASMS.
Introduction of substances into the body using a needle and syringe.
The science or study of speech sounds and their production, transmission, and reception, and their analysis, classification, and transcription. (Random House Unabridged Dictionary, 2d ed)
Drugs whose drug name is not protected by a trademark. They may be manufactured by several companies.
The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.
Communication through a system of conventional vocal symbols.
Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.
A genus of bacteria that form a nonfragmented aerial mycelium. Many species have been identified with some being pathogenic. This genus is responsible for producing a majority of the ANTI-BACTERIAL AGENTS of practical value.
A soil-dwelling actinomycete with a complex lifecycle involving mycelial growth and spore formation. It is involved in the production of a number of medically important ANTIBIOTICS.
A heteropolysaccharide that is similar in structure to HEPARIN. It accumulates in individuals with MUCOPOLYSACCHARIDOSIS.
A naturally occurring glycosaminoglycan found mostly in the skin and in connective tissue. It differs from CHONDROITIN SULFATE A (see CHONDROITIN SULFATES) by containing IDURONIC ACID in place of glucuronic acid, its epimer, at carbon atom 5. (from Merck, 12th ed)
Inorganic salts of sulfuric acid.
Ubiquitous macromolecules associated with the cell surface and extracellular matrix of a wide range of cells of vertebrate and invertebrate tissues. They are essential cofactors in cell-matrix adhesion processes, in cell-cell recognition systems, and in receptor-growth factor interactions. (From Cancer Metastasis Rev 1996; 15(2): 177-86; Hepatology 1996; 24(3): 524-32)
The expected function of a member of a particular profession.

The Saccharomyces cerevisiae ETH1 gene, an inducible homolog of exonuclease III that provides resistance to DNA-damaging agents and limits spontaneous mutagenesis. (1/2335)

The recently sequenced Saccharomyces cerevisiae genome was searched for a gene with homology to the gene encoding the major human AP endonuclease, a component of the highly conserved DNA base excision repair pathway. An open reading frame was found to encode a putative protein (34% identical to the Schizosaccharomyces pombe eth1(+) [open reading frame SPBC3D6.10] gene product) with a 347-residue segment homologous to the exonuclease III family of AP endonucleases. Synthesis of mRNA from ETH1 in wild-type cells was induced sixfold relative to that in untreated cells after exposure to the alkylating agent methyl methanesulfonate (MMS). To investigate the function of ETH1, deletions of the open reading frame were made in a wild-type strain and a strain deficient in the known yeast AP endonuclease encoded by APN1. eth1 strains were not more sensitive to killing by MMS, hydrogen peroxide, or phleomycin D1, whereas apn1 strains were approximately 3-fold more sensitive to MMS and approximately 10-fold more sensitive to hydrogen peroxide than was the wild type. Double-mutant strains (apn1 eth1) were approximately 15-fold more sensitive to MMS and approximately 2- to 3-fold more sensitive to hydrogen peroxide and phleomycin D1 than were apn1 strains. Elimination of ETH1 in apn1 strains also increased spontaneous mutation rates 9- or 31-fold compared to the wild type as determined by reversion to adenine or lysine prototrophy, respectively. Transformation of apn1 eth1 cells with an expression vector containing ETH1 reversed the hypersensitivity to MMS and limited the rate of spontaneous mutagenesis. Expression of ETH1 in a dut-1 xthA3 Escherichia coli strain demonstrated that the gene product functionally complements the missing AP endonuclease activity. Thus, in apn1 cells where the major AP endonuclease activity is missing, ETH1 offers an alternate capacity for repair of spontaneous or induced damage to DNA that is normally repaired by Apn1 protein.  (+info)

Differential regulation of p21waf-1/cip-1 and Mdm2 by etoposide: etoposide inhibits the p53-Mdm2 autoregulatory feedback loop. (2/2335)

The Mdm2 protein is frequently overexpressed in human non-seminomatous germ cell tumours and transitional carcinoma of the bladder where it may contribute to tolerance of wtp53. Mdm2 forms an autoregulatory feedback loop with p53; the Mdm2 gene is responsive to transactivation by p53 and once synthesized the Mdm2 protein terminates the p53 response. We show here that the topoisomerase poison etoposide, like ultra violet irradiation, inhibits Mdm2 synthesis. Cytotoxic concentrations of etoposide (IC90 for > 3 h) result in inhibition of Mdm2 induction at both the RNA and protein level. Rapid apoptosis ensues. Global transcription is not inhibited: p21waf-1/cip1 and GADD45 expression increase in a dose dependent manner. Inhibition of Mdm2 synthesis depends on the continuous presence of etoposide, suggesting the DNA damage may prevent transcription. Downregulation of Mdm2 transcript occurs in cells expressing HPV16-E6 suggesting that inhibition of Mdm2 transcription is p53-independent. When cells are -treated with a pulse (1 h) of etoposide and reincubated in drug free medium, Mdm2 synthesis commences immediately after damage is repaired (3 h) and the p53 response is attenuated. Induction of apoptosis and loss of clonogenicity are 3-5-fold lower under pulse treatment conditions. This is the first observation of inhibition of Mdm2 transcription following treatment with topoisomerase (topo II) poisons, a feature that may be useful in tumour types where p53 is tolerated by overexpression of Mdm2.  (+info)

The integrin alpha v beta 6 binds and activates latent TGF beta 1: a mechanism for regulating pulmonary inflammation and fibrosis. (3/2335)

Transforming growth factor beta (TGF beta) family members are secreted in inactive complexes with a latency-associated peptide (LAP), a protein derived from the N-terminal region of the TGF beta gene product. Extracellular activation of these complexes is a critical but incompletely understood step in regulation of TGF beta function in vivo. We show that TGF beta 1 LAP is a ligand for the integrin alpha v beta 6 and that alpha v beta 6-expressing cells induce spatially restricted activation of TGF beta 1. This finding explains why mice lacking this integrin develop exaggerated inflammation and, as we show, are protected from pulmonary fibrosis. These data identify a novel mechanism for locally regulating TGF beta 1 function in vivo by regulating expression of the alpha v beta 6 integrin.  (+info)

Testicular cancer: an oncological success story. (4/2335)

Testicular cancer has become a model for a curable neoplasm. Our studies with cisplatin combination chemotherapy allow us to conclude that: (a) short-duration intensive induction therapy with the most active agents in optimal dosage is more important than maintenance therapy; (b) modest dose escalation increases toxicity without improving therapeutic efficacy; (c) it is possible to develop curative salvage therapy for refractory germ cell tumors; and (d) preclinical models predicting synergism, such as vinblastine + bleomycin or cisplatin + etoposide have clinical relevance. Finally, testicular cancer has also become a model for new drug development. Cisplatin was approved by the Food and Drug Administration for testis and ovarian cancer, and etoposide and ifosfamide were approved for refractory germ cell tumors. The success of these studies confirms the importance of the continued search for new investigational drugs in all solid tumors.  (+info)

Can we cure indolent lymphomas? (5/2335)

The current consensus is that indolent lymphomas are incurable disorders. There are some indications that these malignancies are potentially curable. Indeed, not all indolent lymphomas are currently incurable. For example, patients with Ann Arbor stage I-II indolent lymphomas can experience long-term disease-free survival and probable cure. Also, from the available literature data, it seems that the achievement of a molecular complete remission is a desirable objective. Patients who achieve a persistently negative PCR state seldom relapse, whereas the opposite is true for persistently positive cases. In view of its excellent correlation with disease-free survival when examined serially in multiple blood or marrow samples, the PCR technique has the potential of providing a tumor marker that can be used as an early end point for clinical trials. By serving as an early surrogate end point, PCR could play an important role in expediting the development of new treatment strategies. Whether IFN is capable of increasing the molecular complete remission rate as measured by PCR is not known. However, it is clear that from the clinical standpoint, IFN has been able to increase 2-fold the length of remission in patients with advanced indolent lymphomas. In at least two studies, this has been associated with prolongation of survival. More intensive regimens such as alternating triple therapy, when used in combination with IFN, seem to have improved the quality of remissions as judged by the PCR assay. Finally, the site where the bcl-2 breakpoint occurs seems to have clinical significance. Those follicular lymphomas with germ-line bcl-2, in our experience, have behaved more aggressively than the others, and their failure-free survival seems different from the usual indolent lymphomas and more closely resembles the large cell lymphomas. Although the biological significance of this observation is not yet understood, this group might actually constitute a prognostically different subset with a more aggressive and perhaps more curable lymphoma. Whether the plateau observed in their failure-free survival curve will be maintained with more follow-up and whether they might be a curable subset remain to be determined.  (+info)

Effects of pirfenidone on procollagen gene expression at the transcriptional level in bleomycin hamster model of lung fibrosis. (6/2335)

A time course study was carried out to elucidate the mechanisms for antifibrotic effect of pirfenidone (PD). Hamsters were intratracheally (i.t.) instilled with saline (SA) or bleomycin (BL) (7.5 units/kg/5 ml). The animals were fed a diet containing 0.5% PD or the same control diet (CD) without the drug 2 days before and throughout the study. The animals were sacrificed at various times after instillation. The lung hydroxyproline level in BL + CD groups was gradually increased and peaked at 21 days to 181% of the SA + CD control. The BL + PD-treated groups showed a gradual decrease in their lung collagen content, showing a maximum reduction of 40% at day 21. The lung malondialdehyde levels of the BL + CD groups were increased by several-fold of the corresponding SA + CD groups at various times. The lung prolyl hydroxylase (PH) activities in the BL + CD groups were also increased by several-fold of the corresponding SA + CD groups at these time points. The hamsters in the BL + PD showed a gradual decrease in the lung malondialdehyde levels from 10 to 21days compared with their corresponding BL + CD groups. Treatment with PD also reduced the lung PH activities in the BL + PD groups compared with the corresponding BL + CD groups. However, PD failed to manifest any direct inhibitory effect on PH activity in vitro. BL treatment increased the lung procollagen I and III gene expressions in the BL + CD groups by several-fold at varying times compared with the corresponding SA + CD, and treatment with PD in the BL + PD groups significantly down-regulated the BL-induced overexpression of these genes. Studies evaluating the regulation of these genes at the transcriptional level revealed PD significantly reduced the transcription of PC I at 14 days. Our results indicate that the antifibrotic effect of PD was partly due to suppression of the BL-induced inflammatory events and partly due to down-regulation of BL-induced overexpression of lung procollagen I and III genes.  (+info)

T cell independence of bleomycin-induced pulmonary fibrosis. (7/2335)

The role of T cells and cytokines in bleomycin (BLM)-induced fibrosis was evaluated in susceptible and resistant strains of normal and SCID mice. Histology and hydroxyproline analysis showed that BLM induced pulmonary fibrosis in C57BL/6 and (C57BL/6 x BALB/c)F1 mice, whereas BALB/c mice were resistant to the disease. To test whether lymphocytes were required for the induction of BLM-induced pulmonary fibrosis, SCID mice were injected intratracheally with BLM and evaluated for the development of pulmonary inflammation and fibrosis. Similar morphological changes and increases in hydroxyproline were observed in both C57BL/6 SCID and (C57BL/6 x CB.17)F1 SCID animals compared to those seen in wild-type C57BL/6 and (C57BL/6 x BALB/c)F1 mice. In contrast, CB.17 SCID mice, which are genetically similar to BALB/c mice, were resistant to disease induction. Analysis of the cellular infiltrate in BLM-treated C57Bl/6 SCID mice confirmed a lack of T cells in the lungs of SCID mice and demonstrated a pronounced accumulation of eosinophils in areas of developing pulmonary fibrosis. NK cells were significantly elevated in untreated SCID mice and did not increase further after BLM treatment. Analysis of selected cytokines 1 day after initiation of BLM-induced pulmonary fibrosis indicated that the levels of TNF-alpha and IFN-gamma appeared to segregate with fibrosis in both the SCID and wild-type mice. The data demonstrate that T cells are not required for the induction of fibrosis by BLM and suggest that responses by non-lymphoid cells may be sufficient for the induction of fibrosis.  (+info)

Follicular large cell lymphoma: an aggressive lymphoma that often presents with favorable prognostic features. (8/2335)

It is debated whether follicular large cell lymphoma (FLCL) has a clinical behavior that is distinct from indolent follicular lymphomas, and whether there is a subset of patients who can be potentially cured. We report here our experience with 100 FLCL patients treated at our institution since 1984 with three successive programs. We evaluated the predictive value of pretreatment clinical features, including two risk models, the Tumor Score System and the International Prognostic Index (IPI). With a median follow-up of 67 months, the 5-year survival is 72% and the failure-free survival (FFS) is 67%, with a possible plateau in the FFS curve, particularly for patients with stage I-III disease. Features associated with shorter survival included age >/=60, elevated lactic dehydrogenase (LDH) or beta-2-microglobulin (beta2M), advanced stage, and bone marrow involvement. Stage III patients had significantly better survival than stage IV patients (P <.05). By the IPI and Tumor Score System, 80% of the patients were in the lower risk groups; both systems stratified patients into prognostic groups. Patients with FLCL have clinical features and response to treatment similar to that reported for diffuse large cell lymphoma. Prognostic risk systems for aggressive lymphomas are useful for FLCL. A meaningful fraction of patients may possibly be cured when treated as aggressive lymphomas.  (+info)

This study analysed the inhibitory effect of erythromycin on bleomycin-induced acute lung injury and found that, by pathological analysis, the most marked changes such as interstitial oedema and infiltration of inflammatory cells into the lung were induced at day 7 following bleomycin treatment.. Pretreatment with erythromycin prior to bleomycin + erythromycin decreased the 2.29-fold increase in total BAL cell count with bleomycin alone to a 1.32-fold increase compared with that with erythromycin alone. The neutrophil ratio in the BAL fluid in the BLM + EM group was 0.444 (69.7/156.9) compared with that of the bleomycin alone group. Furthermore, the neutrophil ratio in the BLM + pre-EM group was 0.106, which indicated that erythromycin caused marked inhibition of neutrophil infiltration into the airway in bleomycin-induced lung injury. An inhibitory effect of erythromycin on neutrophil chemotaxis in patients with chronic bronchitis and diffuse panbronchiolitis has been reported previously.10 16 ...
Bleomycin-induced lung fibrosis in mice reproduces some key features of pulmonary fibrosis in humans including alveolar inflammation, myofibroblast proliferation, and collagen deposition. Glucocorticoids have been used as first-line therapy for the treatment of lung fibrosis, although their clinical efficacy is equivocal. We examined the effect of the glucocorticoid, methylprednisolone (MP), and the estrogen metabolite, 2-methoxyestradiol (2MEO) on bleomycin-induced bronchoalveolar inflammation, fibrosis, and changes in lung function. The characterization of the time-course of the bleomycin-induced fibrosis indicated that lung dry mass and hydroxyproline content showed less variance than histopathological assessment of fibrosis. The bleomycin-induced increases in bronchoalveolar lavage (BAL) fluid cell number and protein levels were not significantly influenced by treatment with either MP (1 mg.(kg body mass)(-1).day(-1), i.p.) or 2MEO (50 mg.(kg body mass)(-1).day(-1), i.p.). Lung fibrosis, ...
Bleomycin is a broad-spectrum glycopeptide antitumor antibiotic produced by Streptomyces verticillus. Clinically, the mixture of bleomycin A2 and bleomycin B2 is widely used in combination with other drugs for the treatment of various cancers. As a secondary metabolite, the biosynthesis of bleomycin is precisely controlled by the complex extra-/intracellular regulation mechanisms, it is imperative to investigate the global metabolic and regulatory system involved in bleomycin biosynthesis for increasing bleomycin production. N-acetylglucosamine (GlcNAc), the vital signaling molecule controlling the onset of development and antibiotic synthesis in Streptomyces, was found to increase the yields of bleomycins significantly in chemically defined medium. To mine the gene information relevant to GlcNAc metabolism, the DNA sequences of dasR-dasA-dasBCD-nagB and nagKA in S. verticillus were determined by chromosome walking. From the results of Real time fluorescence quantitative PCR (RT-qPCR) and
TY - JOUR. T1 - The redox state of activated bleomycin. AU - Burger, R. M.. AU - Blanchard, J. S.. AU - Horwitz, S. B.. AU - Peisach, J.. PY - 1985. Y1 - 1985. N2 - Activated bleomycin appears to have two more oxidizing equivalents than the Fe(III)·bleomycin to which it spontaneously decays. Activated bleomycin reacts with NADH and thio-NADH, two-electron reductants, and with KI, a one-electron reductant, to yield Fe(III)·bleomycin. The observed stoichiometries were 0.85 ± 0.07 eq of thio-NADH oxidized or 1.5 ± 0.25 eq of KI oxidized per mole of activated bleomycin. None of these reactions requires the presence of a redox mediator, as does the reduction of Fe(III)·bleomycin by NADH or thio-NADH. The oxidations of both pyridine nucleotide coenzymes and of KI are inhibited by DNA, the usual bleomycin target.. AB - Activated bleomycin appears to have two more oxidizing equivalents than the Fe(III)·bleomycin to which it spontaneously decays. Activated bleomycin reacts with NADH and thio-NADH, ...
Background The pathogenesis of pulmonary fibrosis remains poorly understood. therefore theoretically avoiding ligand-receptor discussion. Frizzled-related proteins (FRZB) was the founding person in this family members [16-18] and verified to bind xWNT8 and antagonize its activity in and versions, including the impact caused by lack of endogenous SFRP1 and FRZB in the bleomycin-induced lung fibrosis model. We display that both and so are upregulated during bleomycin-induced lung fibrosis. to review their powerful profile in the bleomycin-induced pulmonary fibrosis model. and mRNA amounts had been 2 log-scales even more abundant than those of and may not be recognized. amounts were significantly improved at all period factors after bleomycin treatment however, not different between period points (Shape?1C) (2-method ANOVA PBS, 0.05 for period and connections). amounts were considerably and consistently elevated as time passes after bleomycin treatment (2-method ANOVA 0.0001 for bleomycin PBS, and ...
Iron has been shown to be important in ischaemic, immune and toxic forms of tissue injury in various organs. Although it is generally accepted that iron participates in the generation of powerful oxidant species (e.g. hydroxyl radicals) there has not been any direct evidence that iron capable of catalysing free-radical reactions is increased in tissues in these models of injury. In the present study we demonstrate that ischaemia/reperfusion injury to the kidney results in no significant change in total, nonhaem or ferritin iron levels, but there is a marked and specific increase in bleomycin-detectable iron (capable of catalysing free-radical reactions) in the kidney. The increase in bleomycin-detectable iron is observed only after reperfusion but not during the ischaemic period. In a separate study we demonstrate that despite a drastic reduction in the iron content in the kidney, as a result of feeding an iron-deficient diet, there is a similar and a marked increase in the bleomycin-detectable ...
In the presence of ferrous ions (Fe2+), the anti-tumour agent bleomycin will induce DNA degradation. Degradation of DNA into substances detectable by the thiobarbituric acid test has been used previously for the detection of iron in a form that is capable of catalysing the formation of the potentially harmful hydroxyl free radical. In the present paper, we describe the application of the ethidium-binding assay of DNA damage to the measurement of bleomycin-detectable iron, comparing its performance with the conventional method in the assessment of iron standard solutions and plasma samples from haemochromatosis patients. The ethidium-binding assay proved to be more responsive than the thiobarbituric acid test in the detection of DNA damage induced by very low concentrations of iron, but became saturated at higher iron concentrations. Agreement between the two versions of the assay in the identification of plasma samples containing bleomycin-detectable iron was good, but agreement on the actual ...
Systemic sclerosis (SSc) is a connective tissue disorder characterised by the development of skin fibrosis. Our current understanding of the disease pathogenesis is incomplete and the study of SSc is hindered, at least partially, by a lack of animal models that fully replicate the complex state of human disease. Murine model of bleomycin-induced dermal fibrosis encapsulates important events that take place early in the disease course. To characterise the optimum in vivo parameters required for the successful induction of dermal fibrosis we subjected three commonly used mouse strains to repeated subcutaneous bleomycin injections. We aimed to identify the effects of genetic background and gender on the severity of skin fibrosis. We used male and female Balb/C, C57BL/6, and DBA/2 strains and assessed their susceptibility to bleomycin-induced fibrosis by measuring dermal thickness, hydroxyproline/collagen content and number of resident myofibroblasts, all of which are important indicators of the severity of
If patients could recognise themselves, or anyone else could recognise a patient from your description, please obtain the patients written consent to publication and send them to the editorial office before submitting your response [Patient consent forms] ...
Bleomycin sulfate is a mixture of the sulfate salts of basic glycopeptide antineoplastic antibiotics isolated from Streptomyces verticillus.
Define bleomycin. bleomycin synonyms, bleomycin pronunciation, bleomycin translation, English dictionary definition of bleomycin. n. Any of a class of antibiotics isolated from the bacterium Streptomyces verticillus, used usually in sulfate form in combination with other drugs to treat...
Bleomycin is a treatment for a number of types of cancer. Bleomycin is a type of antibiotic that is poisonous to cells. It binds to the cancer cells DNA so that the cells cant divide or grow. Electrochemotherapy is a cancer treatment. The definition of therapeutic window of lectrochemotherapy is based on the observed responses of the tumors that were treated at different time points after the drug injection. To refine the method, thorough knowledge is needed about the pharmacokinetics and pharmacodynamics of bleomycin, which would base on sensitive analytical method. This method was not available until recently. The aim of the study is therefore to determine pharmacokinetics and pharmacodynamics of bleomycin in patients treated with electrochemotherapy, for optimization of the treatment ...
Matrix metalloproteinase-8 (MMP-8) is a potent interstitial collagenase thought to be expressed mainly by polymorphonuclear neutrophils. To determine whether MMP-8 regulates lung inflammatory or fibrotic responses to bleomycin, we delivered bleomycin by the intratracheal route to wild-type (WT) versus Mmp-8−/− mice and quantified MMP-8 expression, and inflammation and fibrosis in the lung samples. Mmp-8 steady state mRNA and protein levels increase in whole lung and bronchoalveolar lavage samples when WT mice are treated with bleomycin. Activated murine lung fibroblasts express Mmp-8 in vitro. MMP-8 expression is increased in leukocytes in the lungs of patients with idiopathic pulmonary fibrosis compared with control lung samples. Compared with bleomycin-treated WT mice, bleomycin-treated Mmp-8−/− mice have greater lung inflammation, but reduced lung fibrosis. Whereas bleomycin-treated Mmp-8−/− and WT mice have similar lung levels of several pro- and antifibrotic mediators (TGF-β, ...
Objectives Reduced caveolin-1 levels in lung fibroblasts from patients with scleroderma and the lungs of bleomycin-treated mice promote collagen overexpression and lung fibrosis. This study was undertaken to determine whether caveolin-1 is deficient in leucocytes from bleomycin-treated mice and patients with scleroderma and to examine the consequences of this deficiency and its reversal.. Methods Mice or cells received the caveolin-1 scaffolding domain (CSD) peptide to reverse the pathological effects of reduced caveolin-1 expression. In bleomycin-treated mice, the levels of caveolin-1 in leucocytes and the effect of CSD peptide on leucocyte accumulation in lung tissue were examined. To validate the results in human disease and to identify caveolin-1-regulated molecular mechanisms, monocytes and neutrophils were isolated from patients with scleroderma and control subjects and caveolin-1, extracellular signal-regulated protein kinase (ERK), c-Jun N-terminal kinase (JNK), p38, CXC chemokine ...
TY - JOUR. T1 - Bleomycin serum pharmacokinetics as determined by a radioimmunoassay and a microbiologic assay in a patient with compromised renal function. AU - Crooke, Stanley T.. AU - Luft, Friedrich. AU - Broughton, Alan. AU - Strong, James. AU - Casson, Kay. AU - Einhorn, Lawrence. PY - 1977/4. Y1 - 1977/4. N2 - Serum and plasma bleomycin concentrations were determined in a patient with renal dysfunction at two creatinine clearances. The results obtained with a new radioimmunoassay and the microbiologic assay were compared. It was shown: 1) that the clearance of bleomycin from the blood is markedly retarded in severe renal dysfunction, 2) that clearance of bleomycin varies with creatinine clearance, 3) that bleomycin is probably not dialyzable, 4) that determinations on serum and plasma were equivalent, and 5) that the radioimmunoassay and microbiologic assays gave equivalent results (P , 0.001).. AB - Serum and plasma bleomycin concentrations were determined in a patient with renal ...
TY - JOUR. T1 - DNA methylation reduces binding and cleavage by bleomycin. AU - Roy, Basab. AU - Tang, Chenhong. AU - Alam, Mohammad P.. AU - Hecht, Sidney. PY - 2014/9/30. Y1 - 2014/9/30. N2 - In a recent study, we described the enhanced double-strand cleavage of hairpin DNAs by Fe·bleomycin (Fe·BLM) that accompanies increasingly strong binding of this antitumor agent and suggested that this effect may be relevant to the mechanism by which BLM mediates its antitumor effects. Because the DNA in tumor cells is known to be hypomethylated on cytidine relative to that in normal cells, it seemed of interest to study the possible effects of methylation status on BLM-induced double-strand DNA cleavage. Three hairpin DNAs found to bind strongly to bleomycin, and their methylated counterparts, were used to study the effect of methylation on bleomycin-induced DNA degradation. Under conditions of limited DNA cleavage, there was a significant overall decrease in the cleavage of methylated hairpin DNAs. ...
In this study, after doses of 1 g/kg/day of the traditional Chinese formula Ma-Xing-Shi-Gan-Tang (MXSGT), significant reversal of pneumatocysts was achieved in Spague-Dawley rats with bleomycin-induced lung fibrosis. We found that MXSGT can improve the damaged condition of general cellular membranes. Greatly increased levels of lung NO were found in the bleomycin-induced group, which were then significantly reduced by MXSGT. MXSGT drastically prevented depletion of superoxide dismutase (SOD) and reduced the myeloperoxidase (MPO) activities and malondialdehyde (MDA) levels in lung tissue of rats treated with bleomycin. On the basis of the results presented in this paper, MXSGT prevents bleomycin-induced lung fibrosis, and the mechanism may be due to the inhibitory effect on nitric oxide generation in the bleomycin-induced lung-fibrosis model of rats ...
TY - JOUR. T1 - Bleomycin resistance: a new dominant selectable marker for plant cell transformation.. AU - Hille, J.. AU - Verheggen, F.. AU - Roelvink, P.. AU - Franssen, H.G.J.M.. AU - van Kammen, A.. AU - Zabel, W.J.T.. PY - 1986. Y1 - 1986. U2 - 10.1007/bf00021328. DO - 10.1007/bf00021328. M3 - Article. VL - 7. SP - 171. EP - 176. JO - Plant Molecular Biology. JF - Plant Molecular Biology. SN - 0167-4412. ER - ...
A mixture of the sulfate salts of basic glycopeptide antineoplastic antibiotics isolated from Streptomyces verticillus. Bleomycin sulfate forms complexes with iron that reduce molecular oxygen to superoxide and hydroxyl radicals which cause single- and double-stranded breaks in DNA; these reactive oxygen species also induce lipid peroxidation, carbohydrate oxidation, and alterations in prostaglandin synthesis and degradation.
Liposomal formulations of chemotherapeutic agents increase drug accumulation in tumors, which permits disease palliation at relatively low doses and thus decreases some of the dose-limiting toxicity. Multi-agent therapy is considered to be more effective than single-agent therapy; therefore, DOX-SL will be combined with bleomycin and vincristine.. Patients are randomized to receive intravenous DOX-SL alone or in combination with vincristine/bleomycin every 2 weeks. Filgrastim ( granulocyte colony-stimulating factor; G-CSF ) may be given as needed for neutropenia.. AS PER AMENDMENT 11/7/96: Based on interim review data, it is recommended that subjects receiving DOX-SL plus vincristine/bleomycin have vincristine/bleomycin discontinued and receive DOX-SL alone unless, in the opinion of the treating physician, they are benefitting from the DOX-SL plus vincristine/bleomycin regimen. ...
Liposomal formulations of chemotherapeutic agents increase drug accumulation in tumors, which permits disease palliation at relatively low doses and thus decreases some of the dose-limiting toxicity. Multi-agent therapy is considered to be more effective than single-agent therapy; therefore, DOX-SL will be combined with bleomycin and vincristine.. Patients are randomized to receive intravenous DOX-SL alone or in combination with vincristine/bleomycin every 2 weeks. Filgrastim ( granulocyte colony-stimulating factor; G-CSF ) may be given as needed for neutropenia.. AS PER AMENDMENT 11/7/96: Based on interim review data, it is recommended that subjects receiving DOX-SL plus vincristine/bleomycin have vincristine/bleomycin discontinued and receive DOX-SL alone unless, in the opinion of the treating physician, they are benefitting from the DOX-SL plus vincristine/bleomycin regimen. ...
TY - JOUR. T1 - (2S,3S,4R)-4-Amino-3-hydroxy-2-methylvalerate. Synthesis of an amino acid constituent of bleomycin from L-rhamnose [4]. AU - Ohgi, Tadaaki. AU - Hecht, Sidney. PY - 1981. Y1 - 1981. N2 - (2S,3S,4R)-4-Amino-3-hydroxy-2-methylvalerate, an amino acid constituent of the antitumor antibiotic bleomycin, has been prepared from L-rhamnose. This approach to a chiral 3-hydroxy-2-methylcarboxylate constitutes an alternative to the stereoselective aldol condensation.. AB - (2S,3S,4R)-4-Amino-3-hydroxy-2-methylvalerate, an amino acid constituent of the antitumor antibiotic bleomycin, has been prepared from L-rhamnose. This approach to a chiral 3-hydroxy-2-methylcarboxylate constitutes an alternative to the stereoselective aldol condensation.. UR - http://www.scopus.com/inward/record.url?scp=0000978523&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=0000978523&partnerID=8YFLogxK. M3 - Article. VL - 46. SP - 1232. EP - 1234. JO - Journal of Organic Chemistry. T2 - Journal ...
Antineoplastic antibiotic isolated from Streptomyces verticillus; anticancer agent; induces DNA strand breaks and inhibits DNA synthesis. Linnert, M., Gehl, J., Bleomycin treatment of brain tumors:
Background: We recently reported that PBI-Compound demonstrated anti-inflammatory and anti-fibrotic activities in acute and chronic kidney disease models. Inflammatory cytokines play a key role in the pathogenesis of pulmonary fibrosis.. Aims: To determine the effect of PBI-Compound on bleomycin-induced lung fibrosis at the pro-inflammatory/fibrotic cytokine level and histological lesions.. Methods: C57BL/6 mice received bleomycin by intratracheal instillation on day 0, and then were treated with oral administration of PBI-Compound from day 7 to 21. Mice were euthanized on day 21 and protein level of IFN-γ, IL-1β and TNF-α was quantified in the bronchoalveolar lavage fluid (BALF).. Results: The results show that intratracheal instillation of bleomycin induced a significant increase in CTGF, IL-1β and TNF-α in BALF. PBI-Compound treatment significantly decreased the amount of CTGF close to the level observed in the control group. IL-1β and TNF-α were also reduced by 20-30%. Regulation of ...
bleomycin definition: nounAny of a class of antibiotics isolated from the bacterium Streptomyces verticillus, used usually in sulfate form in combination with other drugs to treat certain kinds of cancer.Origin of bleomycin Alteration of phleomycin ...
This randomized phase II trial studies paclitaxel and carboplatin to see how well they work compared with bleomycin sulfate, etoposide phosphate, and cisplatin in treating patients with sex cord-ovarian stromal tumors that have spread to other places in the body and usually cannot be cured or controlled with treatment (advanced) or has returned (recurrent). Drugs used in chemotherapy work in different ways to stop the growth of tumor cells, either by killing the cells, by stopping them from dividing, or by stopping them from spreading. Giving more than one drug (combination chemotherapy) may kill more tumor cells. It is not yet known which chemotherapy regimen is more effective in treating sex cord-ovarian stromal tumors. ...
LOS ANGELES, United States: Global Bleomycin Market Research Report 2020. This report has been prepared by experienced and knowledgeable market analysts and researchers. It is a phenomenal compilation of important studies that explore the competitive landscape, segmentation, geographical expansion, and revenue, production, and consumption growth of the global Bleomycin market. Players can use the accurate market facts and figures and statistical studies provided in the report to understand the current and future growth of the global Bleomycin market. The report includes CAGR, market shares, sales, gross margin, value, volume, and other vital market figures that give an exact picture of the growth of the global Bleomycin market. ...
Bleomycin Sulfate is a glycopeptide antibiotic and an anticancer agent for squamous cell carcinomas (SCC) with IC50 of 4 nM in UT-SCC-19A cells.
Professional guide for Bleomycin Sulfate. Includes: pharmacology, pharmacokinetics, contraindications, interactions, adverse reactions and more.
is an antitumor antibiotic that was isolated from a strain ofStreptomyces verticillusin 1966. It has been used successfully to treat a variety of malignancies, predominantly germ cell tumors and Hodgkin lymphoma. The major limitation of bleomycin the
BioMed Research International is a peer-reviewed, Open Access journal that publishes original research articles, review articles, and clinical studies covering a wide range of subjects in life sciences and medicine. The journal is divided into 55 subject-specific sections.
Rapamycin Regulates Bleomycin-Induced Lung Damage in SP-C-Deficient Mice. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
What is this medicine? BLEOMYCIN (blee oh MYE sin) is a chemotherapy drug. It is used to treat many kinds of cancer like lymphoma, cervical cancer, head and
ZEOCIN RESISTANCE. For Selecting Transfected Cells. To easily select cells that were transfected with our genetic circuit, we required a selectable marker that would work in all of our chassis, particularly HeLa cells and microglia, and would enable us to easily eliminate cells that have not taken up our recombinant plasmid. Zeocin is a widely used glycopeptide antibiotic, a formulation of phleomycin D1. It is capable of binding to and cleaving DNA, leading to cell necrosis in both eukaryotes and aerobic prokaryotes. Commonly outside of cells, in copper-chelated form, zeocin is inactive. When zeocin enters a cell, the Cu2+, which makes it appear blue, is reduced to Cu+ and then removed, activating zeocin, which then intercalates into DNA (Invitrogen). A 375 base pair bacterial gene encodes the Streptoalloteichus hindustanus bleomycin resistance protein (She ble protein). The She ble protein in mammalian cells is predominantly localised at the nucleus, specifically at euchromatin (Calmels et al. ...
ZEOCIN RESISTANCE. For Selecting Transfected Cells. To easily select cells that were transfected with our genetic circuit, we required a selectable marker that would work in all of our chassis, particularly HeLa cells and microglia, and would enable us to easily eliminate cells that have not taken up our recombinant plasmid. Zeocin is a widely used glycopeptide antibiotic, a formulation of phleomycin D1. It is capable of binding to and cleaving DNA, leading to cell necrosis in both eukaryotes and aerobic prokaryotes. Commonly outside of cells, in copper-chelated form, zeocin is inactive. When zeocin enters a cell, the Cu2+, which makes it appear blue, is reduced to Cu+ and then removed, activating zeocin, which then intercalates into DNA (Invitrogen). A 375 base pair bacterial gene encodes the Streptoalloteichus hindustanus bleomycin resistance protein (She ble protein). The She ble protein in mammalian cells is predominantly localised at the nucleus, specifically at euchromatin (Calmels et al. ...
Bleomycin, vincristine, cisplatin/bleomycin, etoposide, cisplatin chemotherapy: an alternating, dose intense regimen producing promising results in untreated patients with intermediate or poor prognosis malignant germ-cell ...
Theres a insufficient contemporary prospective data examining the ABVD (adriamycin, bleomycin, vinblastine, dacarbazine) and Stanford V (SV; doxorubicin, vinblastine, mechlorethamine, vincristine, bleomycin, etoposide, prednisone) regimens in old Hodgkin lymphoma (HL) individuals. been retrospective analyses which were reported in the 1980sC1990s; these analyses demonstrated 5-year overall success (Operating-system) rates of around 30%C45% (Levis, 1996, Mir, 1993, Roy, 2000, Stark, 2002, Weekes, 2002) A recently available Surveillance, Epidemiology and FINAL RESULTS (SEER) Program record indicated that results for HL in old individuals had improved as time passes (Brenner, 2008). Its important to note, nevertheless, that success rates in the last era (1980C1984) had been remarkably low (~20%), as the 2000C2004 survival rates remained significantly inferior compared with that seen in younger populations. Moreover, a recent retrospective analysis of older HL patients treated in the contemporary ...
The latest trending report Global Bleomycin Market 2020 by Manufacturers, Regions, Type and Application, Forecast to 2025 offered by DecisionDatabases.com is an informative study covering the market with detailed analysis. The report will assist reader with better understanding and decision making.. The global Bleomycin market size is expected to gain market growth in the forecast period of 2020 to 2025, with a CAGR of x% in the forecast period of 2020 to 2025 and will expected to reach USD x million by 2025, from USD x million in 2019.. The Bleomycin market report provides a detailed analysis of global market size, regional and country-level market size, segmentation market growth, market share, competitive Landscape, sales analysis, impact of domestic and global market players, value chain optimization, trade regulations, recent developments, opportunities analysis, strategic market growth analysis, product launches, area marketplace expanding, and technological innovations.. Final Report will ...
This 10-year follow-up study of 91 patients with disseminated testicular nonseminomatous cancer, treated with cisplatin, vinblastine, and bleomycin (PVB) induction chemotherapy and vinblastine plus bleomycin maintenance chemotherapy for a planned period of 2 years, shows a 63% cure rate. The predominant long-term sequelae are neurological and sexual dysfunction in 68% and 40% of patients, respectively. Two patients died of myocardial infarction. Sixteen percent of patients developed hypertension, 23% Raynauds phenomenon, and 25% ototoxicity. Despite the long-term side effects, 90% of the patients who responded to a questionnaire are fully employed. This study shows that the maintenance chemotherapy has contributed to the incidence and/or degree of neurotoxicity, hypertension, and renal function disturbance ...
Exosome isolation and purification. Exosome isolation, purification, and characterization were performed as previously described using iodixanol (OptiPrep) cushion density flotation (19). Briefly, concentrated conditioned media from human BM MSCs or HDFs were floated on an iodixanol cushion and centrifuged for 3.5 hours at 100,000 g at 4°C. The exosome-containing fraction (F9) was used for subsequent in vitro and in vivo experiments after confirming the presence of established exosome markers (ALIX, CD63, CD9, and FLOT1) (19).. Bleomycin-induced pulmonary fibrosis model. Fourteen-week-old mice (C57BL/6 strain, Charles River Laboratories) were anesthetized with isoflurane and received a single endotracheal dose of bleomycin sulphate (50 μL, 3 U/kg) at day 0. Bleomycin naive mice (control) received an endotracheal dose of saline (50 μL). Treated animals received a single i.v. (tail vein) dose of MEx (200 μL; dose, 5 × 106 MSC equivalents; ~8.6 × 108 particles) at day 0. HDF-derived exosomes ...
Methods Skin fibrosis was induced by local injections of bleomycin in two groups of DBA/2J mice. One group was cotreated with the synthetic cannabinoid WIN55,212-2 at 1 mg/kg/day. Skin fibrosis was evaluated by histology and skin thickness and hydroxyproline content were quantified. Markers of fibroblast activation, including α smooth muscle actin and the profibrotic cytokines transforming growth factor (TGF)β, connective tissue growth factor (CTGF) and platelet-derived growth factor (PDGF)-BB, were examined. Levels of PSMAD2/3, which are crucial in extracellular matrix overproduction, were analysed.. ...
The ED-A splice variant of FN is an important element controlling myofibroblast activation during wound healing and development of fibrosis (Klingberg et al., 2013; Shinde et al., 2015; White et al., 2008). Part of this action appears to be mediated by binding of ED-A FN-specific integrins. Integrins α9β1 and α4β1 recognize the EDGIHEL motif in ED-A FN (Liao et al., 2002; Shinde et al., 2008), and blocking antibodies against α4-integrins reduce the extent of bleomycin-induced lung fibrosis in mice (Gailit et al., 1993; Wang et al., 2000). This effect is likely caused by affecting inflammatory cells that most prominently express α4β1 integrin. The ED-A FN-binding integrin α4β7 has been directly implicated in myofibroblast differentiation of murine lung fibroblasts (Kohan et al., 2011, 2010). ED-A FN−/− mice are protected against bleomycin-induced skin and lung fibrosis (Muro et al., 2003, 2008) but not from experimentally induced liver fibrosis (Olsen et al., 2012). Notably, ED-A ...
Visit your doctor for checks on your progress. This drug may make you feel generally unwell. This is not uncommon, as chemotherapy can affect healthy cells as well as cancer cells. Report any side effects. Continue your course of treatment even though you feel ill unless your doctor tells you to stop.. Call your doctor or health care professional for advice if you get a fever, chills or sore throat, or other symptoms of a cold or flu. Do not treat yourself. This drug decreases your bodys ability to fight infections. Try to avoid being around people who are sick.. Avoid taking products that contain aspirin, acetaminophen, ibuprofen, naproxen, or ketoprofen unless instructed by your doctor. These medicines may hide a fever.. Do not become pregnant while taking this medicine. Women should inform their doctor if they wish to become pregnant or think they might be pregnant. There is a potential for serious side effects to an unborn child. Talk to your health care professional or pharmacist for more ...
Visit your doctor for checks on your progress. This drug may make you feel generally unwell. This is not uncommon, as chemotherapy can affect healthy cells as well as cancer cells. Report any side effects. Continue your course of treatment even though you feel ill unless your doctor tells you to stop.. Call your doctor or health care professional for advice if you get a fever, chills or sore throat, or other symptoms of a cold or flu. Do not treat yourself. This drug decreases your bodys ability to fight infections. Try to avoid being around people who are sick.. Avoid taking products that contain aspirin, acetaminophen, ibuprofen, naproxen, or ketoprofen unless instructed by your doctor. These medicines may hide a fever.. Do not become pregnant while taking this medicine. Women should inform their doctor if they wish to become pregnant or think they might be pregnant. There is a potential for serious side effects to an unborn child. Talk to your health care professional or pharmacist for more ...
We intend to continue our exploration of the bleomycin assay as a biological marker for the development of environmentally induced cancers. The impetus for such efforts would be enhanced through effective integration of cancer screening and intervention to achieve diminished cancer mortality. Currently, we are integrating combining bleomycin sensitivity screening to chemopreventive therapy against second primary malignancies in head and neck cancer patients. Previous studies have demonstrated that cis-retinoic acid, the agent used in our chemopreventive trial, is effective in such circumstances (35). Our purpose is to identify a high-risk subpopulation through application of the bleomycin sensitivity assay and then demonstrate that we can modulate the carcinogenic process with cis-retinoic acid. The use of genetic markers clearly enhances the power and precision of epidemiological research. The preventive implications of precise and valid markers for carcinogen sensitivity are obvious. We are ...
Loss of Thy-1 expression in fibroblasts correlates with lung fibrogenesis; however, the clinical relevance of therapeutic targeting of myofibroblasts via Thy-1-associated pathways remains to be explored. Using single (self-resolving) or repetitive (nonresolving) intratracheal administration of bleomycin in type 1 collagen-GFP reporter mice, we report that Thy-1 surface expression, but not mRNA, is reversibly diminished in activated fibroblasts and myofibroblasts in self-resolving fibrosis. However, Thy-1 mRNA expression is silenced in lung with nonresolving fibrosis following repetitive bleomycin administration, associated with persistent activation of αv integrin. Thy1-null mice showed progressive αv integrin activation and myofibroblast accumulation after a single dose of bleomycin. In vitro, targeting of αv integrin by soluble Thy-1-Fc (sThy-1), but not RLE-mutated Thy-1 or IgG, reversed TGF-β1-induced myofibroblast differentiation in a dose-dependent manner, suggesting that Thy-1s ...
Bleomycin sulphate Baxter is a Antibiotics / antineoplastics: it is used to treat Pneumothorax. Low Prices Guaranteed. Flat 5% Off at zentherapycenter.com!
The mechanisms underlying the pathogenesis of idiopathic pulmonary fibrosis (IPF) involve multiple pathways, such as inflammation, epithelial mesenchymal transition, coagulation, oxidative stress, and developmental processes. The small GTPase, RhoA, and its target protein, Rho-kinase (ROCK), may interact with other signaling pathways known to contribute to pulmonary fibrosis. This study aimed to determine the beneficial effects and mechanisms of fasudil, a selective ROCK inhibitor, on bleomycin-induced pulmonary fibrosis in mice. Our results showed that the Aschcroft score and hydroxyproline content of the bleomycin-treated mouse lung decreased in response to fasudil treatment. The number of infiltrated inflammatory cells in the bronchoalveolar lavage fluid (BALF) was attenuated by fasudil. In addition, fasudil reduced the production of transforming growth factor-β1 (TGF-β1), connective tissue growth factor (CTGF), alpha-smooth muscle actin (α-SMA), and plasminogen activator inhibitor-1 (PAI-1)
TY - JOUR. T1 - Alveolar surfactant protein D content modulates bleomycin-induced lung injury. AU - Casey, John. AU - Kaplan, Jennifer. AU - Atochina-Vasserman, Elena N.. AU - Gow, Andrew J.. AU - Kadire, Helchem. AU - Tomer, Yaniv. AU - Fisher, James H.. AU - Hawgood, Samuel. AU - Savani, Rashmin C.. AU - Beers, Michael F.. PY - 2005/10/1. Y1 - 2005/10/1. N2 - Rationale: Surfactant protein D (SP-D) is a collectin family member with demonstrated immunomodulatory properties in vitro. We hypothesized that SP-D modulates inflammation during noninfectious lung injury in vivo. Objectives: To investigate the association of alveolar SP-D and injury, we studied the responses of transgenic mice expressing varying levels of SP-D to intratracheal bleomycin (ITB). Methods: Eight-week old C57/BL6 SP-D-deficient (-/-) mice and syngeneic wild-type (WT) controls or Swiss Black SP-D-overexpressing (SP-D OE) mice and littermate controls received either ITB or saline and were followed for up to 21 d. Measurements ...
Circulating fibrocytes had been reported to migrate into the injured lungs, and contribute to fibrogenesis via chemokine-chemokine receptor systems including CXCL12-CXCR4 axis. Here we hypothesized that blockade of CXCR4 might inhibit the migration of fibrocytes to the injured lungs and the subsequent pulmonary fibrosis. To explore the antifibrotic effects of blockade of CXCR4, we used a specific antagonist for CXCR4, AMD3100, in bleomycin-induced pulmonary fibrosis model in mice. Administration of AMD3100 significantly improved the loss of body weight of mice treated with bleomycin, and inhibited the fibrotic lesion in subpleural areas of the lungs. The quantitative analysis demonstrated that treatment with AMD3100 reduced the collagen content and fibrotic score (Aschcroft score) in the lungs. Although AMD3100 did not affect cell classification in bronchoalveolar lavage fluid on day 7, the percentage of lymphocytes was reduced by AMD3100 on day 14. AMD3100 directly inhibited the migration of ...
The specific role of Toll-like receptor 4 (TLR4) in bleomycin-induced lung fibrosis of mice, a model of human idiopathic pulmonary fibrosis, has not been characterized. We injected bleomycin intratracheally into TLR4 knockout (TLR4-/-) and wild-type (WT) mice. Twenty-one days after injection, mice were sacrificed and their lungs were harvested for pathological, hydroxyproline, mRNA expression, and collagen I analyses. Body weight changes and mortality were observed.
TY - JOUR. T1 - Abatement of bleomycin-induced increases in vascular permeability, inflammatory cell infiltration, and fibrotic lesions in hamster lungs by combined treatment with taurine and niacin. AU - Wang, Q.. AU - Hyde, D. M.. AU - Giri, S. N.. PY - 1992. Y1 - 1992. N2 - BACKGROUND: The bleomycin (BL) hamster model of interstitial pulmonary fibrosis has been widely used to study the pathogenesis of interstitial pulmonary fibrosis and to screen potentially desirable antifibrotic agents. We have recently shown that taurine and niacin in combination, diminished BL- induced increases in lung lipid peroxidation and hydroxyproline content in hamsters. In the present study, we have evaluated the effects of taurine and niacin on the bronchoalveolar lavage (BAL) cells, and morphologic and morphometric features of the lung in the same model of pulmonary fibrosis. EXPERIMENTAL DESIGN: The hamsters were divided into 4 groups: saline; taurine + niacin + saline; BL; and taurine + niacin + BL. Treatment ...
TY - JOUR. T1 - Carbon black nanoparticles enhance bleomycin-induced lung inflammatory and fibrotic changes in mice. AU - Kamata, Hirofumi. AU - Tasaka, Sadatomo. AU - Inoue, Ken Ichiro. AU - Miyamoto, Keisuke. AU - Nakano, Yasushi. AU - Shinoda, Hiromi. AU - Kimizuka, Yoshifumi. AU - Fujiwara, Hiroshi. AU - Ishii, Makoto. AU - Hasegawa, Naoki. AU - Takamiya, Rina. AU - Fujishima, Seitaro. AU - Takano, Hirohisa. AU - Ishizaka, Akitoshi. PY - 2011/3/1. Y1 - 2011/3/1. N2 - With the recent increasing use of nanoparticles, there is concern that they may become an environmental risk factor as airborne particles. However, the impact of these particles on susceptible subjects with predisposing lung disease have not been sufficiently elucidated. In the present study, we investigated the effects of nanoparticles on pulmonary inflammatory and fibrotic changes induced by intratracheal bleomycin (BLM) challenge in mice. Mice were intratracheally administered either vehicle, 14-nm carbon black nanoparticles ...
BLEOCIN™ Streptomyces verticillus, Sterile-Filtered, Aqueous Solution - CAS 55658-47-4 - Calbiochem CAS 55658-47-4 A unique antibiotic of the bleomycin family that is toxic to eukaryotic and prokaryotic cells. - Find MSDS or SDS, a COA, data sheets and more information.
TY - JOUR. T1 - Effects of repeated administration of N-acetyl-l-cysteine on sulfhydryl levels of different tissues and bleomycin-induced lung fibrosis in hamsters. AU - Giri, Shri N.. AU - Hyde, Dallas M.. AU - Schiedt, Mary J.. PY - 1988. Y1 - 1988. N2 - N-Acetyl-l-cysteine (NAC), 50, 100, 200, or 400 mg/kg, was Injected intraperltoneally once a day for 13 days: No change was seen In the total sulfhydryl (TSH) and nonproteln sulfhydryl (NPSH) contents of the liver, kidney, and plasma at any dose: The heart TSH level remained unchanged, but the NPSH level was increased from the control value of 16 nmol/mg to 18,19, and 18 nmol/ mg protein at 50,100, and 200 mg/kg, respectively: The lung TSH and NPSH levels both were increased from the control values of 65 and 8 nmol/mg to 80 and 16 nmol/mg protein, respectively, at 200 mg/kg. The lung TSH level at 400 mg/kg NAC was not changed, but the NPSH level Increased to 13:5 nmol/mg protein. The ratio of TSH to NPSH levels In the liver and kidney was 4:1, ...
Phleomycin belongs to the bleomycin antibiotic family from Streptomyces verticillus an actino bacteria. Phleomycin belongs to the bleomycin antibioti…
Background Weve previously explored a therapeutic strategy for specifically targeting the profibrotic activity of IL-13 during experimental pulmonary fibrosis using a fusion protein comprised of human IL-13 and a mutated form of exotoxin A (IL13-PE) and observed that the intranasal delivery of IL13-PE reduced bleomycin-induced pulmonary fibrosis through its elimination of IL-13-responsive cells in the lung. of whole lung samples were performed at day 28 after bleomycin. Intrapulmonary infection promoted a neutralizing IgG2A and IgA antibody response in BALF and serum. Surprisingly, histological analysis showed a prior disease attenuated the introduction of bleomycin-induced pulmonary fibrosis, that was further attenuated from the intranasal administration of IL13-PE modestly. Although prior intranasal administration CGI1746 of IL13-PE didnt elicit an antibody response, the systemic administration of IL13-PE induced a solid neutralizing antibody response. Nevertheless, the last systemic ...
Compared to younger patients, patients over 60 years of age with HL have significantly inferior outcomes. Older HL patients are not only more likely to have risk factors associated with poor prognosis, such as B symptoms, mixed cellularity type, or poor performance status, but a major reason for their poor outcomes is reduced tolerability of treatment.2,3 In the North American Intergroup Study, overall treatment-related mortality was 9% for patients over 60 compared with 0.3% for younger patients. Furthermore, bleomycin lung toxicity was observed in 43% of older patients treated with ABVD, which is significantly higher than expected for younger patients.3 The German Hodgkin Study Group (GHSG) reported a similar experience in the HD10 and HD11 studies, in which patients 60 years and older receiving 4 cycles of ABVD experienced substantial dose reductions, delays, toxicity, and treatment-related toxicity.4 As a result, treatment approaches for older HL patients vary. Some fit patients are treated ...
Feifukang (FFK) is a traditional Chinese medicine composed of herbs that protect lung function. However, difficulty arises regarding the clinical application of FFK due to the complex mechanism of Chinese medicines. This study aimed to investigate the efficacy of FFK and explore its targeted genes and pathways. Histopathological changes and collagen deposition were measured to evaluate the effect of FFK on bleomycin-induced pulmonary fibrosis in mice. The differentially expressed targeted genes and pathways were first screened using RNA sequencing. Then network pharmacology and other experiments were conducted to confirm RNA sequencing data. FFK treatment reduced the pathological score and collagen deposition, with a decrease in α-SMA and collagen. RNA sequencing and network pharmacology results all showed that FFK can ameliorate pulmonary fibrosis through multi-genes and multi-pathways. The targeted genes in JAK-STAT signaling pathway are some of the most notable components of these multi-genes and
TY - JOUR. T1 - Chondrosarcoma. T2 - Its treatment by radiation, hyperthermia and bleomycin. AU - Okuyama, S.. AU - Itoh, M.. AU - Tanaka, K.. AU - Matsuzawa, T.. PY - 1978/12/1. Y1 - 1978/12/1. N2 - A case of chondrosarcoma of the mandible of surgical failure was treated by radiation, hyperthermia, and bleomycin. The treatment resulted in selective necrosis of the tumor. This can be designated as perpetuation principle of radiothermotherapy because bleomycin may inhibit the repair processes of heat and radiation damage. This principle appears to offer selectivity of the therapeutic effects, to open a way to treatment of those radioresistant selectivity of the therapeutic effects, open a way to treatment of those radioresistant malignancies, and to enhance curability of various medium-sensitive tumors. Additionally, a course of large-dose glutathione infusion was confirmed to promptly alleviate radiation dermatitis and mucositis.. AB - A case of chondrosarcoma of the mandible of surgical failure ...
To examine the effects of bleomycin A5 on infantile maxillofacial haemangiomas. Bleomycin A5 was given by multiple intralesinoal injections and the dosage was given according to the age of the patient and size of the lesion. Parts of patients were accompanied by prednisone treatment(2-5 mg/kg, po, QOD. All the haemangiomas involuted completely after treated with bloemycin A5 with better recovery of skin color and less scar forming in small haemangiomas. Infantile haemangioma could be effectively treated with bleomycin A5 without serious side effects.
To examine the effects of bleomycin A5 on infantile maxillofacial haemangiomas. Bleomycin A5 was given by multiple intralesinoal injections and the dosage was given according to the age of the patient and size of the lesion. Parts of patients were accompanied by prednisone treatment(2-5 mg/kg, po, QOD. All the haemangiomas involuted completely after treated with bloemycin A5 with better recovery of skin color and less scar forming in small haemangiomas. Infantile haemangioma could be effectively treated with bleomycin A5 without serious side effects.
1JIE: The 1.6-A crystal structure of the copper(II)-bound bleomycin complexed with the bleomycin-binding protein from bleomycin-producing Streptomyces verticillus.
Micronucleus (MN) assay is a well standardized approach for evaluation of clastogenic/aneugenic effects of mutagens. Fluorescence in situ hybridization (FISH) is successfully used to characterize the chromosomal content of MN. However, the relationships between nuclear positioning, length, and gene density of individual chromosomes and their involvement in MN induced by different mutagens have not been clearly defined. Chromosomal content of MN was characterized in human leukocytes treated with mitomycin C (MMC) and bleomycin (BLM) by FISH using centromeric (cep) and whole-chromosome painting (wcp) probes. Involvement of chromosomes 8, 15 and 20 in MMC-induced and chromosomes 1, 9 and 16 in BLM-induced MN was studied, and correlated with chromosome size, gene density and interphase position. The results obtained were analyzed together with previous own data on the frequencies of inclusion of chromosomes 3, 4, 6, 7, 9, 16, 17, 18, and X in MMC-induced MN. It could be shown that MMC- and BLM-induced MN
Pingyangmycin is an anticancer drug known as bleomycin A5 (A5), discovered in the Pingyang County of Zhejiang Province of China. Bleomycin (BLM) is a mixture of mainly two compounds (A2 and B2), which is on the World Health Organizations list of essential medicines. Both BLM and A5 are hydrophilic molecules that depend on transporters or endocytosis receptors to get inside of cells. Once inside, the anticancer activities rely on their abilities to produce DNA breaks, thus leading to cell death. Interestingly, the half maximal inhibitory concentration (IC50) of BLMs in different cancer cell lines varies from nM to μM ranges. Different cellular uptake, DNA repair rate, and/or increased drug detoxification might be some of the reasons; however, the molecules and signaling pathways responsible for these processes are largely unknown. In the current study, we purified the A2 and B2 from the BLM and tested the cytotoxicities and the molecular mechanisms of each individual compound or in combination with six
Radiologic findings after EP/ECT of large hepatic vessels and hepatic parenchyma were characterized in a porcine model, which was selected due to anatomical and physiological similarities with the human liver.1, 33 The results showed decreased perfusion in the treated area. This finding was an anticipated result since EP/ECT induces a local blood flow modifying effect or vascular lock characterized by the vasoconstriction and increased wall permeabilization of small blood vessels. The effect on perfusion is shorter in EP compared to that in ECT and shorter in healthy compared to tumor tissue, which is known as the vascular disrupting effect. Chemotherapeutic drugs are cytotoxic to endothelial cells, especially neoplastic endothelial cells, and this effect prolongs decreased perfusion.34, 35, 36, 37, 38, 39, 40, 41 In our case, there was no difference between EP and ECT, and no vascular disrupting effect was observed in healthy hepatic parenchyma28, which confirms that bleomycin at the doses ...
Background: Bleomycin (BLM) is an anti-cancer drug widely used in the treatment of cancer. BLM causes several side effects related to DNA and cellular damage. The aim of this study was investigated the effects of tea polyphenol epicatechin on anti-proliferative effects induced by bleomycin in human normal skin and human ...
Montoto, S.; Camos, M.; Lopez-Guillermo, A.; Bosch, F.; Cervantes, F.; Blade, J.; Esteve, J.; Cobo, F.; Nomdedeu, B.; Campo, E.; Montserrat, E., 2000: Hybrid chemotherapy consisting of cyclophosphamide, vincristine, procarbazine, prednisone, doxorubicin, bleomycin, and vinblastine (C-MOPP/ABV) as first-line treatment for patients with advanced Hodgkin disease
INTRODUCTION. Cáncer is a genetic disorder caused by the alteration of a normal DNA cell due to exposure to physical, Chemicals or biological agents (Van Zanden et al., 2005) . Cancer disease is still one of the most important health problems and cause of death in our world where technology is developing rapidly. Globally, about 7.6 million people lose their lives from cancer each year. By the year 2025, this number is estimated to be about 25 million (Siegel et al., 2014). Recently, alternative methods have been developed in the treatment of cancer, but radiotherapy, chemotherapy, surgery, and immunotherapy have been used in general (Konishi et al., 2003). Today, the most common cancer treatment is chemotherapy. Chemotherapeutic drugs used in the treatment of cancer affect tumor cells and prevent growth and proliferation of cells. On the other hand, these drugs also affect normal cells in the body, leading to various side effects. Chemotherapy drugs known as antineoplastic agents are chemical ...
Sigma-Aldrich offers abstracts and full-text articles by [Yoon Hee Cho, Joong Won Lee, Hae Dong Woo, Sunyeong Lee, Yang Jee Kim, Younghyun Lee, Sangah Shin, Hyojee Joung, Hai Won Chung].
Sirtuin 1 (SIRT1) is a protein deacetylases that is involved in regulation of cell metabolism, stress response and aging. Resveratrol, a polyphenol found in wines, it has been described as a potent activator of SIRT1 enzyme. Several studies have shown that resveratrol treatment can prevent progression of wide variety of age-associated diseases, including the pulmonary diseases. Therefore, we aim to investigate the mechanism by which SIRT1 might regulate the development and progression of lung fibrosis.. Bleomycin-treated mice were gavaged with saline or with resveratrol daily. At the day 14 all mice were sacrificed, lung function was measured and lung tissues were excised and processed for further analysis. The results have shown increased survival rate of resveratrol-treated animals, as well as significantly improved lung function. Resveratrol treatment markedly reduced levels of fibrotic markers such as fibronectin, collagen I and collagen IV. Furthermore, our data have demonstrated that ...
The role of the immune response in lung fibrosis and its potential as therapeutic target are not clearly established. Here, we provide evidence for a functional contribution of Fra-2-expressing macrophages to the paracrine activation of fibroblasts and to lung fibrosis (Figure 8F). We identify ColVI as a Fra-2 transcriptional target in macrophages and unravel a profibrogenic role for ColVI in vitro and in vivo. Importantly, inhibiting Fra-2/AP-1 or ColVI is therapeutically relevant in mouse models of lung fibrosis.. The fibrotic phenotype in the Fra-2Tg model of fibrosis is reminiscent of a type 2 cytokine-driven disease with enhanced IL-4 expression, IL-4 pathway signature, eosinophil/neutrophil infiltration, and M(IL-4) macrophage enrichment (25, 28, 46). The contribution of type 2 cytokines, IL-4 and IL-13, to macrophage activation and fibrosis development in different organs is well accepted (4, 47, 48). Lung-specific expression of these cytokines increases after bleomycin treatment, ...
This partially randomized phase III trial studies how well active surveillance, bleomycin, carboplatin, etoposide, or cisplatin work in treating pediatric and adult patients with germ cell tumors. Active surveillance may help doctors to monitor subjects with low risk germ cell tumors after their tumor is removed. Drugs
DNA damaging agents such as the antitumor drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA. Amongst these is base-loss which forms apurinic/apyrimidinic (AP) sites or strand breaks with atypical 3termini. DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3terminus of DNA strand breaks ...
Bleomycin is used in the treatment of Cervical cancer, Cancer of mouth, nasopharynx and paranasal sinuses, larynx, oesophagus, Skin cancer. View Bleomycins uses, side-effects, drug interactions, expert advice and user FAQs only on 1mg.com.
Naprobleo (15 mg) 15mg/1vial - 1Vial Injection (Bleomycin) drug information. Find its price or cost, dose, when to use, how to use, side effects, adverse effects, substitutes. It is manufactured by Miracalus Pharma Pvt Ltd.
This study was designed to investigate the effect of particulate matter with a diameter of ≤2.5 μm (PM2.5) on bleomycin (BLM) induced pulmonary fibrosis. Thirty-two Sprague Dawley rats were assigned into four groups (intratracheal instillation of 500 μL of PBS (control), 2 mg/kg PM2.5, 3.5 mg/kg BLM A5, and BLM plus 2.0 mg/kg PM2.5) and were fed for 14 days. All rats were sacrificed after the study. Lung tissues and bronchoalveolar lavage fluid were prepared for histological and biological analysis. We found that PM2.5 caused dose-trend pulmonary alveolitis and fibrosis. Histological scores, expression of α-SMA and Collagen I as well as contents of TNF-α and IL-6 in lung tissues were upregulated by treatment of PM2.5. PM2.5 did not change the percentage of neutrophils and macrophages. The expression of endoplasmic reticulum (ER) stress markers Chop and GRP78 was upregulated by treatment of PM2.5. In comparison with either PM2.5 or BLM treatment, BLM plus PM2.5 treatment induced higher ...
Impact of dose reductions of bleomycin and vincristine in patients with advanced Hodgkin Lymphoma treated with BEACOPP polychemotherapy: A comprehensive analysis of the German Hodgkin Study Group (GHSG) HD12 and HD15 ...
Murata Official product details information. Here are the latest datasheet, appearance & shape, specifications, features, applications, product data of Ferrite Beads/Frequency Specified Filters BLE32PN300SH1(BLE32PN300SH1B,BLE32PN300SH1K,BLE32PN300SH1L).Specifications:Shape=SMD,Size Code (in mm)=3225,Size Code (in inch)=1210,Length=3.2mm,Length Tolerance=±0.2mm,Width=2.5mm,Width Tolerance=±0.2mm,Thickness=2.0mm,Thickness Tolerance=±0.2mm,Impedance (at 100MHz)=30Ω,Impedance (at 100MHz) Tolerance=±10Ω,Rated Current (at 85℃)=10A,Rated Current (at 125℃)=10A,DC Resistance(max.)=1.6mΩ,Operating Temperature Range=-55℃ to 125℃,Mass(typ.)=0.08g,Number of Circuit=1,Automotive Usage=Powertrain/Safety
Airway inflammation: Bleomycin-induced pulmonary fibrosis, COPD. We also study obstructive sleep apnea symptoms (OSA) and bronchospasm
Full Title IIT (CA209-447): Phase I/II of Nivolumab and A(B)VD in the Front-line Setting for Hodgkin Lymphoma Purpose The standard treatment for newly diagnosed high-risk Hodgkin lymphoma is chemotherapy with doxorubicin (Adriamycin), bleomycin, vinblastine, and dacarbazine (ABVD). Patients over age 60 receive this therapy without bleomycin (AVD) to reduce side effects.
GT:ID BAD55372.1 GT:GENE BAD55372.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 543234..543653 GB:FROM 543234 GB:TO 543653 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55372.1 LENGTH 139 SQ:AASEQ MSSKMIFINLPVRELSRSKDFYQALGWKLNEDFTDDNAACIVVDDNICLMLLTRQYFQTFTKRPVAETTGATGAAYALSLGSAAEVDALTEAALAAGGSEEVNEDKRAQEAEVGMHGRTFLDPDGHQWEPFWMDYPGGA GT:EXON 1,1-139:0, SEG 66-,85,aettgatgaayalslgsaae, RP:PDB:NREP 1 RP:PDB:REP 4-,132,3e5dA,2e-08,15.6,122/122, HM:PFM:NREP 1 HM:PFM:REP 8-,129,PF00903,1.3e-06,22.6,115/128,Glyoxalase, RP:SCP:NREP 1 RP:SCP:REP 4-,129,1sp9A,4e-09,7.3,123/362,d.32.1.3, HM:SCP:REP 1-,134,1tsjA_,1.2e-20,31.5,127/0,d.32.1.7,1/1,Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase, OP:NHOMO 108 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- ...
Labeled free bases could be detected chromatographically after reaction of deoxyribonucleic acid with high concentrations of the antibiotic bleomycin. Thymine, adenine, guanine, and cytosine were released from DNAs previously labeled in the base moiety with each of the four bases. No detectable amounts of nucleosides, nucleotides, deoxyribose, deoxyribose phosphate, or inorganic phosphate were released.. ...
Bleomycin sulfate (15.0 mg/ml) No breakthrough up to 240 minutes Busulfan (6.0mg/ml) No breakthrough up to 240 minutes Carboplatin (10.0mg/ml) No breakthrough up to 240 minutes Cisplatin (1.0 mg/ml) No breakthrough up to 240 minutes Cyclophosphamide (20.0 mg/ml) No breakthrough up to 240 minutes Cytarabine HCL (100.0 mg/ml) No breakthrough up to 240 minutes Dacarbazine (10.0 mg/ml) No breakthrough up to 240 minutes Daunombicin HCL (5.0 mg/ml) No breakthrough up to 240 minutes Docetaxel (10.0 mg/ml) No breakthrough up to 240 minutes Doxorubicin HDC (2.0 mg/ml) No breakthrough up to 240 minutes Ellence (Epirubicin) (2.0 mg/ml) No breakthrough up to 240 minutes Etoposide (20.0 mg/ml) No breakthrough up to 240 minutes Fludarabine (25.0 mg/ml) No breakthrough up to 240 minutes Fluorouracil (50.0 mg/ml) No breakthrough up to 240 minutes Gemcitabine (38.0 mg/ml) No breakthrough up to 240 minutes Idarubicin (1.0 mg/ml) No breakthrough up to 240 minutes Ifosfamide (50.0 mg/ml) No breakthrough up to 240 ...
Cervical cancer refers to cancer of cervix. It is treated through surgery, radiation and chemotherapy. Drugs used for treatment include cisplatin, ifosfamide, fluorouracil, paclitaxel, topotecan hydrochloride, bevacizumab and bleomycin sulfate. HPV vaccines provide immunity against the disease. Read on to find more.
This phase III trial studies how well active surveillance, bleomycin, carboplatin, etoposide, or cisplatin work in treating pediatric and adult patients with germ cell tumors. Active surveillance may help doctors to monitor subjects with low risk germ cell tumors after their tumor is removed. Drugs used in chemotherapy, such as bleomycin, carboplatin, etoposide, and cisplatin, work in different ways to stop the growth of tumor cells, either by killing the cells, by stopping them from dividing, or by stopping them from spreading.. ...
He concluded that JNK1 ablation from lung epithelial cells almost completely protects against TGF-β1 or bleomycin-induced fibrosis and delayed JNK1 ablation prevents further enhancement of fibrosis. This demonstrates the crucial role for epithelial-based JNK1 activation in the development of the fibrogenic response, a part of EMT (epithelial mesenchymal transformation). He then went on to dicuss the utility of micro RNA analysis to understand the specific signaling pathways involved in these responsed. He found that JNK1 / Smad 3 regulates Let-7g miRNA expression and that Let-7 miRNA expression is down regulated in vivo following TGF-b1 expression. This is very novel information and the data was quite convincing. The future plans for his lab include determining whether lack of EMT in the absence of JNK1 or SMAD3 is overcome by expression of let-7g anti-miRNA inhibitor. This would be a significant outcome for future clinical trials. His methods were clear and extremely interesting, this ...
Also, the glycopeptide bleomycin is used for the treatment of several cancers including Hodgkin's lymphoma, head and neck ... "Bleomycin". US National Library of Medicine. Retrieved 28 January 2015. Alvin A, Miller KI, Neilan BA (2014). "Exploring the ... Botulinum toxin (from Clostridium botulinum) and bleomycin (from Streptomyces verticillus) are two examples. Botulinum, the ...
Examples of the bleomycins in clinical use include bleomycin A2 (also known as bleomycin) and bleomycin A5 (also known as ... "Bleomycin". US National Library of Medicine. Retrieved 5 March 2015. Aouida M, Ramotar D (2010). "A new twist in cellular ... resistance to the anticancer drug bleomycin-A5". Curr Drug Metab. 11 (7): 595-602. doi:10.2174/138920010792927307. PMID ...
"Bleomycin". US National Library of Medicine. Retrieved 27 July 2020. Borel JF, Kis ZL, Beveridge T (1995). "The history of the ... These include the anticancer drug bleomycin (obtained from the soil bacterium Streptomyces verticillus), the immunosuppressant ...
Applications for treatment of cutaneous and subcutaneous tumors have reached clinical use by utilizing drugs such as bleomycin ... In the clinical use of electrochemotherapy, limited side effects related to bleomycin or cisplatin use are recorded. Provided ... January 2008). "Vascular disrupting action of electroporation and electrochemotherapy with bleomycin in murine sarcoma". Br. J ... bleomycin) or low-permeant drugs (e.g. cisplatin) and applying electric pulses to the area to be treated when the concentration ...
Bleomycin List of cutaneous conditions Rapini, Ronald P.; Bolognia, Jean L.; Jorizzo, Joseph L. (2007). Dermatology: 2-Volume ... 950-1. ISBN 978-1-4160-2999-1. Ibrahimi, Omar A.; Anderson, R. Rox (2010). "Bleomycin-Induced Flagellate Hyperpigmentation". ...
2004). "Bleomycin-induced scleroderma". The Journal of the Association of Physicians of India. 52: 76-7. PMID 15633728. Farrant ... Bleomycin (a chemotherapeutic agent) and possibly taxane chemotherapy may cause scleroderma, and occupational exposure to ...
Thus, bleomycin as a combination therapy may be an option to treat tumours. Efficacy rates of bleomycin in conjunction with ... In a study of combining bleomycin and other medicinal agents in bladder cancer cells, results showed bleomycin induced DNA ... Bleomycin also acts via interfering with cell wall synthesis in the target bacteria, however the exact mechanism of action is ... Bleomycin use causes side effects ranging from nausea, vomiting, anorexia and fevers, to fatal pulmonary toxicity in 1-2% of ...
... bleomycin, enediynes, and mitomycin". Chemical Reviews. 105 (2): 739-58. doi:10.1021/cr030117g. PMID 15700963. Zhang, C; ...
Galm, U; Hager, MH; Van Lanen, SG; Ju, J; Thorson, JS; Shen, B (Feb 2005). "Antitumor antibiotics: bleomycin, enediynes, and ...
Koldamova RP, Lefterov IM, DiSabella MT, Almonte C, Watkins SC, Lazo JS (1999). "Human bleomycin hydrolase binds ribosomal ... "Human bleomycin hydrolase binds ribosomal proteins". Biochemistry. 38 (22): 7111-7. doi:10.1021/bi990135l. PMID 10353821. Zhang ...
No high quality evidence has evaluated the use of bleomycin in this condition. Proton therapy affords a reduction in dose to ... Zhang, Si; Fang, Yuan; Cai, Bo Wen; Xu, Jian Guo; You, Chao (2016-07-14). "Intracystic bleomycin for cystic craniopharyngiomas ... or bleomycin delivered via an external reservoir are sometimes employed, especially in young patients. The tumor, being in the ...
Bleomycin ingestion may also cause similar findings. On physical exam, one key difference between the two is that post- ... inflammatory hyperpigmentation changes are usually seen with bleomycin-induced flagellate dermatitis and are not typically ...
... and other related chemicals in the bleomycin family of compounds are primarily used in molecular biology as an ... Gatignol, A., Durand, H. & Tiraby, G. (1988). "Bleomycin resistance conferred by a drug-binding protein". FEBS Lett. 230: 171- ... a glycopeptide antibiotic and one of the phleomycins from Streptomyces verticillus belonging to the bleomycin family of ... "Copper-dependent cleavage of DNA by bleomycin". Biochemistry. 26 (3): 931-42. doi:10.1021/bi00377a038. PMID 2436656. Chankova ...
Twohig KJ, Matthay RA (March 1990). "Pulmonary effects of cytotoxic agents other than bleomycin". Clinics in Chest Medicine. 11 ...
Certain drugs such as amiodarone, bleomycin and methotrexate. As a consequence of another disease such as rheumatoid arthritis ...
Treatment with cisplatin, etoposide, and bleomycin has been described. Before modern chemotherapy, this type of neoplasm was ...
Other cytotoxic antibiotics are anthracyclines, mitomycin C, bleomycin, mithramycin. Antibodies are sometimes used as a quick ...
The pulmonary fibrosis produced by paraquat and the antitumor agent bleomycin is also thought to be induced by the pro-oxidant ... These include adriamycin and other anthracyclines, bleomycin, and cisplatin. These agents may show specific toxicity towards ...
... and bleomycin); and infusional EPOCH (i.e. etoposide, prednisone, vincristine, cyclophosphamide, and doxorubicin). While the ...
Pulmonary fibrosis is a classical adverse effect of bleomycin; however, the incidence of pulmonary fibrosis in the brentuximab ... The ECHELON-1 phase 3 trial compared brentuximab vedotin with bleomycin both in combination with adriamycin, vinblastine, ... bleomycin, vinblastine, and dacarbazine) versus A+AVD (a combination of brentuximab vedotin plus AVD, or doxorubicin, ... for treatment of classical Hodgkin lymphoma and found substituting brentuximab vedotin for bleomycin has both improved efficacy ...
This occurs when bleomycin binds to a metal ion, becomes chemically reduced and reacts with oxygen. Mitomycin is a cytotoxic ... Bleomycin, a glycopeptide isolated from Streptomyces verticillus, also intercalates DNA, but produces free radicals that damage ... Dorr RT (April 1992). "Bleomycin pharmacology: mechanism of action and resistance, and clinical pharmacokinetics". Seminars in ... bleomycin) and occasionally secondary neoplasm (e.g., MOPP therapy for Hodgkin's disease). Hand-foot syndrome is another side ...
Bleomycin - A more potent chemotherapy drug, can be injected into deep warts, destroying the viral DNA or RNA. Bleomycin is ... "Efficacy of Intralesional Bleomycin in Palmo-plantar and Periungual Warts". Journal of Cutaneous and Aesthetic Surgery. 4 (3): ...
Bleomycin, a more potent chemotherapy drug, can be injected into deep warts, destroying the viral DNA or RNA. Bleomycin is ... This may include salicylic acid, cryotherapy, chemo-based fluorouracil or bleomycin, and surgical removal. The skin atop the ... "Efficacy of Intralesional Bleomycin in Palmo-plantar and Periungual Warts". Journal of Cutaneous and Aesthetic Surgery. 4 (3): ...
In the early 1960s he discovered the cancer drug bleomycin. The Hamao Umezawa Memorial Museum in Setagaya, Tokyo was named in ...
Lefterov IM, Koldamova RP, Lazo JS (Sep 2000). "Human bleomycin hydrolase regulates the secretion of amyloid precursor protein ...
Stubbs JM, Johnson EG, Thom SR (2005). "Trends Of Treating Patients, That Have Received Bleomycin Therapy In The Past, With ... Takenaka S, Arimura T, Higashi M, Nagayama T, Ito E (August 1980). "Experimental study of bleomycin therapy in combination with ...
Kross, J; Henner WD; Hecht SM; Haseltine WA (1982). "Specificity of Deoxyribonucleic Acid Cleavage by Bleomycin, Phleomycin and ... D'Andrea, AD; Haseltine WA (1978). "Sequence Cleavage of DNA by the Anti-tumor Antibiotics Neocarzinostatin and Bleomycin". ...
Liu S, Shi-wen X, Abraham DJ, Leask A (January 2011). "CCN2 is required for bleomycin-induced skin fibrosis in mice". Arthritis ... and deletion of Ctgf in fibroblasts and smooth muscle cells greatly reduces bleomycin-induced skin fibrosis. In addition to ...
... although bleomycin hydrolase is cytosolic in fungi and mammals. Papain-like cysteine proteinases are essentially synthesised as ... and amino acid composition of rabbit pulmonary bleomycin hydrolase". Biochemistry. 26 (14): 4213-9. doi:10.1021/bi00388a006. ...
Exposure to certain chemicals such as salicylic acid, bleomycin, and cisplatin. Smoker's melanosis Coeliac disease Cronkhite- ...
Bleomycin A5) "Bleomycin Use During Pregnancy". Drugs.com. 9 August 2019. Retrieved 16 February 2020. "Bleomycin- bleomycin ... Bleomycin has also been found to disrupt the sense of taste. Bleomycin, a non-heme iron protein, acts by induction of DNA ... Some studies suggest bleomycin also inhibits incorporation of thymidine into DNA strands. DNA cleavage by bleomycin depends on ... Biosynthesis of bleomycin is completed by glycosylation of the aglycones. Bleomycin naturally occurring-analogues have two to ...
Bleomycin hydrolase is an enzyme that in humans is encoded by the BLMH gene. Bleomycin hydrolase (BMH) is a cytoplasmic ... Koldamova, R P; Lefterov I M; DiSabella M T; Almonte C; Watkins S C; Lazo J S (June 1999). "Human bleomycin hydrolase binds ... 1998). "Bleomycin hydrolase is associated with risk of sporadic Alzheimers disease". Nat. Genet. 18 (3): 211-2. doi:10.1038/ ... Zheng W, Johnston SA, Joshua-Tor L (1998). "The unusual active site of Gal6/bleomycin hydrolase can act as a carboxypeptidase, ...
Bleomycin: learn about side effects, dosage, special precautions, and more on MedlinePlus ... Before taking bleomycin,. *tell your doctor and pharmacist if you are allergic to bleomycin or any of the ingredients in ... You should not become pregnant while you are receiving bleomycin injection. If you become pregnant while receiving bleomycin, ... Bleomycin is a type of antibiotic that is only used in cancer chemotherapy. It slows or stops the growth of cancer cells in ...
Its production by iodination of bleomycin with radioactive iodide ions in the presence of an oxidizing agent is described. ... Radioiodinated bleomycin is a useful imaging agent for body tissues. ... 125 I-bleomycin is stable for at least one month. 123 I-bleomycin has excellent imaging properties and a short half-life (13.3 ... Measurement of Bleomycin Biological Activity. Bacillus subtilis was used as a test organism for measurements of bleomycin ...
Relation to bleomycin. Chest 1985; 88:103.. *Sikdar T, MacVicar D, Husband JE. Pneumomediastinum complicating bleomycin related ... Plasma and pulmonary pharmacokinetics of bleomycin in murine strains that are sensitive and resistant to bleomycin-induced ... Acute pulmonary toxicity of bleomycin: DNA scission and matrix protein mRNA levels in bleomycin-sensitive and -resistant ... Bleomycin is inactivated in vivo by the enzyme bleomycin hydrolase, a cytosolic aminopeptidase that has lower activity in the ...
BLEOMYCIN (blee oh MYE sin) is a chemotherapy drug. It is used to treat many kinds of cancer like lymphoma, cervical cancer, ... Bleomycin injection. What is this medicine?. BLEOMYCIN (blee oh MYE sin) is a chemotherapy drug. It is used to treat many kinds ... an unusual or allergic reaction to bleomycin, other chemotherapy agents, other medicines, foods, dyes, or preservatives ...
Generic name Bleomycin Pronunciation blee-oh-MY-sin Brand name(s), other common name(s) Blenoxane® Drug type Antitumor ... Bleomycin is FDA approved as a single agent or in proven combinations to treat people who have Hodgkin and non-Hodgkin lymphoma ... Bleomycin may cause a temporary loss of hair in some people. Normal hair growth should return after treatment ends (although it ... Patients Disease Information Treatment Types of Treatment Chemotherapy and Other Drug Therapies Drug Listings Bleomycin ...
Peptidase C1B, bleomycin hydrolase (IPR004134). Short name: Peptidase_C1B Overlapping homologous superfamilies *Papain-like ... The unusual active site of Gal6/bleomycin hydrolase can act as a carboxypeptidase, aminopeptidase, and peptide ligase.. Cell 93 ... The unusual active site of Gal6/bleomycin hydrolase can act as a carboxypeptidase, aminopeptidase, and peptide ligase.. Cell 93 ... Studies on the mechanism of antitumor effect of bleomycin of squamous cell carcinoma.. J. Antibiot. 25 409-20 1972 ...
bleomycin synonyms, bleomycin pronunciation, bleomycin translation, English dictionary definition of bleomycin. n. Any of a ... For the bleomycin mouse model, 2 U/kg bleomycin (Nippon Kayaku Co Ltd., Tokyo, Japan) in 20-25 [micro]l phosphate-buffered ... bleomycin. Also found in: Medical, Acronyms, Wikipedia.. Related to bleomycin: cisplatin, doxorubicin ... Bleomycin (BLM) was obtained from Onko Medical Company (Bleocin-S 15 mg, Istanbul, Turkey).. Resveratrol Attenuates Bleomycin- ...
... Article Translations: (Spanish). How does this medicine work?. Bleomycin (blee oh mye sin) destroys ... Bleomycin is given into a vein (IV) or as an injection under the skin (Sub-Q). It is given in the hospital or clinic. ... Blood samples may be needed to check the effects of the bleomycin. Blood counts are lowest at 1 to 2 weeks after the medicine ...
Professional guide for Bleomycin Sulfate. Includes: pharmacology, pharmacokinetics, contraindications, interactions, adverse ... Monitor renal function and adjust the bleomycin dose as needed.. Digoxin, hydantoins (eg, phenytoin) Bleomycin may decrease ... Elimination of bleomycin may be decreased secondary to cisplatin-induced renal dysfunction, increasing the risk of bleomycin ... Do not reconstitute or dilute bleomycin with dextrose 5% in water or any other dextrose-containing diluent. Loss of bleomycin ...
BLEOMYCIN (bleomycin sulfate) injection, powder, lyophilized, for solution. NDC Code(s): 63323-136-10, 63323-137-20 *Packager: ... BLEOMYCIN (bleomycin sulfate) powder, for solution. NDC Code(s): 71288-106-10, 71288-107-20 *Packager: Meitheal Pharmaceuticals ... BLEOMYCIN injection, powder, lyophilized, for solution. NDC Code(s): 61703-323-22, 61703-332-18 *Packager: Hospira, Inc. ... BLEOMYCIN injection, powder, lyophilized, for solution. NDC Code(s): 0409-0323-20, 0409-0332-20 *Packager: Hospira, Inc. ...
... used usually in sulfate form in combination with other drugs to treat certain kinds of cancer.Origin of bleomycin Alteration of ... bleomycin definition: nounAny of a class of antibiotics isolated from the bacterium Streptomyces verticillus, ... bleomycin. ble·o·my·cin. noun. Any of a class of antibiotics isolated from the bacterium Streptomyces verticillus, used usually ... How would you define bleomycin? Add your definition here.. Please enable JavaScript to view the comments powered by Disqus.. ...
Risk of pulmonary toxicity of bleomycin and filgrastim.. Laprise-Lachance M1, Lemieux P2, Grégoire JP3,4. ... We conducted a nested case-control study of patients treated with BEP (bleomycin, etoposide and cisplatin) for germ cell cancer ... To estimate the relative risk of pulmonary toxicity in patients exposed to a bleomycin-based chemotherapy including filgrastim ... add further evidence that the concomitant use of filgrastim might not increase the risk of pulmonary toxicity of bleomycin. It ...
Find patient medical information for Bleomycin Injection on WebMD including its uses, side effects and safety, interactions, ... bleomycin 15 unit solution for injection. color. colorless. shape. No data.. imprint. No data.. This medicine is a colorless, ... bleomycin 30 unit solution for injection. color. colorless. shape. No data.. imprint. No data.. This medicine is a colorless, ... bleomycin 15 unit solution for injection. color. colorless. shape. No data.. imprint. No data.. This medicine is a colorless, ...
Compare bleomycin prices, print discount coupons, find manufacturer promotions and details on available patient assistance ... Bleomycin Prices. This bleomycin price guide is based on using the Drugs.com discount card which is accepted at most U.S. ... Bleomycin Coupons and Rebates. Bleomycin offers may be in the form of a printable coupon, rebate, savings card, trial offer, or ... Bleomycin Prices, Coupons and Patient Assistance Programs. Bleomycin is a member of the antibiotics/antineoplastics drug class ...
Bleomycin seems to act by interfering with the growth of cancer cells, which are eventually destroyed. Since the growth of ... Bleomycin belongs to the general group of medicines called antineoplastics. It is used to treat several types of cancer, ... Before you begin treatment with bleomycin, you and your doctor should talk about the good this medicine will do as well as the ... Bleomycin is to be administered only by or under the immediate supervision of your doctor. ...
Bleomycin A2 is used as the representative structure for Bleomycin. ... A complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2 (B2 CAS # 9060-10 ... DNA cleavage by bleomycin depends on oxygen and metal ions, at least in vitro. It is believed that bleomycin chelates metal ... Bleomycin. ATC Codes. L01DC01 - Bleomycin*L01DC - Other cytotoxic antibiotics. *L01D - CYTOTOXIC ANTIBIOTICS AND RELATED ...
Bleomycin for Injection, USP is available as follows:. NDC 0143-9240-01, 15 units of bleomycin per vial as bleomycin sulfate ... Bleomycin has been shown to be mutagenic both in vitro and in vivo. The effects of bleomycin on fertility have not been studied ... Because of bleomycins sensitization of lung tissue, patients who have received bleomycin are at greater risk of developing ... Bleomycin is inactivated by a cytosolic cysteine proteinase enzyme, bleomycin hydrolase. The enzyme is widely distributed in ...
Bleomycin; Drug: Normal saline Sponsors: Erasmus Medical Center; Centre for Human Drug Research, Netherlands Not yet recruiting ... Condition: Keloid Interventions: Drug: Bleomycin; Drug: Normal saline Sponsors: Erasmus Medical Center; Centre for Human Drug ...
In this study, we have demonstrated that alveolar macrophages stimulated by bleomycin-induced injury secrete large quantities ... The findings in this study demonstrate that during bleomycin-induced injury, alveolar macrophages not only secrete large ... In a model of pulmonary inflammation and fibrosis induced by the antineoplastic antibiotic, bleomycin, we previously ... Regulation of alveolar macrophage transforming growth factor-beta secretion by corticosteroids in bleomycin-induced pulmonary ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Bleomycin sulfate forms complexes with iron that reduce molecular oxygen to superoxide and hydroxyl radicals which cause single ... bleomycin sulfas. bleomycin sulphate. bleomycini sulfas. blexane. Foreign brand name:. Blanoxan. Bleo-cell. Bleocin. Bleolem. ... bleomycin sulfate A mixture of the sulfate salts of basic glycopeptide antineoplastic antibiotics isolated from Streptomyces ... Bleomycin sulfate forms complexes with iron that reduce molecular oxygen to superoxide and hydroxyl radicals which cause single ...
Bleomycin-treated rats receiving flaxseed oil had reduced pulmonary septal thickness (,svg style=vertical-align:-0.17555pt; ... Previous work has shown a reduction in bleomycin-induced lung pathology by long-chain omega-3 fatty acids. Treatment by short- ... Lungs were harvested at 2, 7, and 21 days after bleomycin or saline treatment. Animals receiving flaxseed oil showed a delay in ... bleomycin produced a reduction in pulmonary arterial lumen patency (,svg style=vertical-align:-0.17555pt;width:56.150002px; ...
Bleomycin hydrolaseImported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p>,a ... tr,E9Q6V3,E9Q6V3_MOUSE Bleomycin hydrolase OS=Mus musculus OX=10090 GN=Blmh PE=1 SV=1 ...
For patients who lack risk factors for bleomycin lung toxicity, consider using no more than 2 cycles of bleomycin-containing ... In this issue of Blood, Böll et al report on the toxicity of 2 vs 4 cycles of bleomycin-containing chemotherapy in older, early ... Bleomycin in older early-stage favorable Hodgkin lymphoma patients: analysis of the German Hodgkin Study Group (GHSG) HD10 and ... Furthermore, bleomycin lung toxicity was observed in 43% of older patients treated with ABVD, which is significantly higher ...
Human lung tumors: SPECT quantitation of differences in Co-57 bleomycin uptake.. Front D, Israel O, Iosilevsky G, Even-Sapir E ... The in vivo concentration of intravenously injected bleomycin labeled with cobalt-57 was measured over time in 14 human lung ... Significant differences were found in the uptake of bleomycin by the tumors, even those with the same histologic ...
Bleomycin (BLM) is a mixture of mainly two compounds (A2 and B2), which is on the World Health Organizations list of essential ... Pingyangmycin is an anticancer drug known as bleomycin A5 (A5), discovered in the Pingyang County of Zhejiang Province of China ... bleomycin B2; bleomycin A5 or pingyangmycin; cytotoxicity; cell cycle; apoptosis bleomycin A2; bleomycin B2; bleomycin A5 or ... Bleomycin (BLM) is a mixture of mainly two compounds (A2 and B2), which is on the World Health Organizations list of essential ...
... Liang Guo,1,2 Jun-mei Xu,2 ... "Hypoxia-Induced Epithelial-Mesenchymal Transition Is Involved in Bleomycin-Induced Lung Fibrosis," BioMed Research ...
  • The BLM group mice were intratracheally injected with bleomycin sulfate (5 mg/kg mouse in 50 [micro]l saline) for 7 days to induce mice with pulmonary fibrosis. (thefreedictionary.com)
  • Who should not take Bleomycin SULFATE Vial? (webmd.com)
  • What conditions does Bleomycin SULFATE Vial treat? (webmd.com)
  • Each 15 unit and 30 unit vial contains sterile bleomycin sulfate equivalent to 15 or 30 units of bleomycin, respectively. (nih.gov)
  • Bleomycin Sulfate is a glycopeptide antibiotic and an anticancer agent for squamous cell carcinomas (SCC) with IC50 of 4 nM in UT-SCC-19A cells. (selleckchem.com)
  • Mices received in group 1 (Bleomycin) Bleomycin sulfate, in group 2 (Bleomycin+Thalidomide) Bleomycin beside Thalidomide, in group 3(Thalidomide) Thalidomide and in group 4 (Carboxy Methyl Cellulose) Carboxy Methyl Cellulose via intraperitoneum. (magiran.com)
  • Bleomycin sulfate is a mixture of the sulfate salts of basic glycopeptide antineoplastic antibiotics isolated from Streptomyces verticillus. (adooq.com)
  • Another of its activities is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. (wikipedia.org)
  • Bleomycin is a type of antibiotic that is only used in cancer chemotherapy. (medlineplus.gov)
  • BLEOMYCIN (blee oh MYE sin) is a chemotherapy drug. (nationwidechildrens.org)
  • After receiving three cycles of chemotherapy in the form of bleomycin , etoposide and cisplatin, she presented with recurrent pelvic mass on right side. (thefreedictionary.com)
  • To estimate the relative risk of pulmonary toxicity in patients exposed to a bleomycin-based chemotherapy including filgrastim compared to a similar chemotherapy without filgrastim. (nih.gov)
  • In this issue of Blood , Böll et al report on the toxicity of 2 vs 4 cycles of bleomycin-containing chemotherapy in older, early stage, favorable patients with Hodgkin lymphoma (HL) and show that 2 cycles, but no more, of doxorubicin, bleomycin, vinblastine, and dacarbazine (ABVD) is well tolerated in this patient population. (bloodjournal.org)
  • For patients who lack risk factors for bleomycin lung toxicity, consider using no more than 2 cycles of bleomycin-containing chemotherapy. (bloodjournal.org)
  • therefore, defining the optimal number of bleomycin-containing chemotherapy cycles for older patients may help improve outcomes. (bloodjournal.org)
  • This allowed for direct comparison of toxicity of 0, 2, and 4 cycles of bleomycin-containing chemotherapy for older patients. (bloodjournal.org)
  • A 42 year old man, treated for testicular carcinoma with combination chemotherapy that included bleomycin, developed life threatening interstitial pneumonitis. (bmj.com)
  • Bleomycin is an antibiotic derived from the fungus Streptomyces verticillus but is mainly used as a chemotherapy drug. (dermnetnz.org)
  • A Randomized Phase III Clinical Trial of Daunoxome Versus Combination Chemotherapy With Adriamycin/Bleomycin/Vincristine (ABV) in the Treatment of HIV-Associated Kaposi's Sarcoma. (clinicaltrials.gov)
  • To compare the toxicity profiles (severity and time to onset from initiation of therapy) between daunorubicin (liposomal) and combination chemotherapy with doxorubicin/bleomycin/vincristine (ABV), with both regimens administered in combination with antiretroviral therapy. (clinicaltrials.gov)
  • Background Bleomycin forms part of the chemotherapy regimen ("BEP") for germ cell testicular cancer (1). (bmj.com)
  • This 10-year follow-up study of 91 patients with disseminated testicular nonseminomatous cancer, treated with cisplatin, vinblastine, and bleomycin (PVB) induction chemotherapy and vinblastine plus bleomycin maintenance chemotherapy for a planned period of 2 years, shows a 63% cure rate. (uni-bonn.de)
  • The most serious complication of bleomycin, occurring upon increasing dosage, is pulmonary fibrosis and impaired lung function. (wikipedia.org)
  • Due to the oxygen sensitive nature of bleomycin, and the theorised increased likelihood of developing pulmonary fibrosis following supplemental oxygen therapy, it has been questioned whether patients should take part in scuba diving following treatment with the drug. (wikipedia.org)
  • The major limitation of bleomycin therapy is the potential for life-threatening interstitial pulmonary fibrosis (also called fibrosing alveolitis) in up to 10 percent of patients receiving the drug [ 2-5 ]. (uptodate.com)
  • Pulmonary fibrosis is the most severe toxicity associated with bleomycin. (nih.gov)
  • In a model of pulmonary inflammation and fibrosis induced by the antineoplastic antibiotic, bleomycin, we previously demonstrated that TGF-beta was markedly elevated within 7 d of bleomycin administration. (uptodate.com)
  • Bleomycin, a widely used antineoplastic agent, has been associated with severe pulmonary toxicity, primarily fibrosis. (hindawi.com)
  • In recent literature, the presence of several ROS has been found in clinical cases of idiopathic pulmonary fibrosis [ 10 , 11 ], and decreased production of ROS has been shown to protect mice against bleomycin-induced pulmonary fibrosis [ 12 ]. (hindawi.com)
  • Another research group has shown that fish oil prevents bleomycin-induced lung inflammation and pulmonary fibrosis [ 18 ]. (hindawi.com)
  • We addressed whether PAR-2 deficiency persistently reduces bleomycin-induced pulmonary fibrosis or merely delays disease progression and whether pharmacological PAR-2 inhibition limits experimental pulmonary fibrosis. (springer.com)
  • Once daily treatment with P2pal-18S reduced the severity and extent of fibrotic lesions in lungs of bleomycin-treated wild-type mice but did not further reduce fibrosis in PAR-2-deficient mice. (springer.com)
  • Importantly, P2pal-18S treatment starting even 7 d after the onset of fibrosis limits pulmonary fibrosis as effectively as when treatment was started together with bleomycin instillation. (springer.com)
  • Moreover, PAR-2 expression significantly correlates with the extent of honeycombing ( 18 ), and PAR-2 activation has been shown to be highly relevant to the progression of pulmonary fibrosis in experimental animal models of bleomycin-induced injury. (springer.com)
  • Exposure of lung fibroblasts to bleomycin, a known inducer of fibrosis, resulted in rapid activation of PI3K/Akt and a parallel increase in fibroblast proliferation and collagen production, characteristics of lung fibrosis. (cdc.gov)
  • The current study aimed to investigate the underlying mechanisms of ER stress inhibitors in the treatment of bleomycin-induced lung fibrosis. (nature.com)
  • PI3K/AKT acts upstream of ER stress to affect lung fibroblast proliferation, resulting in bleomycin-induced pulmonary fibrosis. (nature.com)
  • Bleomycin was once used as an antineoplastic agent, but is now thought to cause dose-dependent interstitial pulmonary fibrosis 4 . (nature.com)
  • Here we investigated the effect of IL-22 on alveolar epithelial cells in the bleomycin- (BLM-) induced pulmonary fibrosis. (harvard.edu)
  • Bleomycin (BLM) induces lung inflammation and subsequent fibrosis in humans and animal models. (ersjournals.com)
  • We therefore examined whether inhaled NAC inhibits lung fibrosis induced by bleomycin (BLM). (nih.gov)
  • This study aimed to determine the beneficial effects and mechanisms of fasudil, a selective ROCK inhibitor, on bleomycin-induced pulmonary fibrosis in mice. (mdpi.com)
  • In addition, fasudil reduced the production of transforming growth factor-β1 (TGF-β1), connective tissue growth factor (CTGF), alpha-smooth muscle actin (α-SMA), and plasminogen activator inhibitor-1 (PAI-1) mRNA and protein expression in bleomycin-induced pulmonary fibrosis. (mdpi.com)
  • We examined changes in lung tissue cell populations and in the phenotype of activated fibroblasts after acute injury in a model of bleomycin-induced pulmonary fibrosis. (nih.gov)
  • The aim of this study is to investigate the effect of influenza infection on bleomycin-induced pulmonary fibrosis and TGFβ activation in vivo. (bmj.com)
  • Bleomycin has also been used to induce lung injury in rodents for basic research into pulmonary fibrosis for over a decade. (mdbiosciences.com)
  • To determine whether MMP-8 regulates lung inflammatory or fibrotic responses to bleomycin, we delivered bleomycin by the intratracheal route to wild-type (WT) versus Mmp-8 −/− mice and quantified MMP-8 expression, and inflammation and fibrosis in the lung samples. (jimmunol.org)
  • Compared with bleomycin-treated WT mice, bleomycin-treated Mmp-8 −/− mice have greater lung inflammation, but reduced lung fibrosis. (jimmunol.org)
  • Studies of bleomycin-treated Mmp-8 bone marrow chimeric mice show that both leukocytes and lung parenchymal cells are sources of profibrotic MMP-8 during bleomycin-mediated lung fibrosis. (jimmunol.org)
  • Thus, during bleomycin-mediated lung injury, MMP-8 dampens the lung acute inflammatory response, but promotes lung fibrosis by reducing lung levels of IP-10 and MIP-1α. (jimmunol.org)
  • Methods: Lung fibrosis was induced in mice by a single intratracheal administration of bleomycin. (ersjournals.com)
  • The main advantage of this technique is that direct injection of Bleomycin into the mouse trachea ensures rapid targeting of the lungs without any spills in the upper airway allowing safe, robust and reproducible induction of lung inflammatory and fibrosis. (jove.com)
  • We have studied the variation in the expression of p21, p53, p27 and PCNA in bleomycin-induced lung fibrosis using animal mouse models using immuno-histochemistry and gene-expression analysis. (edu.mt)
  • No difference in the p53, PCNA and p27 expressions were observed from the bleomycin-induced fibrosis when compared to saline-induced non-fibrotic lungs. (edu.mt)
  • Age-matched groups of control and bleomycin-treated rats were killed, and their lung collagen was analyzed at zero (control animals only), 1, 2, 4, 6, and 10 wk after bleomycin administration, a time course appropriate for development of pulmonary fibrosis in this animal model. (osti.gov)
  • Altered expression of small proteoglycans, collagen, and transforming growth factor-beta 1 in developing bleomycin-induced pulmonary fibrosis in rats. (jci.org)
  • The development of bleomycin-induced pulmonary fibrosis in rats was studied over a period of 21 d after an intratracheal instillation of bleomycin. (jci.org)
  • The effects of the nude (nu/nu) mutation on bleomycin-induced pulmonary fibrosis. (biomedsearch.com)
  • In the present study, we have evaluated the impact of the athymic (nude) mutation on the development of pulmonary fibrosis in mice induced by a single intratracheal instillation of bleomycin (0.75 units/animal). (biomedsearch.com)
  • The data indicate that the nude athymic mutation protects, at least partially, against bleomycin-induced pulmonary fibrosis, thus suggesting a role for the cellular immune system in regulating the fibrogenic response to this drug. (biomedsearch.com)
  • Iyer SN, Gurujeyalakshmi G and Giri SN: Effects of pirfenidone on transforming growth factor-beta gene expression at the transcriptional level in bleomycin hamster model of lung fibrosis. (spandidos-publications.com)
  • Iyer SN, Gurujeyalakshmi G and Giri SN: Effects of pirfenidone on procollagen gene expression at the transcriptional level in bleomycin hamster model of lung fibrosis. (spandidos-publications.com)
  • Oku H, Shimizu T, Kawabata T, Nagira M, Hikita I, Ueyama A, Matsushima S, Torii M and Arimura A: Antifibrotic action of pirfenidone and prednisolone: Different effects on pulmonary cytokines and growth factors in bleomycin-induced murine pulmonary fibrosis. (spandidos-publications.com)
  • The aim of this study was to examine the capacity of a synthetic cannabinoid receptor agonist to modify skin fibrosis in the bleomycin mouse model of scleroderma. (bmj.com)
  • Methods Skin fibrosis was induced by local injections of bleomycin in two groups of DBA/2J mice. (bmj.com)
  • Results Bleomycin treatment induced typical skin fibrosis. (bmj.com)
  • In this study, we examined the effect of expression of HSP70 on bleomycin-induced pulmonary fibrosis in mice, a tentative animal model of IPF. (ovid.com)
  • Bleomycin-induced pulmonary injury and inflammatory response were ameliorated in transgenic mice overexpressing HSP70 compared to wild-type mice, even though bleomycin-induced pulmonary fibrosis and dysfunction were also suppressed in the transgenic mice. (ovid.com)
  • Orally administered geranylgeranylacetone (GGA), a clinically used drug with HSP-inducing activity, conferred protection against bleomycin-induced pulmonary injury, as well as against the inflammatory response, fibrosis and dysfunction. (ovid.com)
  • These results suggest that HSP70 plays a protective role against bleomycin-induced pulmonary injury, inflammation, fibrosis and dysfunction through cytoprotective effects and by inhibiting the production of TGF-β1, TGF-β1-dependent EMT of epithelial cells and expression of pro-inflammatory cytokines. (ovid.com)
  • The present study investigated the effects of iPS cells on inflammatory responses, transforming growth factor (TGF)-β1 signaling pathway, and epithelial to mesenchymal transition (EMT) during bleomycin (BLM)-induced lung fibrosis. (frontiersin.org)
  • RP is also a feature of systemic sclerosis (SSc), a connective tissue disease that is studied in a mouse model using bleomycin as the agent to induce pulmonary fibrosis (3,4). (bmj.com)
  • The aim of this research is the examination of Thalidomide effect on the MMP-2 protein expression and Mast cells in the lung fibrosis induced by Bleomycin in mice. (magiran.com)
  • The major complication seen in cancer patients treated with systemic bleomycin is the development of pulmonary fibrosis, which is considered to be dose-dependent. (scielo.org.za)
  • The antineoplastic effect of bleomycin is unique among anticancer agents, and is thought to involve the production of single- and double-strand breaks in DNA (scission) by a complex of bleomycin, ferrous ions, and molecular oxygen [ 2,6,7 ]. (uptodate.com)
  • CIPLA BLEOMYCIN 15K belongs to a group of medicines known as antineoplastic or cytotoxic agents. (nps.org.au)
  • The anti-tumor antibiotic bleomycin is such a drug and it has been shown to concentrate in skin, lung, and certain tumors. (google.com)
  • It has thus been possible to chelate radioactive isotopes of such metals to bleomycin and thereby produce radioactive agents which can be used to detect and visualize tumors. (google.com)
  • Although 111 In alone will localize tumors to some extent, the results indicate that tumor localization occurs more frequently with 111 In-labeled bleomycin. (google.com)
  • Human lung tumors: SPECT quantitation of differences in Co-57 bleomycin uptake. (nih.gov)
  • The in vivo concentration of intravenously injected bleomycin labeled with cobalt-57 was measured over time in 14 human lung tumors. (nih.gov)
  • Significant differences were found in the uptake of bleomycin by the tumors, even those with the same histologic characteristics, when the concentration over time, the tumor/blood ratio at 30 minutes, and the tumor cumulative concentration were measured in vivo. (nih.gov)
  • The metabolism of bleomycin B 2 in homogenates from benign and malignant human tumors was studied, and all 14 tumors were capable of metabolizing bleomycin to desamidobleomycin B 2 . (aacrjournals.org)
  • Bleomycin was instilled intranasally into wild-type or PAR-2-deficient mice in the presence/absence of a specific PAR-2 antagonist (P2pal-18S). (springer.com)
  • Materials and Methods 60 U of bleomycin was instilled into the lungs of 6-8 week old male C57Bl/6 mice. (bmj.com)
  • Results Mice exposed to bleomycin and infected with influenza lost less weight compared with saline-exposed influenza-infected animals. (bmj.com)
  • However, the lungs from bleomycin-exposed, influenza-infected mice showed increased lung damage with more matrix deposition on trichrome staining than saline-exposed, influenza-infected mice. (bmj.com)
  • However, in bleomycin-exposed mice, influenza infection did not promote enhanced BAL lymphocytosis or apoptosis. (bmj.com)
  • However, influenza appeared to enhance the fibrotic response demonstrated by an increase in matrix deposition on masson's trichrome and increased lung hydroxyproline levels in influenza infected bleomycin exposed mice, as early as 5 days post infection. (bmj.com)
  • At MD Biosciences, we have refined the oral aspiration administration to allow for more even distribution of disease throughout both right and left lungs, making bleomycin-induced injury in mice a reliable model for research. (mdbiosciences.com)
  • Mmp-8 steady state mRNA and protein levels increase in whole lung and bronchoalveolar lavage samples when WT mice are treated with bleomycin. (jimmunol.org)
  • Whereas bleomycin-treated Mmp-8 −/− and WT mice have similar lung levels of several pro- and antifibrotic mediators (TGF-β, IL-13, JE, and IFN-γ), Mmp-8 −/− mice have higher lung levels of IFN-γ-inducible protein-10 (IP-10) and MIP-1α. (jimmunol.org)
  • Genetically deleting either Ip-10 or Mip-1 α in Mmp-8 −/− mice abrogates their lung inflammatory response to bleomycin, but reconstitutes their lung fibrotic response to bleomycin. (jimmunol.org)
  • Here we present an effective method to investigate the antifibrotic activity of intravenously infused human mesenchymal stromal cells obtained from the whole umbilical cord following the induction of lung injury by an endotracheal injection of bleomycin in C57BL/6 mice. (jove.com)
  • Net collagen synthesis, as assessed by measuring the rate of incorporation of tritiated proline in an organ culture system, was increased above control values in both nude and euthymic mice at 14 days after bleomycin treatment, although these values returned to normal at 30 days. (biomedsearch.com)
  • However, lung collagen synthetic rates, normalized to dry lung weights, were significantly higher at 14 days in euthymic bleomycin-treated control mice than in the nude bleomycin-treated animals. (biomedsearch.com)
  • The production of TGF-β1 and expression of pro-inflammatory cytokines was lower in cells from the transgenic mice than wild-type mice after the administration of bleomycin. (ovid.com)
  • The present study aimed to evaluate the therapeutic effect of human umbilical cord derived‑MSCs (UC‑MSCs) on bleomycin‑induced SSc in mice and explore the potential underlying mechanism. (spandidos-publications.com)
  • UC‑MSC treatment exerted an anti‑fibrotic role in bleomycin‑induced SSc mice, as confirmed by histological improvement, decreased collagen synthesis, and reduced collagen‑1α1, collagen‑1α2, fibronectin‑1 and α‑smooth muscle actin gene expression levels. (spandidos-publications.com)
  • We conducted a nested case-control study of patients treated with BEP (bleomycin, etoposide and cisplatin) for germ cell cancer or with ABVD (doxorubicin, bleomycin, vinblastine and dacarbazine) for Hodgkin's lymphoma at the Hôtel-Dieu de Lévis Hospital between 31 October 2000 and 30 June 2016. (nih.gov)
  • Autonomic neuropathy after treatment with cisplatin, vinblastine, and bleomycin for germ cell cancer. (bmj.com)
  • Bleomycin is most commonly implicated, but peplomycin (a bleomycin derivative) docetaxel and cisplatin have also been reported as causes. (renalandurologynews.com)
  • Effect of Zinc on Spermatogenesis and Sperm Chromatin Condensation in Bleomycin, Etoposide, Cisplatin Treated Rats. (americanelements.com)
  • Co-administration of bleomycin, etoposide and cisplatin (BEP) has increased survival rate of patients with testicular cancer. (americanelements.com)
  • Therefore, bleomycin is used in combination with doxorubicin in Hodgkins lymphoma, as they have additive and complementary effects on the DNA, since doxorubicin acts by intercalating between DNA strands, and also acts on topoisomerase II enzyme thus relaxing the topoisomerase complexes. (wikipedia.org)
  • To determine the efficacy of Stealth liposomal doxorubicin hydrochloride (DOX-SL) in the treatment of moderate to severe AIDS-related Kaposi's sarcoma (KS) by comparison with the established therapy BV (bleomycin/vincristine). (clinicaltrials.gov)
  • Background: The role of bleomycin and dacarbazine in the ABVD regimen (ie, doxorubicin, bleomycin, vinblastine, and dacarbazine) has been questioned, especially for treatment of early-stage favourable Hodgkin's lymphoma, because of the drugs' toxicity. (mdc-berlin.de)
  • How important is bleomycin in the adriamycin + bleomycin + vinblastine + dacarbazine regimen? (semanticscholar.org)
  • article{Canellos2004HowII, title={How important is bleomycin in the adriamycin + bleomycin + vinblastine + dacarbazine regimen? (semanticscholar.org)
  • Bleomycin is inactivated in vivo by the enzyme bleomycin hydrolase, a cytosolic aminopeptidase that has lower activity in the skin and lungs. (uptodate.com)
  • For this condition, bleomycin is placed in the space around the lungs through a chest tube. (webmd.com)
  • High doses of the corticosteroid methylprednisolone given intramuscularly before and concomitantly with bleomycin administration prevented the influx of alveolar macrophages into the lungs, diminishing both the number of macrophages present in the alveoli and the total lung content of TGF-beta. (uptodate.com)
  • Lungs were harvested at 2, 7, and 21 days after bleomycin or saline treatment. (hindawi.com)
  • Intratracheal administration of bleomycin to the lungs of rodents has been shown to cause alveolar cell damage, an inflammatory response, epithelial-mesenchymal transition (EMT), fibroblast proliferation and subsequent extracellular matrix deposition, all of which resemble human fibrotic lung disease 5 . (nature.com)
  • Bleomycin can be injected into a vein, into a muscle, under the skin, or into the pleura (lining around the lungs). (medbroadcast.com)
  • The mechanism of bleomycin-induced lung injury includes oxidative damage via oxidant-mediated DNA breaks, causing inflammatory reactions in the lungs. (mdbiosciences.com)
  • This protocol can be successfully applied both to induce important inflammatory and fibrotic response in both lungs by endotracheal injection of Bleomycin and to validate new anti-inflammatory and anti-fibrotic systemic therapies by tail vein infusion. (jove.com)
  • Although no difference in nuclear p21 expression was observed, the level of cytoplasmic p21 expression was found to be higher in fibrotic lungs at day 14 after bleomycin injection. (edu.mt)
  • p21 expression was found to increase independent of p53 in fibrotic lungs at 14 days after bleomycin induction. (edu.mt)
  • No evidence of breakdown of this pool of mature, preformed collagen was observed in lungs of either the control or the bleomycin-treated rats. (osti.gov)
  • We conclude that there is no biochemically detectable turnover of mature lung collagen, defined as that pool of lung collagen that is obligatorily extracellular (i.e., crosslinked and containing labeled hydroxylysine from an injection of precursor 5 to 15 wk earlier), in either normal rat lungs or lungs of rats made fibrotic with bleomycin. (osti.gov)
  • Before starting i was a fairly frequent cannabis smoker and i can't remember if it is prohibited to smoke (he was refering to tobacco) during the treatment or during AND after the treatment, as i see online that bleomycin damage the lungs. (tc-cancer.com)
  • Bleomycin is a mixture of glycopeptide antibiotics discovered by Umezawa et al, in 1962, and isolated from the cultured broth of Streptomyces verticillus. (google.com)
  • Bleomycin is an antitumor antibiotic that was isolated from a strain of Streptomyces verticillus in 1966 [ 1 ]. (uptodate.com)
  • A complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2 (B2 CAS # 9060-10-0). (drugbank.ca)
  • Bleomycin, an antibiotic derived from Streptomyces verticillus , has recently become available for clinical trial in this country. (annals.org)
  • Bleomycin is a broad-spectrum glycopeptide antitumor antibiotic produced by Streptomyces verticillus . (springer.com)
  • Bleomycin is a member of glycopeptide antibiotics that was first isolated from the fermentation broth of S. verticillus by Umezawa et al. (springer.com)
  • Pycnidione irreversibly abrogated bleomycin-induced G2 arrest in Jurkat cells and synergically potentiated the cytotoxicity of bleomycin. (sigmaaldrich.com)
  • Thus, we concluded that pycnidione abrogated bleomycin-induced G2 arrest by decreasing Chk1 and Chk2. (sigmaaldrich.com)
  • The most common use of intralesional bleomycin injections is for viral warts that have failed to respond to conventional therapies such as liquid nitrogen cryotherapy and wart paints/gels (e.g., high-strength salicylic acid ). (dermnetnz.org)
  • Flagellate erythema has also been reported after intralesional bleomycin injections for plantar warts, or after intrapleural or intraperitoneal instillation. (renalandurologynews.com)
  • It has been suggested that bleomycin induces sensitivity to oxygen toxicity and recent studies support the role of the proinflammatory cytokines IL-18 and IL-1beta in the mechanism of bleomycin-induced lung injury. (wikipedia.org)
  • Depletion of iron with chelators also reduces the toxicity of bleomycin both in vitro and in vivo, probably secondary to decreased production of free radicals [ 4,9,10 ]. (uptodate.com)
  • 50 years old or those with pulmonary compromise at diagnosis, groups with increased susceptibility to bleomycin lung toxicity in whom bleomycin is often avoided. (thefreedictionary.com)
  • Pulmonary toxicity of bleomycin appears to be dose-related, with a striking increase when the total dose is more than 400 units. (drugs.com)
  • Risk of pulmonary toxicity of bleomycin and filgrastim. (nih.gov)
  • The results add further evidence that the concomitant use of filgrastim might not increase the risk of pulmonary toxicity of bleomycin. (nih.gov)
  • A large study from 1986 to 2003 found that out of 141 Hodgkin's lymphoma patients treated with bleomycin, 18% developed pulmonary toxicity, and of those patients 24% died [ 1 ]. (hindawi.com)
  • Furthermore, bleomycin lung toxicity was observed in 43% of older patients treated with ABVD, which is significantly higher than expected for younger patients. (bloodjournal.org)
  • With regard to bleomycin-induced lung toxicity, 0% and 1.5% cases were reported among patients receiving 2 cycles of AVD and ABVD, respectively, whereas 7 cases (10%) were reported among patients receiving 4 cycles ABVD, 3 of which were fatal. (bloodjournal.org)
  • Severe bleomycin lung toxicity: reversal with high dose corticosteroids. (bmj.com)
  • This report suggests that bleomycin lung toxicity may be reversible if treated aggressively. (bmj.com)
  • Reversal of bleomycin lung toxicity with corticosteroids. (bmj.com)
  • Therefore, we examined the effect of an onion extract on cyto- and geno-toxicity in human lymphocytes treated with bleomycin (BLM), a radiomimetic agent. (sigmaaldrich.com)
  • Growth factor support is not routinely required unless there are treatment delays (due to sepsis etc.), because it may increase the risk of bleomycin induced pulmonary toxicity. (eviq.org.au)
  • 178 (33%) of 544 patients given ABVD had WHO grade III or IV toxicity, compared with 53 (28%) of 187 given ABV, 142 (26%) of 539 given AVD, and 40 (26%) of 151 given AV. Leucopenia was the most common event, and highest in the groups given bleomycin. (mdc-berlin.de)
  • Systemic toxicity after intralesional bleomycin therapy has not been reported in haemangioma patients. (scielo.org.za)
  • Nevertheless, the potential for bleomycin-induced pulmonary toxicity when used in the treatment of non-malignant diseases remains a major concern. (scielo.org.za)
  • Bleomycin pulmonary toxicity in adult Saudi patients with Hodgkin's lymphoma. (semanticscholar.org)
  • IBI was used for the treatment of 4 paediatric patients with haemangiomas at dosages of 0.2 - 0.9 mg/kg/treatment ( Table I ). The bleomycin sulphate formulation used was Blenoxane (Bristol-Myers Squibb, Bedfordview, South Africa), which is a mixture of glycopeptides containing approximately 69% bleomycin A 2 and 29% bleomycin B 2 . (scielo.org.za)
  • Waters LC Module 1 HPLC fitted with a model 486 UV detector (294 nm) (Waters Corp., Milford, MA, USA) and a C-18 Luna column (150x4.6 mm) (Phenomenex Corp., Sunnyvale, CA, USA) were used to separate and quantitate the Blenoxane fractions (bleomycin A 2 and B 2 ) in plasma samples according to a method developed in our laboratory (unpublished data). (scielo.org.za)
  • At these time points, the mean levels of the two blenoxane fractions ranged from 211.95 to 678.44 ug/ml for bleomycin A 2 and 99.90 to 340.32 µ g/ml for bleomycin B 2 . (scielo.org.za)
  • For intrapleural administration, dissolve 60 units of bleomycin in 50 to 100 mL of sodium chloride 0.9% injection. (drugs.com)
  • Following intravenous bolus administration of 30 units of bleomycin to one patient with a primary germ cell tumor of the brain, a peak CSF level was 40% of the simultaneously-obtained plasma level and was attained in two hours after drug administration. (nih.gov)
  • Each vial of sterile lyophilized powder contains bleomycin sulphate equivalent to 15 units of bleomycin. (medbroadcast.com)
  • DOSE EQUIVALENCE: 1,500 International Units of bleomycin are equivalent to 1.5 USP units and approximately equivalent to 1.5 mg (by potency) or 1 mg (by weight). (eviq.org.au)
  • The rat lung tumor-derived cell lines I149 and R623, with a methylated and unmethylated endogenous p16 gene, respectively were used to determine the effect of bleomycin on transcriptional activity of a 162-bp minimized p16 promoter. (aacrjournals.org)
  • In contrast to control animals treated with saline, total lung hydroxyproline in the nude mouse was not significantly increased at 14 and 30 days after bleomycin treatment. (biomedsearch.com)
  • We aimed to investigate whether omission of either bleomycin or dacarbazine, or both, from ABVD reduced the efficacy of this regimen in treatment of Hodgkin's lymphoma. (mdc-berlin.de)
  • These groups were further divided to receive either bleomycin or vehicle (saline) via an oropharyngeal delivery, rather than the traditional intratracheal instillation. (hindawi.com)
  • After the increase of TGF-beta 1 mRNA the messages for biglycan and collagen III steadily increased to reach a maximum 10 d after bleomycin instillation. (jci.org)
  • Objectives: This study was designed to compare effectiveness of intra-pleural instillation of Bleomycin with instillation of Povidone-iodine for control of malignant pleural effusion among patients with non-small cell lung cancer, guided by results of thoracic Echography. (omicsonline.org)
  • Drainage of the effusion was followed by instillation of bleomycin or povidone- iodine through the thoracostomy tube. (omicsonline.org)
  • Thus, 51 patients received intra-pleural instillation of bleomycin or povidone-iodine in a randomized prospective comparative study. (omicsonline.org)
  • Instillation of bleomycin is a well- established technique but unfortunately it is expensive and associated with serious side effects [ 2 ]. (omicsonline.org)
  • Bleomycin is a mixture of cytotoxic glycopeptide antibiotics. (drugs.com)
  • One vial (15 U) of bleomycin was dissolved in 15 mL of sterile water. (ajnr.org)
  • Although the exact mechanism of action of bleomycin is unknown, available evidence indicates that the main mode of action is the inhibition of DNA synthesis with some evidence of lesser inhibition of RNA and protein synthesis. (nih.gov)
  • Inhibition of this phosphorylation by PI3K inhibitors or by dominant-negative Akt (T308A/S473A) expression abrogated the effects of bleomycin on fibroblast proliferation and collagen production, suggesting the role of PI3K/Akt in the fibrogenic process. (cdc.gov)
  • Inhibition of ROS generation by antioxidant enzymes, catalase and superoxide dismutase mimetic MnTBAP, abrogated the fibrogenic effects of bleomycin as well as its induction of PI3K/Akt and HIF-1 alpha activation. (cdc.gov)
  • Bleomycin treatment did not affect the activity of the pGL-2 control vector (SV40 promoter and enhancer sequence), suggesting that inhibition of p16 promoter activity is occurring either by direct damage or indirectly through affecting transcriptional machinery needed to drive expression of the transgene. (aacrjournals.org)
  • The addition of Wortmannin, but not 3-aminobenzamide (DSB and SSB inhibitors, respectively) potentiates the inhibition of p16 promoter activity suggesting that bleomycin effects are mediated through DSBs. (aacrjournals.org)
  • The synthetic cannabinoid prevented fibroblasts activation induced by bleomycin, paralleled by a strong inhibition of TGFβ, CTGF and PDGF-BB expression. (bmj.com)
  • Randomized trial of bleomycin , etoposide, andcisplatin compared with bleomycin , etoposide, and carboplatin in good-prognosis metastatic nonseminomatous germ cell cancer: A multi-institutional Medical Research Council/European Organization for Research and Treatment of Cancer Trial. (thefreedictionary.com)
  • Bleomycin selectively inhibits the synthesis of deoxyribonucleic acid (DNA). (drugbank.ca)
  • DNA (deoxyribonucleic acid) complexed with Bleomycin A2. (sciencephoto.com)
  • C.-H. Huang, C. K. Mirabelli, Y. Jan, and S. T. Crooke, Single-strand and double-strand deoxyribonucleic acid breaks produced by several bleomycin analogues. (springer.com)
  • Labeled free bases could be detected chromatographically after reaction of deoxyribonucleic acid with high concentrations of the antibiotic bleomycin. (aspetjournals.org)
  • Bleomycin is also used to treat Hodgkin's lymphoma (Hodgkin's disease) and non-Hodgkin's lymphoma (cancer that begins in the cells of the immune system) in combination with other medications. (medlineplus.gov)
  • Bleomycin is FDA approved as a single agent or in proven combinations to treat people who have Hodgkin and non-Hodgkin lymphoma. (lls.org)
  • Bleomycin is a member of the antibiotics/antineoplastics drug class and is commonly used for Hodgkin's Lymphoma, Malignant Pleural Effusion, Non-Hodgkin's Lymphoma, and others. (drugs.com)
  • A severe idiosyncratic reaction consisting of hypotension, mental confusion, fever, chills, and wheezing has been reported in approximately 1% of lymphoma patients treated with bleomycin. (nih.gov)
  • In the last few decades, many Americans were diagnosed with Hodgkin's lymphoma and testicular cancer, and a majority received bleomycin as part of their chemotherapeutic regimen. (hindawi.com)
  • Bleomycin is a chemotherapeutic agent used to treat cancers such as Hodgkins lymphoma. (mdbiosciences.com)
  • There have been isolated cases where patients, treated for lymphoma with bleomycin containing regimens, have developed SSc (5,6) thus evaluation of RP and SSc is warranted in testicular cancer patients. (bmj.com)
  • With respect to our predefined non-inferiority margin, bleomycin cannot be safely omitted either, and the standard of care for patients with early-stage favourable Hodgkin's lymphoma should remain ABVD followed by IFRT. (mdc-berlin.de)
  • Bleomycin in older early-stage favorable Hodgkin lymphoma patients: analysis of the German Hodgkin Study Group (GHSG) HD10 and HD13 trials. (semanticscholar.org)
  • Impact of Bleomycin and Vincristine Dose Reductions in Patients With Advanced Hodgkin Lymphoma Treated With BEACOPP: An Analysis of the German Hodgkin Study Group HD12 and HD15 Trials. (semanticscholar.org)
  • Bleomycin A5 hydrochloride is an antitumor antibiotic which induces apoptosis. (scbt.com)
  • Bleomycin A5 stimulates downstream apoptosis by increasing cysteine-aspartic acid protease-3 (caspase-3) activity, tumor protein 53 (p53) production and transforming growth factor beta 1 (TGF-beta 1) formation. (goldbio.com)
  • Regulation of alveolar macrophage transforming growth factor-beta secretion by corticosteroids in bleomycin-induced pulmonary inflammation in the rat. (uptodate.com)
  • Bleomycin for injection is provided as a sterile, white to off-white, lyophilized cake or powder in vials for intramuscular, intravenous, or subcutaneous administration. (nih.gov)
  • Bleomycin is rapidly absorbed following either intramuscular, subcutaneous, intraperitoneal or intrapleural administration reaching peak plasma concentrations in 30 to 60 minutes. (nih.gov)
  • Systemic bioavailability of bleomycin is 100% and 70% following intramuscular and subcutaneous administrations, respectively, and 45% following both intraperitoneal and intrapleural administrations, compared to intravenous and bolus administration. (nih.gov)
  • The murine SSc model was established by daily subcutaneous injection of bleomycin for 4 weeks, followed with two UC‑MSC infusions every 7 days. (spandidos-publications.com)
  • OUTLINE: Patients receive bleomycin intratumorally during laparotomy. (bioportfolio.com)
  • Arm I: Patients receive bleomycin intratumorally on day 1. (knowcancer.com)
  • Bleomycin comes as a powder to be mixed with liquid and injected intravenously (into a vein), intramuscularly (into a muscle), or subcutaneously (under the skin) by a doctor or nurse in a medical office or hospital outpatient department. (medlineplus.gov)
  • The cost for bleomycin injectable powder for injection 15 units is around $38 for a supply of 1 powder for injection, depending on the pharmacy you visit. (drugs.com)
  • Please read this leaflet carefully before you start using Cipla Bleomycin 15K Powder for injection. (nps.org.au)
  • The pathogenesis and clinical aspects of bleomycin-induced lung injury will be reviewed here. (uptodate.com)
  • Potential drug interactions that may modify the course of bleomycin-induced lung injury and the therapeutic options available for management will also be discussed. (uptodate.com)
  • The mechanism of bleomycin-induced lung injury is not entirely clear, but likely includes components of oxidative damage, relative deficiency of the deactivating enzyme bleomycin hydrolase, genetic susceptibility, and elaboration of inflammatory cytokines. (uptodate.com)
  • Primary skin cancers - basal cell carcinoma , keratoacanthoma , flat ( macular ) stage of Kaposi sarcoma and squamous cell carcinoma / Bowen disease have been successfully treated usually with the combination of intralesional bleomycin followed by electrical impulses (electrochemotherapy). (dermnetnz.org)
  • Zhang, L. Pingyangmycin and Bleomycin Share the Same Cytotoxicity Pathway. (mdpi.com)
  • Protective Effect of Onion Extract on Bleomycin-Induced Cytotoxicity and Genotoxicity in Human Lymphocytes. (sigmaaldrich.com)
  • Phosphatidylinositol-3-Kinase/Akt regulates bleomycin-induced fibroblast proliferation and collagen production. (cdc.gov)
  • Activation of PI3K/Akt by bleomycin also led to transcriptional activation and protein expression of hypoxia-inducible factor-la (HIF-1 alpha) and vascular endothelial growth factor, which contributed to the fibroproliferative and collagen-inducing effects of bleomycin. (cdc.gov)
  • Results: After 14 days, bleomycin caused increased macrophages and lymphocytes in the BALF and elevated IL-1β, TIMP-1 and collagen levels in the lung. (ersjournals.com)
  • With at the beginning of bleomycin synthesis, the supply of the specific precursor GDP-mannose played the key role in bleomycin production. (springer.com)
  • The fibrogenic effects of bleomycin were dependent on ROS generation, particularly superoxide anion and hydrogen peroxide, which were induced by bleomycin. (cdc.gov)
  • We describe a patient in whom direct intralesional injections of bleomycin successfully palliated severe recurrent epistaxis for almost 2 years without the need for adjuvant therapy. (ajnr.org)
  • Any previous treatment with bleomycin should therefore always be disclosed to the anaesthetist prior to undergoing a procedure requiring general anaesthesia. (wikipedia.org)
  • Before you begin treatment with bleomycin, you and your doctor should talk about the good this medicine will do as well as the risks of using it. (mayoclinic.org)
  • DNA cleavage by bleomycin depends on oxygen and metal ions, at least in vitro. (wikipedia.org)
  • In in vitro and in vivo experiments, bleomycin has been shown to cause cell cycle arrest in G2 and in mitosis. (nih.gov)
  • We demonstrated that bleomycin can activate ER stress associated proteins, including GRP78, CHOP, and ATF-4, both in vitro and in vivo . (nature.com)
  • Bleomycin, a non-heme iron protein, acts by induction of DNA strand breaks. (wikipedia.org)
  • Protein binding of bleomycin has not been studied. (nih.gov)
  • Bleomycin had no significant effect on total Akt protein expression but induced phosphorylation of the protein at threonine 308 and serine 473 positions. (cdc.gov)
  • Histological and immunohistochemical studies showed a significant increase in the number of MMP-2 protein expression and Mast cells in the Bleomycin group in comparison with the Carboxy Methyl Cellulose group (p (magiran.com)
  • and are inactivated by bleomycin hydrolase, which hydrolyses the carboxyamide bond of the beta-aminoalanine moiety [ PMID: 4122312 ]. (ebi.ac.uk)
  • Bleomycin hydrolase acts mainly as an aminopeptidase on short peptides, but the rat orthologue has been shown to cleave amyloid beta-peptides, acting as an endopeptidase or a carboxypeptidase, as well as an aminopeptidase [ PMID: 16472072 ]. (ebi.ac.uk)
  • Bleomycin hydrolase is intracellular and exists naturally as a homohexamer, with all the active site in the central cavity of the barrel [ PMID: 7638617 ]. (ebi.ac.uk)
  • Our results showed that the Aschcroft score and hydroxyproline content of the bleomycin-treated mouse lung decreased in response to fasudil treatment. (mdpi.com)
  • OBJECTIVES: I. Determine the safety and surgical feasibility of electroporation therapy with bleomycin in patients with locally advanced pancreatic cancer. (bioportfolio.com)
  • The purpose of the trial is to study the safety and efficacy of the Medpulser Electroporation System with bleomycin in the treatment of head and neck cancer. (bioportfolio.com)
  • The purpose of the study is to evaluate Medpulser electroporation (EPT) with bleomycin with regard to local tumor recurrence, disease-free survival, and overall survival rates versus surge. (bioportfolio.com)
  • OBJECTIVES: I. Compare the objective tumor response rate of patients with stage III or IV melanoma when treated with intratumoral bleomycin with or without electroporation therapy. (knowcancer.com)
  • Bleomycin is a medication used to treat cancer. (wikipedia.org)
  • Bleomycin (blee oh mye sin) destroys cancer cells by interfering with a specific phase of cell life. (childrensmn.org)
  • Bleomycin seems to act by interfering with the growth of cancer cells, which are eventually destroyed. (mayoclinic.org)
  • It is recommended that bleomycin be administered under the supervision of a qualified physician experienced in the use of cancer chemotherapeutic agents. (nih.gov)
  • Bleomycin is a group of glycopeptides that binds iron and oxygen in vivo to produce an active drug, effective in cancer treatment. (hindawi.com)
  • Bleomycin belongs to the group of cancer-fighting medications known as antineoplastics , and specifically to the group of antineoplastics called actinomycins . (medbroadcast.com)
  • Bleomycin causes the death of cancer cells by interfering with their growth and reproduction. (medbroadcast.com)
  • As well as interfering with the genetic material (DNA) of cancer cells, bleomycin can interfere with some of your normal cells. (medbroadcast.com)
  • There is a high rate of skin side effects when used intravenously to treat cancer because skin, in particular, has no bleomycin hydrolase activity. (dermnetnz.org)
  • Skin side effects develop in approximately 50% of patients receiving bleomycin for cancer. (dermnetnz.org)
  • S. K. Carter, The current role of bleomycin in cancer therapy. (springer.com)
  • Survival of cells with bleomycin-induced chromosomal lesions in the cultured lymphocytes of lung cancer patients. (aacrjournals.org)
  • In a previous study of lung cancer, we showed that bleomycin, a radiomimetic agent, induced breaks preferentially on chromosomes 4 and 5. (aacrjournals.org)
  • The molecular cytogenetic study reported here, using chromosome painting and G banding, was designed to assess whether the chromatid breaks induced by bleomycin could survive as chromosome-type aberrations after treated lymphocyte populations were allowed to recover in a drug-free medium for one or two cell generations and whether the survival rates of lesions on chromosomes 4 and 5 differed in cases with lung cancer and controls. (aacrjournals.org)
  • As controls, blood samples were taken at the same time intervals as for the haemangioma patients from 4 paediatric cancer patients who received bleomycin intravenously. (scielo.org.za)
  • What are the indications for intralesional bleomycin? (dermnetnz.org)
  • Has ab142406 Bleomycin A5 hydrochloride activity been assessed? (abcam.com)
  • I have been in touch with the originating laboratories and am sorry to confirm that the activity of the Bleomycin A5 hydrochloride has not been assessed. (abcam.com)
  • Bleomycin A5 hydrochloride is a compound part of the glycopeptide antibiotic family. (goldbio.com)
  • Bleomycin (BLM) is a mixture of mainly two compounds (A2 and B2), which is on the World Health Organization's list of essential medicines. (mdpi.com)
  • Bleomycin A 2 is the major constituent of the clinically used mixture of bleomycins. (springer.com)
  • Clinically, the mixture of bleomycin A2 and bleomycin B2 is widely used in combination with other drugs for the treatment of various cancers. (springer.com)
  • The bleomycin mixture was then injected until blanching of the overlying mucosa and the telangiectasia was seen. (ajnr.org)
  • Bleomycin hydrolase is an enzyme that in humans is encoded by the BLMH gene. (wikipedia.org)
  • Bleomycin is inactivated by a cytosolic cysteine proteinase enzyme, bleomycin hydrolase. (nih.gov)
  • Electrical impulses are sometimes used to improve bleomycin efficacy via electrodes placed in the skin around the injected area ( electrochemotherapy ). (dermnetnz.org)
  • Mainly during electrochemotherapy treatment anticancer drug bleomycin (BLM) is used. (vdu.lt)