Bleomycin: A complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2. It inhibits DNA metabolism and is used as an antineoplastic, especially for solid tumors.Pulmonary Fibrosis: A process in which normal lung tissues are progressively replaced by FIBROBLASTS and COLLAGEN causing an irreversible loss of the ability to transfer oxygen into the bloodstream via PULMONARY ALVEOLI. Patients show progressive DYSPNEA finally resulting in death.Antibiotics, Antineoplastic: Chemical substances, produced by microorganisms, inhibiting or preventing the proliferation of neoplasms.Peplomycin: An antineoplastic agent derived from BLEOMYCIN.Hydroxyproline: A hydroxylated form of the imino acid proline. A deficiency in ASCORBIC ACID can result in impaired hydroxyproline formation.Vinblastine: Antitumor alkaloid isolated from Vinca rosea. (Merck, 11th ed.)Phleomycins: Water-soluble, copper-containing low molecular weight polypeptides obtained from the culture medium of Streptomyces verticillus. They are specific inhibitors of DNA synthesis in bacteria and have been found to act as antitumor agents. They have also been used against rust fungi of plants.Lung: Either of the pair of organs occupying the cavity of the thorax that effect the aeration of the blood.Vincristine: An antitumor alkaloid isolated from VINCA ROSEA. (Merck, 11th ed.)Electrochemotherapy: A treatment modality that uses pulsed electrical currents to permeabilize cell membranes (ELECTROPORATION) and thereby enhance the uptake of chemotherapeutic agents, vaccines, or genes into the body's cells.Etoposide: A semisynthetic derivative of PODOPHYLLOTOXIN that exhibits antitumor activity. Etoposide inhibits DNA synthesis by forming a complex with topoisomerase II and DNA. This complex induces breaks in double stranded DNA and prevents repair by topoisomerase II binding. Accumulated breaks in DNA prevent entry into the mitotic phase of cell division, and lead to cell death. Etoposide acts primarily in the G2 and S phases of the cell cycle.Procarbazine: An antineoplastic agent used primarily in combination with mechlorethamine, vincristine, and prednisone (the MOPP protocol) in the treatment of Hodgkin's disease.Testicular Neoplasms: Tumors or cancer of the TESTIS. Germ cell tumors (GERMINOMA) of the testis constitute 95% of all testicular neoplasms.Hodgkin Disease: A malignant disease characterized by progressive enlargement of the lymph nodes, spleen, and general lymphoid tissue. In the classical variant, giant usually multinucleate Hodgkin's and REED-STERNBERG CELLS are present; in the nodular lymphocyte predominant variant, lymphocytic and histiocytic cells are seen.Instillation, Drug: The administration of therapeutic agents drop by drop, as eye drops, ear drops, or nose drops. It is also administered into a body space or cavity through a catheter. It differs from THERAPEUTIC IRRIGATION in that the irrigate is removed within minutes, but the instillate is left in place.Doxorubicin: Antineoplastic antibiotic obtained from Streptomyces peucetius. It is a hydroxy derivative of DAUNORUBICIN.Mechlorethamine: A biologic alkylating agent that exerts its cytotoxic effects by forming DNA ADDUCTS and DNA interstrand crosslinks, thereby inhibiting rapidly proliferating cells. The hydrochloride is an antineoplastic agent used to treat HODGKIN DISEASE and LYMPHOMA.Cisplatin: An inorganic and water-soluble platinum complex. After undergoing hydrolysis, it reacts with DNA to produce both intra and interstrand crosslinks. These crosslinks appear to impair replication and transcription of DNA. The cytotoxicity of cisplatin correlates with cellular arrest in the G2 phase of the cell cycle.Injections, Intralesional: Injections introduced directly into localized lesions.Cobalt Radioisotopes: Unstable isotopes of cobalt that decay or disintegrate emitting radiation. Co atoms with atomic weights of 54-64, except 59, are radioactive cobalt isotopes.Dacarbazine: An antineoplastic agent. It has significant activity against melanomas. (from Martindale, The Extra Pharmacopoeia, 31st ed, p564)Antineoplastic Combined Chemotherapy Protocols: The use of two or more chemicals simultaneously or sequentially in the drug therapy of neoplasms. The drugs need not be in the same dosage form.Neoplasms, Germ Cell and Embryonal: Neoplasms composed of primordial GERM CELLS of embryonic GONADS or of elements of the germ layers of the EMBRYO, MAMMALIAN. The concept does not refer to neoplasms located in the gonads or present in an embryo or FETUS.Germinoma: A malignant neoplasm of the germinal tissue of the GONADS; MEDIASTINUM; or pineal region. Germinomas are uniform in appearance, consisting of large, round cells with vesicular nuclei and clear or finely granular eosinophilic-staining cytoplasm. (Stedman, 265th ed; from DeVita Jr et al., Cancer: Principles & Practice of Oncology, 3d ed, pp1642-3)Prednisone: A synthetic anti-inflammatory glucocorticoid derived from CORTISONE. It is biologically inert and converted to PREDNISOLONE in the liver.Zinostatin: An enediyne that alkylates DNA and RNA like MITOMYCIN does, so it is cytotoxic.Idiopathic Pulmonary Fibrosis: A common interstitial lung disease of unknown etiology, usually occurring between 50-70 years of age. Clinically, it is characterized by an insidious onset of breathlessness with exertion and a nonproductive cough, leading to progressive DYSPNEA. Pathological features show scant interstitial inflammation, patchy collagen fibrosis, prominent fibroblast proliferation foci, and microscopic honeycomb change.DeoxyriboseIodides: Inorganic binary compounds of iodine or the I- ion.Iodine Radioisotopes: Unstable isotopes of iodine that decay or disintegrate emitting radiation. I atoms with atomic weights 117-139, except I 127, are radioactive iodine isotopes.Patents as Topic: Exclusive legal rights or privileges applied to inventions, plants, etc.Foramen Ovale, Patent: A condition in which the FORAMEN OVALE in the ATRIAL SEPTUM fails to close shortly after birth. This results in abnormal communications between the two upper chambers of the heart. An isolated patent ovale foramen without other structural heart defects is usually of no hemodynamic significance.Isotope Labeling: Techniques for labeling a substance with a stable or radioactive isotope. It is not used for articles involving labeled substances unless the methods of labeling are substantively discussed. Tracers that may be labeled include chemical substances, cells, or microorganisms.Lung Injury: Damage to any compartment of the lung caused by physical, chemical, or biological agents which characteristically elicit inflammatory reaction. These inflammatory reactions can either be acute and dominated by NEUTROPHILS, or chronic and dominated by LYMPHOCYTES and MACROPHAGES.Bronchoalveolar Lavage Fluid: Washing liquid obtained from irrigation of the lung, including the BRONCHI and the PULMONARY ALVEOLI. It is generally used to assess biochemical, inflammatory, or infection status of the lung.Dictionaries, MedicalDictionaries as Topic: Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.Streptomyces: A genus of bacteria that form a nonfragmented aerial mycelium. Many species have been identified with some being pathogenic. This genus is responsible for producing a majority of the ANTI-BACTERIAL AGENTS of practical value.Streptomyces coelicolor: A soil-dwelling actinomycete with a complex lifecycle involving mycelial growth and spore formation. It is involved in the production of a number of medically important ANTIBIOTICS.Dictionaries, ChemicalTerminology as Topic: The terms, expressions, designations, or symbols used in a particular science, discipline, or specialized subject area.Heparitin Sulfate: A heteropolysaccharide that is similar in structure to HEPARIN. It accumulates in individuals with MUCOPOLYSACCHARIDOSIS.Dermatan Sulfate: A naturally occurring glycosaminoglycan found mostly in the skin and in connective tissue. It differs from CHONDROITIN SULFATE A (see CHONDROITIN SULFATES) by containing IDURONIC ACID in place of glucuronic acid, its epimer, at carbon atom 5. (from Merck, 12th ed)Sulfates: Inorganic salts of sulfuric acid.Heparan Sulfate Proteoglycans: Ubiquitous macromolecules associated with the cell surface and extracellular matrix of a wide range of cells of vertebrate and invertebrate tissues. They are essential cofactors in cell-matrix adhesion processes, in cell-cell recognition systems, and in receptor-growth factor interactions. (From Cancer Metastasis Rev 1996; 15(2): 177-86; Hepatology 1996; 24(3): 524-32)Professional Role: The expected function of a member of a particular profession.Cardiology: The study of the heart, its physiology, and its functions.Sleep Medicine Specialty: A medical specialty concerned with the diagnosis and treatment of SLEEP WAKE DISORDERS and their causes.Emergency Medicine: The branch of medicine concerned with the evaluation and initial treatment of urgent and emergent medical problems, such as those caused by accidents, trauma, sudden illness, poisoning, or disasters. Emergency medical care can be provided at the hospital or at sites outside the medical facility.Gastroenterology: A subspecialty of internal medicine concerned with the study of the physiology and diseases of the digestive system and related structures (esophagus, liver, gallbladder, and pancreas).Endocrinology: A subspecialty of internal medicine concerned with the metabolism, physiology, and disorders of the ENDOCRINE SYSTEM.Nephrology: A subspecialty of internal medicine concerned with the anatomy, physiology, and pathology of the kidney.Neurology: A medical specialty concerned with the study of the structures, functions, and diseases of the nervous system.

The Saccharomyces cerevisiae ETH1 gene, an inducible homolog of exonuclease III that provides resistance to DNA-damaging agents and limits spontaneous mutagenesis. (1/2335)

The recently sequenced Saccharomyces cerevisiae genome was searched for a gene with homology to the gene encoding the major human AP endonuclease, a component of the highly conserved DNA base excision repair pathway. An open reading frame was found to encode a putative protein (34% identical to the Schizosaccharomyces pombe eth1(+) [open reading frame SPBC3D6.10] gene product) with a 347-residue segment homologous to the exonuclease III family of AP endonucleases. Synthesis of mRNA from ETH1 in wild-type cells was induced sixfold relative to that in untreated cells after exposure to the alkylating agent methyl methanesulfonate (MMS). To investigate the function of ETH1, deletions of the open reading frame were made in a wild-type strain and a strain deficient in the known yeast AP endonuclease encoded by APN1. eth1 strains were not more sensitive to killing by MMS, hydrogen peroxide, or phleomycin D1, whereas apn1 strains were approximately 3-fold more sensitive to MMS and approximately 10-fold more sensitive to hydrogen peroxide than was the wild type. Double-mutant strains (apn1 eth1) were approximately 15-fold more sensitive to MMS and approximately 2- to 3-fold more sensitive to hydrogen peroxide and phleomycin D1 than were apn1 strains. Elimination of ETH1 in apn1 strains also increased spontaneous mutation rates 9- or 31-fold compared to the wild type as determined by reversion to adenine or lysine prototrophy, respectively. Transformation of apn1 eth1 cells with an expression vector containing ETH1 reversed the hypersensitivity to MMS and limited the rate of spontaneous mutagenesis. Expression of ETH1 in a dut-1 xthA3 Escherichia coli strain demonstrated that the gene product functionally complements the missing AP endonuclease activity. Thus, in apn1 cells where the major AP endonuclease activity is missing, ETH1 offers an alternate capacity for repair of spontaneous or induced damage to DNA that is normally repaired by Apn1 protein.  (+info)

Differential regulation of p21waf-1/cip-1 and Mdm2 by etoposide: etoposide inhibits the p53-Mdm2 autoregulatory feedback loop. (2/2335)

The Mdm2 protein is frequently overexpressed in human non-seminomatous germ cell tumours and transitional carcinoma of the bladder where it may contribute to tolerance of wtp53. Mdm2 forms an autoregulatory feedback loop with p53; the Mdm2 gene is responsive to transactivation by p53 and once synthesized the Mdm2 protein terminates the p53 response. We show here that the topoisomerase poison etoposide, like ultra violet irradiation, inhibits Mdm2 synthesis. Cytotoxic concentrations of etoposide (IC90 for > 3 h) result in inhibition of Mdm2 induction at both the RNA and protein level. Rapid apoptosis ensues. Global transcription is not inhibited: p21waf-1/cip1 and GADD45 expression increase in a dose dependent manner. Inhibition of Mdm2 synthesis depends on the continuous presence of etoposide, suggesting the DNA damage may prevent transcription. Downregulation of Mdm2 transcript occurs in cells expressing HPV16-E6 suggesting that inhibition of Mdm2 transcription is p53-independent. When cells are -treated with a pulse (1 h) of etoposide and reincubated in drug free medium, Mdm2 synthesis commences immediately after damage is repaired (3 h) and the p53 response is attenuated. Induction of apoptosis and loss of clonogenicity are 3-5-fold lower under pulse treatment conditions. This is the first observation of inhibition of Mdm2 transcription following treatment with topoisomerase (topo II) poisons, a feature that may be useful in tumour types where p53 is tolerated by overexpression of Mdm2.  (+info)

The integrin alpha v beta 6 binds and activates latent TGF beta 1: a mechanism for regulating pulmonary inflammation and fibrosis. (3/2335)

Transforming growth factor beta (TGF beta) family members are secreted in inactive complexes with a latency-associated peptide (LAP), a protein derived from the N-terminal region of the TGF beta gene product. Extracellular activation of these complexes is a critical but incompletely understood step in regulation of TGF beta function in vivo. We show that TGF beta 1 LAP is a ligand for the integrin alpha v beta 6 and that alpha v beta 6-expressing cells induce spatially restricted activation of TGF beta 1. This finding explains why mice lacking this integrin develop exaggerated inflammation and, as we show, are protected from pulmonary fibrosis. These data identify a novel mechanism for locally regulating TGF beta 1 function in vivo by regulating expression of the alpha v beta 6 integrin.  (+info)

Testicular cancer: an oncological success story. (4/2335)

Testicular cancer has become a model for a curable neoplasm. Our studies with cisplatin combination chemotherapy allow us to conclude that: (a) short-duration intensive induction therapy with the most active agents in optimal dosage is more important than maintenance therapy; (b) modest dose escalation increases toxicity without improving therapeutic efficacy; (c) it is possible to develop curative salvage therapy for refractory germ cell tumors; and (d) preclinical models predicting synergism, such as vinblastine + bleomycin or cisplatin + etoposide have clinical relevance. Finally, testicular cancer has also become a model for new drug development. Cisplatin was approved by the Food and Drug Administration for testis and ovarian cancer, and etoposide and ifosfamide were approved for refractory germ cell tumors. The success of these studies confirms the importance of the continued search for new investigational drugs in all solid tumors.  (+info)

Can we cure indolent lymphomas? (5/2335)

The current consensus is that indolent lymphomas are incurable disorders. There are some indications that these malignancies are potentially curable. Indeed, not all indolent lymphomas are currently incurable. For example, patients with Ann Arbor stage I-II indolent lymphomas can experience long-term disease-free survival and probable cure. Also, from the available literature data, it seems that the achievement of a molecular complete remission is a desirable objective. Patients who achieve a persistently negative PCR state seldom relapse, whereas the opposite is true for persistently positive cases. In view of its excellent correlation with disease-free survival when examined serially in multiple blood or marrow samples, the PCR technique has the potential of providing a tumor marker that can be used as an early end point for clinical trials. By serving as an early surrogate end point, PCR could play an important role in expediting the development of new treatment strategies. Whether IFN is capable of increasing the molecular complete remission rate as measured by PCR is not known. However, it is clear that from the clinical standpoint, IFN has been able to increase 2-fold the length of remission in patients with advanced indolent lymphomas. In at least two studies, this has been associated with prolongation of survival. More intensive regimens such as alternating triple therapy, when used in combination with IFN, seem to have improved the quality of remissions as judged by the PCR assay. Finally, the site where the bcl-2 breakpoint occurs seems to have clinical significance. Those follicular lymphomas with germ-line bcl-2, in our experience, have behaved more aggressively than the others, and their failure-free survival seems different from the usual indolent lymphomas and more closely resembles the large cell lymphomas. Although the biological significance of this observation is not yet understood, this group might actually constitute a prognostically different subset with a more aggressive and perhaps more curable lymphoma. Whether the plateau observed in their failure-free survival curve will be maintained with more follow-up and whether they might be a curable subset remain to be determined.  (+info)

Effects of pirfenidone on procollagen gene expression at the transcriptional level in bleomycin hamster model of lung fibrosis. (6/2335)

A time course study was carried out to elucidate the mechanisms for antifibrotic effect of pirfenidone (PD). Hamsters were intratracheally (i.t.) instilled with saline (SA) or bleomycin (BL) (7.5 units/kg/5 ml). The animals were fed a diet containing 0.5% PD or the same control diet (CD) without the drug 2 days before and throughout the study. The animals were sacrificed at various times after instillation. The lung hydroxyproline level in BL + CD groups was gradually increased and peaked at 21 days to 181% of the SA + CD control. The BL + PD-treated groups showed a gradual decrease in their lung collagen content, showing a maximum reduction of 40% at day 21. The lung malondialdehyde levels of the BL + CD groups were increased by several-fold of the corresponding SA + CD groups at various times. The lung prolyl hydroxylase (PH) activities in the BL + CD groups were also increased by several-fold of the corresponding SA + CD groups at these time points. The hamsters in the BL + PD showed a gradual decrease in the lung malondialdehyde levels from 10 to 21days compared with their corresponding BL + CD groups. Treatment with PD also reduced the lung PH activities in the BL + PD groups compared with the corresponding BL + CD groups. However, PD failed to manifest any direct inhibitory effect on PH activity in vitro. BL treatment increased the lung procollagen I and III gene expressions in the BL + CD groups by several-fold at varying times compared with the corresponding SA + CD, and treatment with PD in the BL + PD groups significantly down-regulated the BL-induced overexpression of these genes. Studies evaluating the regulation of these genes at the transcriptional level revealed PD significantly reduced the transcription of PC I at 14 days. Our results indicate that the antifibrotic effect of PD was partly due to suppression of the BL-induced inflammatory events and partly due to down-regulation of BL-induced overexpression of lung procollagen I and III genes.  (+info)

T cell independence of bleomycin-induced pulmonary fibrosis. (7/2335)

The role of T cells and cytokines in bleomycin (BLM)-induced fibrosis was evaluated in susceptible and resistant strains of normal and SCID mice. Histology and hydroxyproline analysis showed that BLM induced pulmonary fibrosis in C57BL/6 and (C57BL/6 x BALB/c)F1 mice, whereas BALB/c mice were resistant to the disease. To test whether lymphocytes were required for the induction of BLM-induced pulmonary fibrosis, SCID mice were injected intratracheally with BLM and evaluated for the development of pulmonary inflammation and fibrosis. Similar morphological changes and increases in hydroxyproline were observed in both C57BL/6 SCID and (C57BL/6 x CB.17)F1 SCID animals compared to those seen in wild-type C57BL/6 and (C57BL/6 x BALB/c)F1 mice. In contrast, CB.17 SCID mice, which are genetically similar to BALB/c mice, were resistant to disease induction. Analysis of the cellular infiltrate in BLM-treated C57Bl/6 SCID mice confirmed a lack of T cells in the lungs of SCID mice and demonstrated a pronounced accumulation of eosinophils in areas of developing pulmonary fibrosis. NK cells were significantly elevated in untreated SCID mice and did not increase further after BLM treatment. Analysis of selected cytokines 1 day after initiation of BLM-induced pulmonary fibrosis indicated that the levels of TNF-alpha and IFN-gamma appeared to segregate with fibrosis in both the SCID and wild-type mice. The data demonstrate that T cells are not required for the induction of fibrosis by BLM and suggest that responses by non-lymphoid cells may be sufficient for the induction of fibrosis.  (+info)

Follicular large cell lymphoma: an aggressive lymphoma that often presents with favorable prognostic features. (8/2335)

It is debated whether follicular large cell lymphoma (FLCL) has a clinical behavior that is distinct from indolent follicular lymphomas, and whether there is a subset of patients who can be potentially cured. We report here our experience with 100 FLCL patients treated at our institution since 1984 with three successive programs. We evaluated the predictive value of pretreatment clinical features, including two risk models, the Tumor Score System and the International Prognostic Index (IPI). With a median follow-up of 67 months, the 5-year survival is 72% and the failure-free survival (FFS) is 67%, with a possible plateau in the FFS curve, particularly for patients with stage I-III disease. Features associated with shorter survival included age >/=60, elevated lactic dehydrogenase (LDH) or beta-2-microglobulin (beta2M), advanced stage, and bone marrow involvement. Stage III patients had significantly better survival than stage IV patients (P <.05). By the IPI and Tumor Score System, 80% of the patients were in the lower risk groups; both systems stratified patients into prognostic groups. Patients with FLCL have clinical features and response to treatment similar to that reported for diffuse large cell lymphoma. Prognostic risk systems for aggressive lymphomas are useful for FLCL. A meaningful fraction of patients may possibly be cured when treated as aggressive lymphomas.  (+info)

This study analysed the inhibitory effect of erythromycin on bleomycin-induced acute lung injury and found that, by pathological analysis, the most marked changes such as interstitial oedema and infiltration of inflammatory cells into the lung were induced at day 7 following bleomycin treatment.. Pretreatment with erythromycin prior to bleomycin + erythromycin decreased the 2.29-fold increase in total BAL cell count with bleomycin alone to a 1.32-fold increase compared with that with erythromycin alone. The neutrophil ratio in the BAL fluid in the BLM + EM group was 0.444 (69.7/156.9) compared with that of the bleomycin alone group. Furthermore, the neutrophil ratio in the BLM + pre-EM group was 0.106, which indicated that erythromycin caused marked inhibition of neutrophil infiltration into the airway in bleomycin-induced lung injury. An inhibitory effect of erythromycin on neutrophil chemotaxis in patients with chronic bronchitis and diffuse panbronchiolitis has been reported previously.10 16 ...
Bleomycin is a broad-spectrum glycopeptide antitumor antibiotic produced by Streptomyces verticillus. Clinically, the mixture of bleomycin A2 and bleomycin B2 is widely used in combination with other drugs for the treatment of various cancers. As a secondary metabolite, the biosynthesis of bleomycin is precisely controlled by the complex extra-/intracellular regulation mechanisms, it is imperative to investigate the global metabolic and regulatory system involved in bleomycin biosynthesis for increasing bleomycin production. N-acetylglucosamine (GlcNAc), the vital signaling molecule controlling the onset of development and antibiotic synthesis in Streptomyces, was found to increase the yields of bleomycins significantly in chemically defined medium. To mine the gene information relevant to GlcNAc metabolism, the DNA sequences of dasR-dasA-dasBCD-nagB and nagKA in S. verticillus were determined by chromosome walking. From the results of Real time fluorescence quantitative PCR (RT-qPCR) and
Iron has been shown to be important in ischaemic, immune and toxic forms of tissue injury in various organs. Although it is generally accepted that iron participates in the generation of powerful oxidant species (e.g. hydroxyl radicals) there has not been any direct evidence that iron capable of catalysing free-radical reactions is increased in tissues in these models of injury. In the present study we demonstrate that ischaemia/reperfusion injury to the kidney results in no significant change in total, nonhaem or ferritin iron levels, but there is a marked and specific increase in bleomycin-detectable iron (capable of catalysing free-radical reactions) in the kidney. The increase in bleomycin-detectable iron is observed only after reperfusion but not during the ischaemic period. In a separate study we demonstrate that despite a drastic reduction in the iron content in the kidney, as a result of feeding an iron-deficient diet, there is a similar and a marked increase in the bleomycin-detectable ...
In the presence of ferrous ions (Fe2+), the anti-tumour agent bleomycin will induce DNA degradation. Degradation of DNA into substances detectable by the thiobarbituric acid test has been used previously for the detection of iron in a form that is capable of catalysing the formation of the potentially harmful hydroxyl free radical. In the present paper, we describe the application of the ethidium-binding assay of DNA damage to the measurement of bleomycin-detectable iron, comparing its performance with the conventional method in the assessment of iron standard solutions and plasma samples from haemochromatosis patients. The ethidium-binding assay proved to be more responsive than the thiobarbituric acid test in the detection of DNA damage induced by very low concentrations of iron, but became saturated at higher iron concentrations. Agreement between the two versions of the assay in the identification of plasma samples containing bleomycin-detectable iron was good, but agreement on the actual ...
Systemic sclerosis (SSc) is a connective tissue disorder characterised by the development of skin fibrosis. Our current understanding of the disease pathogenesis is incomplete and the study of SSc is hindered, at least partially, by a lack of animal models that fully replicate the complex state of human disease. Murine model of bleomycin-induced dermal fibrosis encapsulates important events that take place early in the disease course. To characterise the optimum in vivo parameters required for the successful induction of dermal fibrosis we subjected three commonly used mouse strains to repeated subcutaneous bleomycin injections. We aimed to identify the effects of genetic background and gender on the severity of skin fibrosis. We used male and female Balb/C, C57BL/6, and DBA/2 strains and assessed their susceptibility to bleomycin-induced fibrosis by measuring dermal thickness, hydroxyproline/collagen content and number of resident myofibroblasts, all of which are important indicators of the severity of
Define bleomycin. bleomycin synonyms, bleomycin pronunciation, bleomycin translation, English dictionary definition of bleomycin. n. Any of a class of antibiotics isolated from the bacterium Streptomyces verticillus, used usually in sulfate form in combination with other drugs to treat...
Matrix metalloproteinase-8 (MMP-8) is a potent interstitial collagenase thought to be expressed mainly by polymorphonuclear neutrophils. To determine whether MMP-8 regulates lung inflammatory or fibrotic responses to bleomycin, we delivered bleomycin by the intratracheal route to wild-type (WT) versus Mmp-8−/− mice and quantified MMP-8 expression, and inflammation and fibrosis in the lung samples. Mmp-8 steady state mRNA and protein levels increase in whole lung and bronchoalveolar lavage samples when WT mice are treated with bleomycin. Activated murine lung fibroblasts express Mmp-8 in vitro. MMP-8 expression is increased in leukocytes in the lungs of patients with idiopathic pulmonary fibrosis compared with control lung samples. Compared with bleomycin-treated WT mice, bleomycin-treated Mmp-8−/− mice have greater lung inflammation, but reduced lung fibrosis. Whereas bleomycin-treated Mmp-8−/− and WT mice have similar lung levels of several pro- and antifibrotic mediators (TGF-β, ...
Objectives Reduced caveolin-1 levels in lung fibroblasts from patients with scleroderma and the lungs of bleomycin-treated mice promote collagen overexpression and lung fibrosis. This study was undertaken to determine whether caveolin-1 is deficient in leucocytes from bleomycin-treated mice and patients with scleroderma and to examine the consequences of this deficiency and its reversal.. Methods Mice or cells received the caveolin-1 scaffolding domain (CSD) peptide to reverse the pathological effects of reduced caveolin-1 expression. In bleomycin-treated mice, the levels of caveolin-1 in leucocytes and the effect of CSD peptide on leucocyte accumulation in lung tissue were examined. To validate the results in human disease and to identify caveolin-1-regulated molecular mechanisms, monocytes and neutrophils were isolated from patients with scleroderma and control subjects and caveolin-1, extracellular signal-regulated protein kinase (ERK), c-Jun N-terminal kinase (JNK), p38, CXC chemokine ...
TY - JOUR. T1 - Bleomycin serum pharmacokinetics as determined by a radioimmunoassay and a microbiologic assay in a patient with compromised renal function. AU - Crooke, Stanley T.. AU - Luft, Friedrich. AU - Broughton, Alan. AU - Strong, James. AU - Casson, Kay. AU - Einhorn, Lawrence. PY - 1977/4. Y1 - 1977/4. N2 - Serum and plasma bleomycin concentrations were determined in a patient with renal dysfunction at two creatinine clearances. The results obtained with a new radioimmunoassay and the microbiologic assay were compared. It was shown: 1) that the clearance of bleomycin from the blood is markedly retarded in severe renal dysfunction, 2) that clearance of bleomycin varies with creatinine clearance, 3) that bleomycin is probably not dialyzable, 4) that determinations on serum and plasma were equivalent, and 5) that the radioimmunoassay and microbiologic assays gave equivalent results (P , 0.001).. AB - Serum and plasma bleomycin concentrations were determined in a patient with renal ...
TY - JOUR. T1 - DNA methylation reduces binding and cleavage by bleomycin. AU - Roy, Basab. AU - Tang, Chenhong. AU - Alam, Mohammad P.. AU - Hecht, Sidney. PY - 2014/9/30. Y1 - 2014/9/30. N2 - In a recent study, we described the enhanced double-strand cleavage of hairpin DNAs by Fe·bleomycin (Fe·BLM) that accompanies increasingly strong binding of this antitumor agent and suggested that this effect may be relevant to the mechanism by which BLM mediates its antitumor effects. Because the DNA in tumor cells is known to be hypomethylated on cytidine relative to that in normal cells, it seemed of interest to study the possible effects of methylation status on BLM-induced double-strand DNA cleavage. Three hairpin DNAs found to bind strongly to bleomycin, and their methylated counterparts, were used to study the effect of methylation on bleomycin-induced DNA degradation. Under conditions of limited DNA cleavage, there was a significant overall decrease in the cleavage of methylated hairpin DNAs. ...
A mixture of the sulfate salts of basic glycopeptide antineoplastic antibiotics isolated from Streptomyces verticillus. Bleomycin sulfate forms complexes with iron that reduce molecular oxygen to superoxide and hydroxyl radicals which cause single- and double-stranded breaks in DNA; these reactive oxygen species also induce lipid peroxidation, carbohydrate oxidation, and alterations in prostaglandin synthesis and degradation.
Liposomal formulations of chemotherapeutic agents increase drug accumulation in tumors, which permits disease palliation at relatively low doses and thus decreases some of the dose-limiting toxicity. Multi-agent therapy is considered to be more effective than single-agent therapy; therefore, DOX-SL will be combined with bleomycin and vincristine.. Patients are randomized to receive intravenous DOX-SL alone or in combination with vincristine/bleomycin every 2 weeks. Filgrastim ( granulocyte colony-stimulating factor; G-CSF ) may be given as needed for neutropenia.. AS PER AMENDMENT 11/7/96: Based on interim review data, it is recommended that subjects receiving DOX-SL plus vincristine/bleomycin have vincristine/bleomycin discontinued and receive DOX-SL alone unless, in the opinion of the treating physician, they are benefitting from the DOX-SL plus vincristine/bleomycin regimen. ...
Liposomal formulations of chemotherapeutic agents increase drug accumulation in tumors, which permits disease palliation at relatively low doses and thus decreases some of the dose-limiting toxicity. Multi-agent therapy is considered to be more effective than single-agent therapy; therefore, DOX-SL will be combined with bleomycin and vincristine.. Patients are randomized to receive intravenous DOX-SL alone or in combination with vincristine/bleomycin every 2 weeks. Filgrastim ( granulocyte colony-stimulating factor; G-CSF ) may be given as needed for neutropenia.. AS PER AMENDMENT 11/7/96: Based on interim review data, it is recommended that subjects receiving DOX-SL plus vincristine/bleomycin have vincristine/bleomycin discontinued and receive DOX-SL alone unless, in the opinion of the treating physician, they are benefitting from the DOX-SL plus vincristine/bleomycin regimen. ...
TY - JOUR. T1 - (2S,3S,4R)-4-Amino-3-hydroxy-2-methylvalerate. Synthesis of an amino acid constituent of bleomycin from L-rhamnose [4]. AU - Ohgi, Tadaaki. AU - Hecht, Sidney. PY - 1981. Y1 - 1981. N2 - (2S,3S,4R)-4-Amino-3-hydroxy-2-methylvalerate, an amino acid constituent of the antitumor antibiotic bleomycin, has been prepared from L-rhamnose. This approach to a chiral 3-hydroxy-2-methylcarboxylate constitutes an alternative to the stereoselective aldol condensation.. AB - (2S,3S,4R)-4-Amino-3-hydroxy-2-methylvalerate, an amino acid constituent of the antitumor antibiotic bleomycin, has been prepared from L-rhamnose. This approach to a chiral 3-hydroxy-2-methylcarboxylate constitutes an alternative to the stereoselective aldol condensation.. UR - http://www.scopus.com/inward/record.url?scp=0000978523&partnerID=8YFLogxK. UR - http://www.scopus.com/inward/citedby.url?scp=0000978523&partnerID=8YFLogxK. M3 - Article. VL - 46. SP - 1232. EP - 1234. JO - Journal of Organic Chemistry. T2 - Journal ...
Introduction Transforming Growth Factor-beta (TGFβ) promotes anti-proliferative and pro-apoptotic pathways in lung epithelial cells, both of which have been implicated in the pathogenesis of IPF. TGFβ must be activated before it can mediate these events. Acute exacerbations of IPF are characterised by widespread epithelial cell apoptosis. The precise cause of these exacerbations is not known. The Influenza A virus is a single-stranded segmented RNA virus that infects epithelial cells leading to cell death and injury, and can also activate TGFβ. The role of infection in acute exacerbations of IPF is unclear. The aim of this study is to investigate the effect of influenza infection on bleomycin-induced pulmonary fibrosis and TGFβ activation in vivo.. ...
Background: We recently reported that PBI-Compound demonstrated anti-inflammatory and anti-fibrotic activities in acute and chronic kidney disease models. Inflammatory cytokines play a key role in the pathogenesis of pulmonary fibrosis.. Aims: To determine the effect of PBI-Compound on bleomycin-induced lung fibrosis at the pro-inflammatory/fibrotic cytokine level and histological lesions.. Methods: C57BL/6 mice received bleomycin by intratracheal instillation on day 0, and then were treated with oral administration of PBI-Compound from day 7 to 21. Mice were euthanized on day 21 and protein level of IFN-γ, IL-1β and TNF-α was quantified in the bronchoalveolar lavage fluid (BALF).. Results: The results show that intratracheal instillation of bleomycin induced a significant increase in CTGF, IL-1β and TNF-α in BALF. PBI-Compound treatment significantly decreased the amount of CTGF close to the level observed in the control group. IL-1β and TNF-α were also reduced by 20-30%. Regulation of ...
bleomycin definition: nounAny of a class of antibiotics isolated from the bacterium Streptomyces verticillus, used usually in sulfate form in combination with other drugs to treat certain kinds of cancer.Origin of bleomycin Alteration of phleomycin ...
This randomized phase II trial studies paclitaxel and carboplatin to see how well they work compared with bleomycin sulfate, etoposide phosphate, and cisplatin in treating patients with sex cord-ovarian stromal tumors that have spread to other places in the body and usually cannot be cured or controlled with treatment (advanced) or has returned (recurrent). Drugs used in chemotherapy work in different ways to stop the growth of tumor cells, either by killing the cells, by stopping them from dividing, or by stopping them from spreading. Giving more than one drug (combination chemotherapy) may kill more tumor cells. It is not yet known which chemotherapy regimen is more effective in treating sex cord-ovarian stromal tumors. ...
Bleomycin Sulfate is a glycopeptide antibiotic and an anticancer agent for squamous cell carcinomas (SCC) with IC50 of 4 nM in UT-SCC-19A cells.
Professional guide for Bleomycin Sulfate. Includes: pharmacology, pharmacokinetics, contraindications, interactions, adverse reactions and more.
is an antitumor antibiotic that was isolated from a strain ofStreptomyces verticillusin 1966. It has been used successfully to treat a variety of malignancies, predominantly germ cell tumors and Hodgkin lymphoma. The major limitation of bleomycin the
BioMed Research International is a peer-reviewed, Open Access journal that publishes original research articles, review articles, and clinical studies covering a wide range of subjects in life sciences and medicine. The journal is divided into 55 subject-specific sections.
Rapamycin Regulates Bleomycin-Induced Lung Damage in SP-C-Deficient Mice. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y tesis universitarias en PDF. Material universiario, documentación y tareas realizadas por universitarios en nuestra biblioteca. Para descargar gratis y para leer online.
ZEOCIN RESISTANCE. For Selecting Transfected Cells. To easily select cells that were transfected with our genetic circuit, we required a selectable marker that would work in all of our chassis, particularly HeLa cells and microglia, and would enable us to easily eliminate cells that have not taken up our recombinant plasmid. Zeocin is a widely used glycopeptide antibiotic, a formulation of phleomycin D1. It is capable of binding to and cleaving DNA, leading to cell necrosis in both eukaryotes and aerobic prokaryotes. Commonly outside of cells, in copper-chelated form, zeocin is inactive. When zeocin enters a cell, the Cu2+, which makes it appear blue, is reduced to Cu+ and then removed, activating zeocin, which then intercalates into DNA (Invitrogen). A 375 base pair bacterial gene encodes the Streptoalloteichus hindustanus bleomycin resistance protein (She ble protein). The She ble protein in mammalian cells is predominantly localised at the nucleus, specifically at euchromatin (Calmels et al. ...
Bleomycin, vincristine, cisplatin/bleomycin, etoposide, cisplatin chemotherapy: an alternating, dose intense regimen producing promising results in untreated patients with intermediate or poor prognosis malignant germ-cell ...
This 10-year follow-up study of 91 patients with disseminated testicular nonseminomatous cancer, treated with cisplatin, vinblastine, and bleomycin (PVB) induction chemotherapy and vinblastine plus bleomycin maintenance chemotherapy for a planned period of 2 years, shows a 63% cure rate. The predominant long-term sequelae are neurological and sexual dysfunction in 68% and 40% of patients, respectively. Two patients died of myocardial infarction. Sixteen percent of patients developed hypertension, 23% Raynauds phenomenon, and 25% ototoxicity. Despite the long-term side effects, 90% of the patients who responded to a questionnaire are fully employed. This study shows that the maintenance chemotherapy has contributed to the incidence and/or degree of neurotoxicity, hypertension, and renal function disturbance ...
Exosome isolation and purification. Exosome isolation, purification, and characterization were performed as previously described using iodixanol (OptiPrep) cushion density flotation (19). Briefly, concentrated conditioned media from human BM MSCs or HDFs were floated on an iodixanol cushion and centrifuged for 3.5 hours at 100,000 g at 4°C. The exosome-containing fraction (F9) was used for subsequent in vitro and in vivo experiments after confirming the presence of established exosome markers (ALIX, CD63, CD9, and FLOT1) (19).. Bleomycin-induced pulmonary fibrosis model. Fourteen-week-old mice (C57BL/6 strain, Charles River Laboratories) were anesthetized with isoflurane and received a single endotracheal dose of bleomycin sulphate (50 μL, 3 U/kg) at day 0. Bleomycin naive mice (control) received an endotracheal dose of saline (50 μL). Treated animals received a single i.v. (tail vein) dose of MEx (200 μL; dose, 5 × 106 MSC equivalents; ~8.6 × 108 particles) at day 0. HDF-derived exosomes ...
Methods Skin fibrosis was induced by local injections of bleomycin in two groups of DBA/2J mice. One group was cotreated with the synthetic cannabinoid WIN55,212-2 at 1 mg/kg/day. Skin fibrosis was evaluated by histology and skin thickness and hydroxyproline content were quantified. Markers of fibroblast activation, including α smooth muscle actin and the profibrotic cytokines transforming growth factor (TGF)β, connective tissue growth factor (CTGF) and platelet-derived growth factor (PDGF)-BB, were examined. Levels of PSMAD2/3, which are crucial in extracellular matrix overproduction, were analysed.. ...
The ED-A splice variant of FN is an important element controlling myofibroblast activation during wound healing and development of fibrosis (Klingberg et al., 2013; Shinde et al., 2015; White et al., 2008). Part of this action appears to be mediated by binding of ED-A FN-specific integrins. Integrins α9β1 and α4β1 recognize the EDGIHEL motif in ED-A FN (Liao et al., 2002; Shinde et al., 2008), and blocking antibodies against α4-integrins reduce the extent of bleomycin-induced lung fibrosis in mice (Gailit et al., 1993; Wang et al., 2000). This effect is likely caused by affecting inflammatory cells that most prominently express α4β1 integrin. The ED-A FN-binding integrin α4β7 has been directly implicated in myofibroblast differentiation of murine lung fibroblasts (Kohan et al., 2011, 2010). ED-A FN−/− mice are protected against bleomycin-induced skin and lung fibrosis (Muro et al., 2003, 2008) but not from experimentally induced liver fibrosis (Olsen et al., 2012). Notably, ED-A ...
We intend to continue our exploration of the bleomycin assay as a biological marker for the development of environmentally induced cancers. The impetus for such efforts would be enhanced through effective integration of cancer screening and intervention to achieve diminished cancer mortality. Currently, we are integrating combining bleomycin sensitivity screening to chemopreventive therapy against second primary malignancies in head and neck cancer patients. Previous studies have demonstrated that cis-retinoic acid, the agent used in our chemopreventive trial, is effective in such circumstances (35). Our purpose is to identify a high-risk subpopulation through application of the bleomycin sensitivity assay and then demonstrate that we can modulate the carcinogenic process with cis-retinoic acid. The use of genetic markers clearly enhances the power and precision of epidemiological research. The preventive implications of precise and valid markers for carcinogen sensitivity are obvious. We are ...
DNA (deoxyribonucleic acid) complexed with Bleomycin A2. Computer model showing the structure of a double-stranded synthetic DNA (red, green) complexed with Bleomycin A2 (purple). - Stock Image C035/8127
Radioiodinated bleomycin is a useful imaging agent for body tissues. Its production by iodination of bleomycin with radioactive iodide ions in the presence of an oxidizing agent is described.
We have seen the concomittant regression of BIP and onset of focal eosinophilic liver disease (FELD) with eosinophilia. By exclusion diagnosis and thorough pathologic examination, this relationship in time led to the hypothesis of eosinophilic migration. Our understanding of the pathogenesis of BIP is mainly based on data derived from animal studies. Endothelial damage of the lung vasculature by bleomycin-induced free radicals is associated with an acquired loss of bleomycin hydrolase activity and followed by an influx of inflammatory cells [8]. There is a significant correlation between eosinophilia and bleomycin-induced pulmonary fibrosis [9, 10]. Apart from T-lymphocytes, eosinophils are key players in the production of tumor growth factor-β, platelet-derived growth factor receptor-α and tumor necrosis factor-α, leading to proliferation and accumulation of fibroblasts. On their turn, fibroblasts produce chemotactic cytokines recruiting eosinophils [11, 12]. The trigger for the ...
Lung fibrosis (LF) is a chronic and progressive lung disease characterized by pulmonary parenchyma progressive lesion, inflammatory infiltration, and interstitial fibrosis. It is developed by excessive collagen deposition and other cellular matrix components, resulting in severe changes in the alveolar architecture. Considering the absence of effective treatment, the aim of this study was to investigate the effect of photobiomodulation therapy (PBMT) on the development of PF. For this purpose, we used C57BL6 mice subjected to induction of LF by bleomycin administration (1.5 U/kg) by orotracheal route and, after 14 days of the induction, mice were treated with PBMT applied to the thorax 1×/day for 8 days (wavelength 660 ± 20 nm, power 100 mW, radiant exposure 5 J/cm2, irradiance 33.3 mW/cm2, spot size 2.8cm2, total energy 15 J, time of irradiation: 150 s) and inflammatory and fibrotic parameters were evaluated with or without PBMT. Our results showed that PBMT significantly reduced the number ...
Suitable animal models of IPF are lacking (Roman et al. 2013) and have been identified as a research priority for the IPF field (White et al. 2016). In our attempt to elucidate the efficacy of GBT1118 drug effects were explored in the most commonly used animal model of lung fibrosis: the bleomycin‐induced model. The results from this in vivo therapeutic study provide support for the potential use in IPF of a molecule that increases Hb-O2 affinity. GBT1118 treatment not only restored arterial O2 to normal levels, but also significantly inhibited the increase in numbers of inflammatory cell infiltrates, reduced collagen in BALF, and resulted in an approximately 50% reduction in fibrosis (histopathological changes in lung tissue). Additionally, GBT1118 administration ameliorated the loss of body weight associated with bleomycin exposure.. Exertional dyspnea and worsening hypoxia associated with hypoxemia are prominent clinical features of IPF progression as fibrosis increases and ...
Bleomycin A complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2. It inhibits DNA metabolism and is used as an antineoplastic, especially for solid tumors ...
Bleomycin is a chemotherapeutic drug used in combination with two others to treat Kaposis sarcoma (KS) when it does not respond to standard treatment. It is also used to treat other forms of cancer.
Blenoxane - What are effects from the bleomycin? Lung function... An important side effect to be aware of with bleomycin is its effects on lung function. Most oncologists will perform pulmonary function tests (pfts) before administration of bleomycin in order to obtain a baseline. During therapy the pfts will be repeated to monitor for a decrease in lung function. If this occurs, sometimes the dosing of bleomycin will be changed or it will be stopped altogether.
Introduction: In a Phase II clinical trial, 12 months treatment with nintedanib (BIBF 1120) reduced the rate of decline in FVC in patients with idiopathic pulmonary fibrosis (IPF) by 68.4% versus placebo, which approached statistical significance.. Aim: To explore its mode of action, nintedanib was tested in a preventive and therapeutic mouse model of lung inflammation and fibrosis.. Methods: Lung fibrosis was induced in mice by a single intratracheal administration of bleomycin. Nintedanib was administered by gavage q.d. at 30 mg/kg or 60 mg/kg from day 0 to day 14 (preventive treatment) or from day 7 to 21 (therapeutic treatment).. Results: After 14 days, bleomycin caused increased macrophages and lymphocytes in the BALF and elevated IL-1β, TIMP-1 and collagen levels in the lung. Histology revealed chronic inflammation and fibrosis. At day 21, the pathology was very similar to day 14, but histology revealed slightly increased inflammation and fibrosis and TIMP-1 levels were nearly doubled. ...
Regarding specific causal agents, bleomycin has the strongest association with RP. In a study of 395 patients with good-risk nonseminomas randomized to receive 4 cycles of etoposide and cisplatin with (BEP) or without bleomycin (EP), 8% of patients in the BEP arm developed acute RP compared with none in the EP arm.23 Vinblastine and cisplatin have also been implicated as contributing to this toxicity.15-18 For example, higher rates of digital ischemia were identified in patients treated with cisplatin compared with those who were not (41% vs. 21%).14 The cumulative dose of chemotherapy and the prevalence of conventional risk factors for peripheral arterial disease, such as hypertension or smoking, may also play a role.15,16. In vitro studies and laboratory findings further support a direct mechanism of cardiovascular disease through chemotherapy-induced endothelial dysfunction. For example, exposure of endothelial cells to cisplatin or bleomycin in vitro leads to endothelial cell cytokine ...
Abnormal repair and dysregulated angiogenesis have been implicated in the pathogenesis of pulmonary fibrosis, but the underlying mechanisms of regulation are not well understood. The present study investigated the role of phosphatidylinositol-3-kinase (PI3K)/Akt in fibrogenesis of human lung fibroblasts and its regulation by reactive oxygen species (ROS). Exposure of lung fibroblasts to bleomycin,
Hey everyone so yesterday I was looking forward to my second shot of bleo since Ive had a pretty bad time with week 1 nausea and thought the bleo would be easier on my body. Boy was I wrong! I ended up in the ER with 102.8 fever and antibiotics. My WBC was 1.7. Needless to say Im not looking forward to
Hello, So, Im on the first week of my first of 3XBEP and i was trying to remember something the oncologist told me before starting. Before starting i was a fairly frequent cannabis smoker and i cant remember if it is prohibited to smoke (he was refering to tobacco) during the treatment or during AND
So as to far better fully grasp the toxic response of some cell types to L action, we wished to examine the influence on the various elements of L and whether or not every one of the adverse consequences of L expression are resulting from the endonuclease exercise. Induction of double stranded DNA breaks has become observed with all the expression of the two full length L and L ORF . For the reason that scientific studies about the splicing of L mRNA show that lots of cells express a splice product capable of expressing only L ORF , we measured the impact of the two L and L ORF inside a cellular proliferation assay . A zeocin resistanceexpressing plasmid, in conjunction with L associated or manage plasmids are cotransfected. These transfected cells are then picked with zeocin, to be sure that only cells transfected with L are assayed, followed by a quantification of viable cells. Consequently, something that prospects to cell death, or alters the cellular proliferation fee, will likely be ...
Sack: Cell Media with Selection Agents (Blasticidin, Zeocin, Geneticin),Cell Media with Selection Agents (Blasticidin, Zeocin, Geneticin)]] [http://openwetware.org/images/8/84/Cell_Media_with_Gen_Selection_Agents_4-5-2012.pdf .],br ...
Cell Media with Selection Agents (Blasticidin, Zeocin, Geneticin),Cell Media with Selection Agents (Blasticidin, Zeocin, Geneticin) 04/05/12]] [http://openwetware.org/images/2/27/Cell_Media_with_Gen_Selection_Agents_4-5-2012.docx .],br ...
Do not become pregnant while taking this medicine. Women should inform their doctor if they wish to become pregnant or think they might be pregnant. There is a potential for serious side effects to an unborn child. Talk to your health care professional or pharmacist for more information. Do not breast-feed an infant while taking this medicine.. ...
Sgrifennir tudalennau Wicipedia ar bwnc iechyd er mwyn rhoi gwybodaeth sylfaenol, ond allen nhw ddim rhoir manylion sydd gan arbenigwyr i chi. Mae llawer o bobl yn cyfrannu gwybodaeth i Wicipedia. Er bod y mwyafrif ohonynt yn ceisio osgoi gwallau, nid ydynt i gyd yn arbenigwyr ac felly maen bosib bod peth or wybodaeth a gynhwysir ar y ddalen hon yn anghyflawn neun anghywir. Am wybodaeth lawn neu driniaeth ar gyfer afiechyd, cysylltwch âch meddyg neu ag arbenigwr cymwys arall! ...
Examples were given of chemical activation via radical dependent mechanisms and their pharmacologic and toxicologic implications were discussed. Studies were conducted using bleomycin-A2 (11116317) and butylated-hydroxytoluene (128370) (BHT). Bleomycin-A2, a glycopeptide antibiotic used in chemotherapy, is activated in the presence of iron and reactive oxygen species to an intermediate which can c
The mechanisms underlying the pathogenesis of idiopathic pulmonary fibrosis (IPF) involve multiple pathways, such as inflammation, epithelial mesenchymal transition, coagulation, oxidative stress, and developmental processes. The small GTPase, RhoA, and its target protein, Rho-kinase (ROCK), may interact with other signaling pathways known to contribute to pulmonary fibrosis. This study aimed to determine the beneficial effects and mechanisms of fasudil, a selective ROCK inhibitor, on bleomycin-induced pulmonary fibrosis in mice. Our results showed that the Aschcroft score and hydroxyproline content of the bleomycin-treated mouse lung decreased in response to fasudil treatment. The number of infiltrated inflammatory cells in the bronchoalveolar lavage fluid (BALF) was attenuated by fasudil. In addition, fasudil reduced the production of transforming growth factor-β1 (TGF-β1), connective tissue growth factor (CTGF), alpha-smooth muscle actin (α-SMA), and plasminogen activator inhibitor-1 (PAI-1)
Compared to younger patients, patients over 60 years of age with HL have significantly inferior outcomes. Older HL patients are not only more likely to have risk factors associated with poor prognosis, such as B symptoms, mixed cellularity type, or poor performance status, but a major reason for their poor outcomes is reduced tolerability of treatment.2,3 In the North American Intergroup Study, overall treatment-related mortality was 9% for patients over 60 compared with 0.3% for younger patients. Furthermore, bleomycin lung toxicity was observed in 43% of older patients treated with ABVD, which is significantly higher than expected for younger patients.3 The German Hodgkin Study Group (GHSG) reported a similar experience in the HD10 and HD11 studies, in which patients 60 years and older receiving 4 cycles of ABVD experienced substantial dose reductions, delays, toxicity, and treatment-related toxicity.4 As a result, treatment approaches for older HL patients vary. Some fit patients are treated ...
To examine the effects of bleomycin A5 on infantile maxillofacial haemangiomas. Bleomycin A5 was given by multiple intralesinoal injections and the dosage was given according to the age of the patient and size of the lesion. Parts of patients were accompanied by prednisone treatment(2-5 mg/kg, po, QOD. All the haemangiomas involuted completely after treated with bloemycin A5 with better recovery of skin color and less scar forming in small haemangiomas. Infantile haemangioma could be effectively treated with bleomycin A5 without serious side effects.
1JIE: The 1.6-A crystal structure of the copper(II)-bound bleomycin complexed with the bleomycin-binding protein from bleomycin-producing Streptomyces verticillus.
Micronucleus (MN) assay is a well standardized approach for evaluation of clastogenic/aneugenic effects of mutagens. Fluorescence in situ hybridization (FISH) is successfully used to characterize the chromosomal content of MN. However, the relationships between nuclear positioning, length, and gene density of individual chromosomes and their involvement in MN induced by different mutagens have not been clearly defined. Chromosomal content of MN was characterized in human leukocytes treated with mitomycin C (MMC) and bleomycin (BLM) by FISH using centromeric (cep) and whole-chromosome painting (wcp) probes. Involvement of chromosomes 8, 15 and 20 in MMC-induced and chromosomes 1, 9 and 16 in BLM-induced MN was studied, and correlated with chromosome size, gene density and interphase position. The results obtained were analyzed together with previous own data on the frequencies of inclusion of chromosomes 3, 4, 6, 7, 9, 16, 17, 18, and X in MMC-induced MN. It could be shown that MMC- and BLM-induced MN
Radiologic findings after EP/ECT of large hepatic vessels and hepatic parenchyma were characterized in a porcine model, which was selected due to anatomical and physiological similarities with the human liver.1, 33 The results showed decreased perfusion in the treated area. This finding was an anticipated result since EP/ECT induces a local blood flow modifying effect or vascular lock characterized by the vasoconstriction and increased wall permeabilization of small blood vessels. The effect on perfusion is shorter in EP compared to that in ECT and shorter in healthy compared to tumor tissue, which is known as the vascular disrupting effect. Chemotherapeutic drugs are cytotoxic to endothelial cells, especially neoplastic endothelial cells, and this effect prolongs decreased perfusion.34, 35, 36, 37, 38, 39, 40, 41 In our case, there was no difference between EP and ECT, and no vascular disrupting effect was observed in healthy hepatic parenchyma28, which confirms that bleomycin at the doses ...
Montoto, S.; Camos, M.; Lopez-Guillermo, A.; Bosch, F.; Cervantes, F.; Blade, J.; Esteve, J.; Cobo, F.; Nomdedeu, B.; Campo, E.; Montserrat, E., 2000: Hybrid chemotherapy consisting of cyclophosphamide, vincristine, procarbazine, prednisone, doxorubicin, bleomycin, and vinblastine (C-MOPP/ABV) as first-line treatment for patients with advanced Hodgkin disease
Sigma-Aldrich offers abstracts and full-text articles by [Yoon Hee Cho, Joong Won Lee, Hae Dong Woo, Sunyeong Lee, Yang Jee Kim, Younghyun Lee, Sangah Shin, Hyojee Joung, Hai Won Chung].
The role of the immune response in lung fibrosis and its potential as therapeutic target are not clearly established. Here, we provide evidence for a functional contribution of Fra-2-expressing macrophages to the paracrine activation of fibroblasts and to lung fibrosis (Figure 8F). We identify ColVI as a Fra-2 transcriptional target in macrophages and unravel a profibrogenic role for ColVI in vitro and in vivo. Importantly, inhibiting Fra-2/AP-1 or ColVI is therapeutically relevant in mouse models of lung fibrosis.. The fibrotic phenotype in the Fra-2Tg model of fibrosis is reminiscent of a type 2 cytokine-driven disease with enhanced IL-4 expression, IL-4 pathway signature, eosinophil/neutrophil infiltration, and M(IL-4) macrophage enrichment (25, 28, 46). The contribution of type 2 cytokines, IL-4 and IL-13, to macrophage activation and fibrosis development in different organs is well accepted (4, 47, 48). Lung-specific expression of these cytokines increases after bleomycin treatment, ...
DNA damaging agents such as the antitumor drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA. Amongst these is base-loss which forms apurinic/apyrimidinic (AP) sites or strand breaks with atypical 3termini. DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3terminus of DNA strand breaks ...
Bleomycin is used in the treatment of Cervical cancer, Cancer of mouth, nasopharynx and paranasal sinuses, larynx, oesophagus, Skin cancer. View Bleomycins uses, side-effects, drug interactions, expert advice and user FAQs only on 1mg.com.
Naprobleo (15 mg) 15mg/1vial - 1Vial Injection (Bleomycin) drug information. Find its price or cost, dose, when to use, how to use, side effects, adverse effects, substitutes. It is manufactured by Miracalus Pharma Pvt Ltd.
This study was designed to investigate the effect of particulate matter with a diameter of ≤2.5 μm (PM2.5) on bleomycin (BLM) induced pulmonary fibrosis. Thirty-two Sprague Dawley rats were assigned into four groups (intratracheal instillation of 500 μL of PBS (control), 2 mg/kg PM2.5, 3.5 mg/kg BLM A5, and BLM plus 2.0 mg/kg PM2.5) and were fed for 14 days. All rats were sacrificed after the study. Lung tissues and bronchoalveolar lavage fluid were prepared for histological and biological analysis. We found that PM2.5 caused dose-trend pulmonary alveolitis and fibrosis. Histological scores, expression of α-SMA and Collagen I as well as contents of TNF-α and IL-6 in lung tissues were upregulated by treatment of PM2.5. PM2.5 did not change the percentage of neutrophils and macrophages. The expression of endoplasmic reticulum (ER) stress markers Chop and GRP78 was upregulated by treatment of PM2.5. In comparison with either PM2.5 or BLM treatment, BLM plus PM2.5 treatment induced higher ...
Impact of dose reductions of bleomycin and vincristine in patients with advanced Hodgkin Lymphoma treated with BEACOPP polychemotherapy: A comprehensive analysis of the German Hodgkin Study Group (GHSG) HD12 and HD15 ...
Murata Official product details information. Here are the latest datasheet, appearance & shape, specifications, features, applications, product data of Ferrite Beads/Frequency Specified Filters BLE32PN300SH1(BLE32PN300SH1B,BLE32PN300SH1K,BLE32PN300SH1L).Specifications:Shape=SMD,Size Code (in mm)=3225,Size Code (in inch)=1210,Length=3.2mm,Length Tolerance=±0.2mm,Width=2.5mm,Width Tolerance=±0.2mm,Thickness=2.0mm,Thickness Tolerance=±0.2mm,Impedance (at 100MHz)=30Ω,Impedance (at 100MHz) Tolerance=±10Ω,Rated Current (at 85℃)=10A,Rated Current (at 125℃)=10A,DC Resistance(max.)=1.6mΩ,Operating Temperature Range=-55℃ to 125℃,Mass(typ.)=0.08g,Number of Circuit=1,Automotive Usage=Powertrain/Safety
Airway inflammation: Bleomycin-induced pulmonary fibrosis, COPD. We also study obstructive sleep apnea symptoms (OSA) and bronchospasm
Full Title IIT (CA209-447): Phase I/II of Nivolumab and A(B)VD in the Front-line Setting for Hodgkin Lymphoma Purpose The standard treatment for newly diagnosed high-risk Hodgkin lymphoma is chemotherapy with doxorubicin (Adriamycin), bleomycin, vinblastine, and dacarbazine (ABVD). Patients over age 60 receive this therapy without bleomycin (AVD) to reduce side effects.
GT:ID BAD55372.1 GT:GENE BAD55372.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 543234..543653 GB:FROM 543234 GB:TO 543653 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55372.1 LENGTH 139 SQ:AASEQ MSSKMIFINLPVRELSRSKDFYQALGWKLNEDFTDDNAACIVVDDNICLMLLTRQYFQTFTKRPVAETTGATGAAYALSLGSAAEVDALTEAALAAGGSEEVNEDKRAQEAEVGMHGRTFLDPDGHQWEPFWMDYPGGA GT:EXON 1,1-139:0, SEG 66-,85,aettgatgaayalslgsaae, RP:PDB:NREP 1 RP:PDB:REP 4-,132,3e5dA,2e-08,15.6,122/122, HM:PFM:NREP 1 HM:PFM:REP 8-,129,PF00903,1.3e-06,22.6,115/128,Glyoxalase, RP:SCP:NREP 1 RP:SCP:REP 4-,129,1sp9A,4e-09,7.3,123/362,d.32.1.3, HM:SCP:REP 1-,134,1tsjA_,1.2e-20,31.5,127/0,d.32.1.7,1/1,Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase, OP:NHOMO 108 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- ...
Labeled free bases could be detected chromatographically after reaction of deoxyribonucleic acid with high concentrations of the antibiotic bleomycin. Thymine, adenine, guanine, and cytosine were released from DNAs previously labeled in the base moiety with each of the four bases. No detectable amounts of nucleosides, nucleotides, deoxyribose, deoxyribose phosphate, or inorganic phosphate were released.. ...
Bleomycin sulfate (15.0 mg/ml) No breakthrough up to 240 minutes Busulfan (6.0mg/ml) No breakthrough up to 240 minutes Carboplatin (10.0mg/ml) No breakthrough up to 240 minutes Cisplatin (1.0 mg/ml) No breakthrough up to 240 minutes Cyclophosphamide (20.0 mg/ml) No breakthrough up to 240 minutes Cytarabine HCL (100.0 mg/ml) No breakthrough up to 240 minutes Dacarbazine (10.0 mg/ml) No breakthrough up to 240 minutes Daunombicin HCL (5.0 mg/ml) No breakthrough up to 240 minutes Docetaxel (10.0 mg/ml) No breakthrough up to 240 minutes Doxorubicin HDC (2.0 mg/ml) No breakthrough up to 240 minutes Ellence (Epirubicin) (2.0 mg/ml) No breakthrough up to 240 minutes Etoposide (20.0 mg/ml) No breakthrough up to 240 minutes Fludarabine (25.0 mg/ml) No breakthrough up to 240 minutes Fluorouracil (50.0 mg/ml) No breakthrough up to 240 minutes Gemcitabine (38.0 mg/ml) No breakthrough up to 240 minutes Idarubicin (1.0 mg/ml) No breakthrough up to 240 minutes Ifosfamide (50.0 mg/ml) No breakthrough up to 240 ...
Cervical cancer refers to cancer of cervix. It is treated through surgery, radiation and chemotherapy. Drugs used for treatment include cisplatin, ifosfamide, fluorouracil, paclitaxel, topotecan hydrochloride, bevacizumab and bleomycin sulfate. HPV vaccines provide immunity against the disease. Read on to find more.
This phase III trial studies how well active surveillance, bleomycin, carboplatin, etoposide, or cisplatin work in treating pediatric and adult patients with germ cell tumors. Active surveillance may help doctors to monitor subjects with low risk germ cell tumors after their tumor is removed. Drugs used in chemotherapy, such as bleomycin, carboplatin, etoposide, and cisplatin, work in different ways to stop the growth of tumor cells, either by killing the cells, by stopping them from dividing, or by stopping them from spreading.. ...
He concluded that JNK1 ablation from lung epithelial cells almost completely protects against TGF-β1 or bleomycin-induced fibrosis and delayed JNK1 ablation prevents further enhancement of fibrosis. This demonstrates the crucial role for epithelial-based JNK1 activation in the development of the fibrogenic response, a part of EMT (epithelial mesenchymal transformation). He then went on to dicuss the utility of micro RNA analysis to understand the specific signaling pathways involved in these responsed. He found that JNK1 / Smad 3 regulates Let-7g miRNA expression and that Let-7 miRNA expression is down regulated in vivo following TGF-b1 expression. This is very novel information and the data was quite convincing. The future plans for his lab include determining whether lack of EMT in the absence of JNK1 or SMAD3 is overcome by expression of let-7g anti-miRNA inhibitor. This would be a significant outcome for future clinical trials. His methods were clear and extremely interesting, this ...
Presentation of Hodgkin lymphoma (HL) is distinctive in the infected individual being more advanced, accompanied by B symptoms and the presence of extranodal disease particularly lymphadenopathy of the head and neck. Bone marrow involvement may be found in over 50% of cases. Virtually all co express gamma-herpesvirus. Phenotypically there is prominence of the mixed-cellularity and lymphocyte depleted histopathologic subtypes that define an aggressive clinical course in comparison to other variants. Prior to the induction of cART, median survival was only 1-2 years. Notably the first chemotherapy trial using ABVD (doxorubicin, bleomycin, vinblastine, and dacarbazine) in 21 patients, without treating the viral infection, resulted in a 43% complete remission rate accompanied by severe haematological toxicities but did not extend median survival with this being 1.5 years matching the negative cases. Significant change accompanied concomitant anti-retroviral therapy that could be given safely even ...
After 24 hrs,EGFP-expressing cells have been picked in Asarylaldehyde the presence of 1 mg/mL G418 and colonies have been expanded.EGFP virus was harvested in the PT67 cells and put to use to infect 231-BR cells.The following day,231-BR cells had been selected within the presence of 0.8 mg/mL G418.EGFPexpressing cells had been then co-transfected with pCMV4.HER2 fulllength human cDNA and pSVzeo to confer antibiotic resistance.The sequence in the HER2 insert in pCMV4.HER2 was confi rmed by sequencing.Secure colonies had been picked during the presence of 0.750 mg/mL zeocin.A vector management cell line was simultaneously established by transfecting both pCMV4 that lacked inserted cDNA and pSVzeo in to the 231-BR-EGFP cells and deciding on secure colonies during the presence of 0.750 mg/mL zeocin.The 231-BR cells that had been transfected with vectors that contained or lacked the HER2 cDNA were maintained in Dulbeccos modifi ed Eagle Medium supplemented with 10% fetal bovine serum and 1% ...
Due to inconsistencies between the drug labels on DailyMed and the pill images provided by RxImage, we no longer display the RxImage pill images associated with drug labels. We anticipate reposting the images once we are able identify and filter out images that do not match the information provided in the drug labels. ...
Vurdering av hudens fuktighet med et Corneometer som hovedparameter, vurdering av barriere-funksjon med et Vapometer som sekundært parameter. Deltakerne vasket sine underarmer med såpe 2 timer før målingene ble utført. Utgangsmålinger ble gjort med intrumentene. Bio-Oil og en referanseolje ble deretter applisert på ulike steder på undersiden av underarmen hos alle deltakere. Det ble gjort nye målinger igjen umiddelbart etter applisering av produktet samt 2 timer senere, både før og etter at produktene ble tørket av. Et ubehandlet kontrollområde ble også målt samtidig ...
Vurdering av hudens fuktighet med et Corneometer som hovedparameter, vurdering av barriere-funksjon med et Vapometer som sekundært parameter. Deltakerne vasket sine underarmer med såpe 2 timer før målingene ble utført. Utgangsmålinger ble gjort med intrumentene. Bio-Oil og en referanseolje ble deretter applisert på ulike steder på undersiden av underarmen hos alle deltakere. Det ble gjort nye målinger igjen umiddelbart etter applisering av produktet samt 2 timer senere, både før og etter at produktene ble tørket av. Et ubehandlet kontrollområde ble også målt samtidig ...
Data published online today in Blood, the Journal of the American Society of Hematology (ASH) describe the work of an ASH international clinical network collaborative focused on modernizing treatment protocols for patients ...
... : Cell survival percentage obtained in MTT assay, expressed as survival percentage. (A) CAL27 cells cultured in 3D spherorids or in 2D monolayers when exposed to various concentrations of erlotinib, docetaxel, and bleomycin, for 72 h; and (B) DU145 cells in 3D spheroids or in 2D monolayer when exposed to various concentrations of rapamycin, docetaxel, and camptothecin for 72 h. Data is expressed as mean ± standard deviation based on three independent experiments with triplicate wells for each drug concentration ...
A legislative download is science net inquiry, which recognizes accessed for a bleomycin agents in a germline analysis, is subscribed as the measurability mouse. not the recombination option management is spread hand-collected for its RCMP on the such curve. A fluoride control is updated that can widely present acid of the rule intragroup of a many cytoplasm as index manors.
Moreover, we have previously found that a single intratracheal administration of CSBG can induce mucus hyperplasia, one of the consequences of the Th2 (IL-13)-dominant response and the enhanced phosphorylation of STAT6, one of the pivotal transcriptional factors in the Th2 milieu [42 ...
Kvin-nen som er sik-tet for dra-pet på sin bror i Åm-li er løs-latt. - På høy tid, sier 47-årin-gens for-sva-rer.. - Hun løs-la-tes for-di vil-kå-re-ne for å hol-de hen-ne fengslet ikke len-ger er til ste-de. Po-li-ti-et opp-rett-hol-der sik-tel-sen, sier po-liti-ad-vo-kat Van-ja Bru-voll i Ag-der po-liti-dis-trikt til Fædre-lands-ven-nen.. Den 47 år gam-le kvin-nen og hen-nes 37 år gam-le ekte-mann ble på-gre-pet 14. fe-bru-ar. Kvin-nens 44 år gam-le bror ble sam-me dag fun-net død på ek-te-pa-rets gårds-bruk i Åm-li. Man-nen skal ha blitt drept fle-re uker tid-li-ge-re.. 37-årin-gen har er-kjent å ha skutt svo-ge-ren, men hev-der at det skjed-de i nød-ver-ge. 37-årin-gens kone skal ikke ha vært til ste-de da bro-ren ble drept, men skal ha bi-dratt til å skju-le spor etter dra-pet. - Vi har ikke fått en-de-lig ob-duk-sjons-rap-port og kan ikke si noe sik-kert om hvor-dan man-nen ble drept, sier Bru-voll.. 47-årin-gens for-sva-rer, Sol El-den, opp-ly-ser at hen-nes ...
Bsis Guide Strt Here Commenez ii 1 USB ble users: Do not onnet the USB ble until step A2. Utilisteurs de âble USB : Ne onnetez ps le âble USB vnt l étpe A2. Use this guide to set up the hrdwre nd onnet
Including the modified brentuximab antibody in the treatment regimen improved modified progression-free survival in patients witb Advanced Hodgkin Lymphoma.
Rapporten omfatter resultatet av en inventeringav strandengvegetasjon langsTrondheimsfjorden som ble utført sommeren1973 og som er et ledd i Miljøverndepartementetsarbeid med landsplan for verneverdigenaturområder og ...
Norsk førskolelærerutdanning er i perioden 2008-2010 blitt evaluert av NOKUT på oppdrag fra Kunnskapsdepartementet. Rapportene fra evalueringen ble...
Trifluoperazine (TFP), a member of the phenothiazine class of antipsychotic drugs, has been shown to augment the cytotoxicity of the DNA-damaging agent bleomycin. In the present study, we investigated the effect of trifluoperazine on (a) survival of bleomycin-treated human non-small cell lung carcinoma U1810 cells, (b) induction and repair of bleomycin-induced DNA strand breaks, and (c) nonhomologous end-joining (NHEJ), the major DNA double-strand break (DSB) repair pathway in mammalian cells. By using a clonogenic survival assay, we show here that concomitant administration of trifluoperazine at a subtoxic concentration enhances the cytotoxicity of bleomycin. Moreover, trifluoperazine also increases the longevity of bleomycin-induced DNA strand breaks in U1810 cells, as shown by both comet assay and fraction of activity released (FAR)-assay. This action seems to be related to suppression of cellular DNA DSB repair activities because NHEJ-mediated rejoining of DSBs occurs with significantly ...
Chronic lung diseases including asthma and idiopathic pulmonary fibrosis (IPF) are characterized by the airway inflammation, airway remodeling, subepithelial fibrosis, and hypoxia. Previous study indicated that hypoxia plays a critical role in tissue fibrosis. In chronic asthma and IPF, the CXCR4/CXCL12 (stromal cell-derived factor-1, SDF-1) axis plays important role in pulmonary fibrosis. CXCL12 is a potent chemokine for homing of CXCR4+ fibrocytes to sites of lung tissue injury, which directly contribute to pulmonary fibrosis. Circulating CXCR4+ fibrocytes and CXC12 were found to be significantly increases in both plasma and lung of the patient with pulmonary fibrosis. Moreover, an anti-CXCL12 neutralizing antibody attenuated bleomycin-induced pulmonary fibrosis in mice. In addition, CXCL12 plays an important role in carcinoma-associated fibroblast differentiation. These results suggest that interfering with CXCL12 network may help to block pulmonary fibrosis. There is increasing evidence ...
Pulmonary Fibrosis Symptoms Slideshows: Get information on Pulmonary Fibrosis Symptoms. See Slideshows and learn about all the facts related to Pulmonary Fibrosis Symptoms from our health website Onlymyhealth.com.
Updated analyses based on long-term follow-up of four German Hodgkin Study Group (GHSG) trials (HD7, HD8, HD10, and HD11) in early stage Hodgkin Lymphoma (HL)
Purpose To compare patients with high-risk stage III to IV Hodgkin lymphoma (HL) in the phase III European Organisation for Research and Treatment of Cancer 20012 Intergroup trial (Comparison of Two Combination Chemotherapy Regimens in Treating Patients With Stage III or Stage IV Hodgkins Lymphoma) who were randomly assigned to either doxorubicin, bleomycin, vinblastine, and dacarbazine (ABVD) or to bleomycin, etoposide, doxorubicin, cyclophosphamide, vincristine, procarbazine, and prednisone (BEACOPP). Patients and Methods Patients with clinical stage III or IV HL, International Prognostic Score of 3 or higher, and age 60 years or younger received ABVD for eight cycles (ABVD(8)) or escalated-dose BEACOPP (BEACOPP(escalated)) for four cycles followed by baseline BEACOPP (BEACOPP(baseline)) for four cycles (BEACOPP(4+4)) without radiotherapy. Primary end points were event-free survival (EFS), treatment discontinuation, no complete response (CR) or unconfirmed complete response (CRu) after eight ...
There are three major findings of this study: 1) the i.t. administration of MSC demonstrated both a functional and survival benefit in the mouse model of endotoxin-induced ALI when given 4 h after the administration of LPS; 2) there was a significant histological improvement in the severity of lung injury following MSC administration despite a level of MSC engraftment of ,5% at 48 h after injury; 3) the beneficial effects with MSC appear to be mediated by a shift from a proinflammatory to an anti-inflammatory response to endotoxin.. Previous studies using MSC in lung injury have used only the bleomycin model of lung injury (3, 4). In these studies, the i.v. administration of cells ameliorated the severity of bleomycin-induced injury despite the low engraftment levels seen. This beneficial effect was primarily demonstrated by an improvement in histology, although Rojas et al. (4) did report a significant survival advantage when the MSC were given to bone marrow-suppressed mice. Despite these ...
BACKGROUND: Electrochemotherapy describes the use of electric pulses to enhance chemotherapy uptake, and has proven highly efficient in treating cutaneous metastases. Patients referred for electrochemotherapy present with diverse clinical pictures, from multiple small lesions to large, ulcerated lesions. Post-electrochemotherapy pain has been observed in some patients. The objectives of this study were to evaluate pain scores before and after electrochemotherapy, and to investigate if patients at risk of post-procedure pain could be identified. METHODS: Seven cancer centres in the International Network for Sharing Practices on Electrochemotherapy (INSPECT) consecutively and prospectively reported to a common database. Electrochemotherapy consisted of intratumoural or intravenous injection of bleomycin, followed by delivery of electric pulses in local or general anesthesia. RESULTS: Of 121 patients 39% had metastatic melanoma, 18% squamous cell carcinoma, 16% breast cancer, 13% basal-cell ...
Amara N, Goven D, Prost F, Muloway R, Crestani B, Boczkowski J. NOX4/NADPH oxidase expression is increased in pulmonary fibroblasts from patients with idiopathic pulmonary fibrosis and only nowmediates TGFbeta1-induced fibroblast differentiation into myofibroblasts. Thorax. 2010 Aug;65(8):733-8. Avcuoglu S, Wygrecka M, Marsh LM, Günther A, Seeger W, Weissmann N, Fink L, Morty RE, Kwapiszewska G. Neurotrophic tyrosine kinase receptor B/neurotrophin 4 signaling axis is perturbed in clinical and experimental pulmonary fibrosis. Am J Respir Cell Mol Biol. 2011 Oct;45(4):768-80. Bantsimba-Malanda C, Marchal-Sommé J, Goven D, Freynet O, Michel L, Crestani B, Soler P. A role for dendritic cells in bleomycin-induced pulmonary fibrosis in mice? Am J Respir Crit Care Med. 2010 Aug 1;182(3):385-95. Cigna N, Farrokhi Moshai E, Brayer S, Marchal-Somme J, Wémeau-Stervinou L, Fabre A, Mal H, Lesèche G, Dehoux M, Soler P, Crestani B, Mailleux AA. The hedgehog system machinery controls transforming growth ...
The focus of Dr. Kass lab is Idiopathic Pulmonary Fibrosis (IPF). It is a progressive, scarring of the alveolar parenchyma that ultimately leads to respiratory failure and death. Pathologically, this disease is characterized by the unremitting accumulation of fibroblasts. These are the cells responsible for the deposition of extracellular matrix in pulmonary fibrosis. To gain insight into the pathogenesis of IPF, Dr. Kass colleagues performed gene expression profiling of IPF lungs compared to normal controls. Dr. Kass has focused on the genes that exhibited increased expression in IPF under the rationale that genes that are highly expressed in IPF likely contribute to the development of pulmonary fibrosis. Specifically, the lab has focused on MetAP2 and Twist1. Dr. Kass made the novel insight that the MetAP2 expression is necessary for fibroblast proliferation in vitro and that inhibition of MetAP2 with the drug fumagillin suppresses bleomycin-induced pulmonary fibrosis in mice by selectively ...
Description of disease Idiopathic pulmonary fibrosis. Treatment Idiopathic pulmonary fibrosis. Symptoms and causes Idiopathic pulmonary fibrosis Prophylaxis Idiopathic pulmonary fibrosis
Tumocin (30 mg) 30mg/1Vial - 1Vial Injection (Bleomycin) drug information. Find its price or cost, dose, when to use, how to use, side effects, adverse effects, substitutes. It is manufactured by Neon Laboratories Limited.
ABVD is a chemotherapy regimen used in the first-line treatment of Hodgkin lymphoma, supplanting the older MOPP protocol. It consists of concurrent treatment with the chemotherapy drugs: (A)driamycin (also known as doxorubicin/(H)ydroxydaunorubicin, designated as H in CHOP) (B)leomycin (V)inblastine (D)acarbazine (similar to (P)rocarbazine, designated as P in MOPP and in COPP) As of 2007, ABVD is widely used as the initial chemotherapy treatment for newly diagnosed Hodgkins lymphoma.[citation needed] The other chemotherapy regimen that is widely used in this setting is the Stanford V regimen. One cycle of ABVD chemotherapy is typically given over 4 weeks, with two doses in each cycle (on day 1 and day 15). All four of the chemotherapy drugs are given intravenously. ABVD chemotherapy is usually given in the outpatient setting - that is, it does not require hospitalization. Typical dosages for one 28-day cycle of ABVD are as follows: The total number of cycles given depends upon the stage of the ...
Looking for Idiopathic pulmonary fibrosis? Find out information about Idiopathic pulmonary fibrosis. the formation of an abnormal amount of fibrous tissue in an organ or part as the result of inflammation, irritation, or healing Growth of fibrous connective... Explanation of Idiopathic pulmonary fibrosis
Lung disease models are useful to study how cell engraftment, proliferation and differentiation are modulated in lung bioengineering. The aim of this work was to characterize the local stiffness of decellularized lungs in aged and fibrotic mice. Mice (2- and 24-month old; 14 of each) with lung fibrosis (N=20) and healthy controls (N=8) were euthanized after 11 days of intratracheal bleomycin (fibrosis) or saline (controls) infusion. The lungs were excised, decellularized by a conventional detergent-based (sodium-dodecyl sulfate) procedure and slices of the acellular lungs were prepared to measure the local stiffness by means of atomic force microscopy. The local stiffness of the different sites in acellular fibrotic lungs was very inhomogeneous within the lung and increased according to the degree of the structural fibrotic lesion. Local stiffness of the acellular lungs did not show statistically significant differences caused by age. The group of mice most affected by fibrosis exhibited local ...
Also, the glycopeptide bleomycin is used for the treatment of several cancers including Hodgkin's lymphoma, head and neck ... "Bleomycin". US National Library of Medicine. Retrieved 28 January 2015. Alvin A, Miller KI, Neilan BA (2014). "Exploring the ... Botulinum toxin (from Clostridium botulinum) and bleomycin (from Streptomyces verticillus) are two examples. Botulinum, the ...
BLEOMYCIN 66. PRIMONIDINE TARTRATE 67. BROMHEXINE HYDROCLORIDE 68. BROMOCRIPTINE MESYLATE 69. BUDESONIDE ...
This occurs when bleomycin binds to a metal ion, becomes chemically reduced and reacts with oxygen.[59][3]:87 ... Bleomycin, a glycopeptide isolated from Streptomyces verticillus, also intercalates DNA, but produces free radicals that damage ... Doxorubicin, bleomycin, vinblastine, dacarbazine. ABVD. Non-Hodgkin's lymphoma. Cyclophosphamide, doxorubicin, vincristine, ... Dorr RT (Apr 1992). "Bleomycin pharmacology: mechanism of action and resistance, and clinical pharmacokinetics". Seminars in ...
Bleomycin, surgical excision Cryotherapy being applied to a plantar wart with a cotton swab ...
Examples of the bleomycins in clinical use include bleomycin A2 (also known as bleomycin) and bleomycin A5 (also known as ... "Bleomycin". US National Library of Medicine. Retrieved 5 March 2015. Aouida M, Ramotar D (2010). "A new twist in cellular ... resistance to the anticancer drug bleomycin-A5". Curr Drug Metab. 11 (7): 595-602. doi:10.2174/138920010792927307. PMID ...
Allergic reactions to bleomycin can occur. A small test dose of bleomycin is often given prior to the first round of ABVD to ... Pulmonary function tests are often used to assess for bleomycin-related damage to the lungs. One study found bleomycin lung ... Canellos G, Duggan D, Johnson J, Niedzwiecki D (2004). "How important is bleomycin in the adriamycin + bleomycin + vinblastine ... Pulmonary toxicity, or lung damage, can occur with the use of bleomycin in ABVD, especially when radiation therapy to the chest ...
Applications for treatment of cutaneous and subcutaneous tumors have reached clinical use by utilizing drugs such as bleomycin ... In the clinical use of electrochemotherapy, limited side effects related to bleomycin or cisplatin use are recorded. Provided ... January 2008). "Vascular disrupting action of electroporation and electrochemotherapy with bleomycin in murine sarcoma". Br. J ... bleomycin) or low-permeant drugs (e.g. cisplatin) and applying electric pulses to the area to be treated when the concentration ...
The pulmonary fibrosis produced by paraquat and the antitumor agent bleomycin is also thought to be induced by the pro-oxidant ... These include adriamycin and other anthracyclines, bleomycin, and cisplatin. These agents may show specific toxicity towards ...
Bleomycin was first discovered in 1966. Teicoplanin was discovered in the early 1990s. Telavancin is a semi-synthetic ... and the antitumor antibiotic bleomycin. Vancomycin is used if infection with methicillin-resistant Staphylococcus aureus (MRSA ...
... bleomycin, enediynes, and mitomycin". Chemical Reviews. 105 (2): 739-58. doi:10.1021/cr030117g. PMID 15700963. Zhang, C; ...
Koldamova RP, Lefterov IM, DiSabella MT, Almonte C, Watkins SC, Lazo JS (1999). "Human bleomycin hydrolase binds ribosomal ... "Human bleomycin hydrolase binds ribosomal proteins". Biochemistry. 38 (22): 7111-7. doi:10.1021/bi990135l. PMID 10353821. Zhang ...
Zheng, J; Fang, Y; Cai, BW; Zhang, H; Liu, W; Wu, B; Xu, JG; You, C (Sep 19, 2014). "Intracystic bleomycin for cystic ... There is no high quality evidence looking at the use of bleomycin in this condition.[needs update] The most effective treatment ... or bleomycin delivered via an external reservoir are sometimes employed, especially in young patients. The tumor, being in the ...
Bleomycin ingestion may also cause similar findings. On physical exam, one key difference between the two is that post- ... inflammatory hyperpigmentation changes are usually seen with bleomycin-induced flagellate dermatitis and are not typically ...
... and other related chemicals in the bleomycin family of compounds are primarily used in molecular biology as an ... Gatignol, A., Durand, H. & Tiraby, G. (1988). "Bleomycin resistance conferred by a drug-binding protein". FEBS Lett. 230: 171- ... a glycopeptide antibiotic and one of the phleomycins from Streptomyces verticillus belonging to the bleomycin family of ... "Copper-dependent cleavage of DNA by bleomycin". Biochemistry. 26 (3): 931-42. doi:10.1021/bi00377a038. PMID 2436656. Chankova ...
Twohig KJ, Matthay RA (March 1990). "Pulmonary effects of cytotoxic agents other than bleomycin". Clinics in Chest Medicine. 11 ...
Certain drugs such as amiodarone, bleomycin and methotrexate. As a consequence of another disease such as rheumatoid arthritis ...
Bleomycin List of cutaneous conditions Rapini, Ronald P.; Bolognia, Jean L.; Jorizzo, Joseph L. (2007). Dermatology: 2-Volume ... Scratch dermatitis (also known as "flagellate pigmentation from bleomycin") is a cutaneous condition characterized by linear ...
2004). "Bleomycin-induced scleroderma". The Journal of the Association of Physicians of India. 52: 76-7. PMID 15633728.. ... Bleomycin[33] (a chemotherapeutic agent) and possibly taxane chemotherapy[34] may cause scleroderma, and occupational exposure ...
Treatment with cisplatin, etoposide, and bleomycin has been described. Before modern chemotherapy, this type of neoplasm was ...
Hydrolysis of bleomycin B2 by a Fusarium acylagmatine amidohydrolase". J. Antibiot. 26 (2): 117-119. doi:10.7164/antibiotics. ...
Other cytotoxic antibiotics are anthracyclines, mitomycin C, bleomycin, mithramycin. Antibodies are sometimes used as a quick ...
Pulmonary fibrosis is a classical adverse effect of bleomycin; however, the incidence of pulmonary fibrosis in the brentuximab ... The ECHELON-1 phase 3 trial compared brentuximab vedotin with bleomycin both in combination with adriamycin, vinblastine, ... bleomycin, vinblastine, and dacarbazine) versus brentuximab vedotin in combination with AVD (doxorubicin, vinblastine, and ...
Bleomycin is an antineoplastic antibiotic drug isolated in 1966 from the actinomycete Streptomyces verticillus. Bleomycin forms ... Role of proinflammatory cytokines IL-18 and IL-1beta in bleomycin-induced lung injury in humans and mice. Am J Respir Cell Mol ... Role of proinflammatory cytokines IL-18 and IL-1beta in bleomycin-induced lung injury in humans and mice. Am J Respir Cell Mol ... intratracheal instillation of bleomycin and in transforming growth factor β1 (TGF β1) overexpressing transgenic mice exposed to ...
This occurs when bleomycin binds to a metal ion, becomes chemically reduced and reacts with oxygen. Mitomycin is a cytotoxic ... Bleomycin, a glycopeptide isolated from Streptomyces verticillus, also intercalates DNA, but produces free radicals that damage ... Dorr RT (Apr 1992). "Bleomycin pharmacology: mechanism of action and resistance, and clinical pharmacokinetics". Seminars in ... such as bleomycin and cisplatin), to enter the cancer cells. Hence, greater effectiveness of antitumor treatment is achieved. ...
Lefterov IM, Koldamova RP, Lazo JS (Sep 2000). "Human bleomycin hydrolase regulates the secretion of amyloid precursor protein ...
Pingyangmycin (Bleomycin A5). References[edit]. *^ a b c d e f g h i j k l m n o p q r "Bleomycin Sulfate". The American ... Bleomycin acts by induction of DNA strand breaks.[10] Some studies suggest bleomycin also inhibits incorporation of thymidine ... The peptide/polyketide/peptide backbone of the bleomycin aglycon is assembled by the bleomycin megasynthetase, which is made of ... Biosynthesis of bleomycin is completed by glycosylation of the aglycones. Bleomycin naturally occurring-analogues have two to ...
Bleomycin: learn about side effects, dosage, special precautions, and more on MedlinePlus ... Before taking bleomycin,. *tell your doctor and pharmacist if you are allergic to bleomycin or any of the ingredients in ... You should not become pregnant while you are receiving bleomycin injection. If you become pregnant while receiving bleomycin, ... Bleomycin is a type of antibiotic that is only used in cancer chemotherapy. It slows or stops the growth of cancer cells in ...
Its production by iodination of bleomycin with radioactive iodide ions in the presence of an oxidizing agent is described. ... Radioiodinated bleomycin is a useful imaging agent for body tissues. ... 125 I-bleomycin is stable for at least one month. 123 I-bleomycin has excellent imaging properties and a short half-life (13.3 ... Measurement of Bleomycin Biological Activity. Bacillus subtilis was used as a test organism for measurements of bleomycin ...
Relation to bleomycin. Chest 1985; 88:103.. *Sikdar T, MacVicar D, Husband JE. Pneumomediastinum complicating bleomycin related ... Plasma and pulmonary pharmacokinetics of bleomycin in murine strains that are sensitive and resistant to bleomycin-induced ... Acute pulmonary toxicity of bleomycin: DNA scission and matrix protein mRNA levels in bleomycin-sensitive and -resistant ... Bleomycin is inactivated in vivo by the enzyme bleomycin hydrolase, a cytosolic aminopeptidase that has lower activity in the ...
Peptidase C1B, bleomycin hydrolase (IPR004134). Short name: Peptidase_C1B Overlapping homologous superfamilies *Papain-like ... The unusual active site of Gal6/bleomycin hydrolase can act as a carboxypeptidase, aminopeptidase, and peptide ligase.. Cell 93 ... The unusual active site of Gal6/bleomycin hydrolase can act as a carboxypeptidase, aminopeptidase, and peptide ligase.. Cell 93 ... Studies on the mechanism of antitumor effect of bleomycin of squamous cell carcinoma.. J. Antibiot. 25 409-20 1972 ...
bleomycin synonyms, bleomycin pronunciation, bleomycin translation, English dictionary definition of bleomycin. n. Any of a ... For the bleomycin mouse model, 2 U/kg bleomycin (Nippon Kayaku Co Ltd., Tokyo, Japan) in 20-25 [micro]l phosphate-buffered ... bleomycin. Also found in: Medical, Acronyms, Wikipedia.. Related to bleomycin: cisplatin, doxorubicin ... Bleomycin (BLM) was obtained from Onko Medical Company (Bleocin-S 15 mg, Istanbul, Turkey).. Resveratrol Attenuates Bleomycin- ...
Professional guide for Bleomycin Sulfate. Includes: pharmacology, pharmacokinetics, contraindications, interactions, adverse ... Monitor renal function and adjust the bleomycin dose as needed.. Digoxin, hydantoins (eg, phenytoin) Bleomycin may decrease ... Elimination of bleomycin may be decreased secondary to cisplatin-induced renal dysfunction, increasing the risk of bleomycin ... Do not reconstitute or dilute bleomycin with dextrose 5% in water or any other dextrose-containing diluent. Loss of bleomycin ...
BLEOMYCIN (bleomycin sulfate) injection, powder, lyophilized, for solution. NDC Code(s): 63323-136-10, 63323-137-20 *Packager: ... BLEOMYCIN (bleomycin sulfate) powder, for solution. NDC Code(s): 71288-106-10, 71288-107-20 *Packager: Meitheal Pharmaceuticals ... BLEOMYCIN injection, powder, lyophilized, for solution. NDC Code(s): 61703-323-22, 61703-332-18 *Packager: Hospira, Inc. ... BLEOMYCIN injection, powder, lyophilized, for solution. NDC Code(s): 0409-0323-20, 0409-0332-20 *Packager: Hospira, Inc. ...
... used usually in sulfate form in combination with other drugs to treat certain kinds of cancer.Origin of bleomycin Alteration of ... bleomycin definition: nounAny of a class of antibiotics isolated from the bacterium Streptomyces verticillus, ... bleomycin. ble·o·my·cin. noun. Any of a class of antibiotics isolated from the bacterium Streptomyces verticillus, used usually ... How would you define bleomycin? Add your definition here.. Please enable JavaScript to view the comments powered by Disqus.. ...
Risk of pulmonary toxicity of bleomycin and filgrastim.. Laprise-Lachance M1, Lemieux P2, Grégoire JP3,4. ... We conducted a nested case-control study of patients treated with BEP (bleomycin, etoposide and cisplatin) for germ cell cancer ... To estimate the relative risk of pulmonary toxicity in patients exposed to a bleomycin-based chemotherapy including filgrastim ... add further evidence that the concomitant use of filgrastim might not increase the risk of pulmonary toxicity of bleomycin. It ...
Find patient medical information for Bleomycin Injection on WebMD including its uses, side effects and safety, interactions, ... bleomycin 15 unit solution for injection. color. colorless. shape. No data.. imprint. No data.. This medicine is a colorless, ... bleomycin 30 unit solution for injection. color. colorless. shape. No data.. imprint. No data.. This medicine is a colorless, ... bleomycin 15 unit solution for injection. color. colorless. shape. No data.. imprint. No data.. This medicine is a colorless, ...
Compare bleomycin prices, print discount coupons, find manufacturer promotions and details on available patient assistance ... Bleomycin Prices. This bleomycin price guide is based on using the Drugs.com discount card which is accepted at most U.S. ... Bleomycin Coupons and Rebates. Bleomycin offers may be in the form of a printable coupon, rebate, savings card, trial offer, or ... Bleomycin Prices, Coupons and Patient Assistance Programs. Bleomycin is a member of the antibiotics/antineoplastics drug class ...
Bleomycin hydrolase is an enzyme that in humans is encoded by the BLMH gene. Bleomycin hydrolase (BMH) is a cytoplasmic ... Koldamova, R P; Lefterov I M; DiSabella M T; Almonte C; Watkins S C; Lazo J S (June 1999). "Human bleomycin hydrolase binds ... 1998). "Bleomycin hydrolase is associated with risk of sporadic Alzheimers disease". Nat. Genet. 18 (3): 211-2. doi:10.1038/ ... Zheng W, Johnston SA, Joshua-Tor L (1998). "The unusual active site of Gal6/bleomycin hydrolase can act as a carboxypeptidase, ...
Bleomycin seems to act by interfering with the growth of cancer cells, which are eventually destroyed. Since the growth of ... Bleomycin belongs to the general group of medicines called antineoplastics. It is used to treat several types of cancer, ... Before you begin treatment with bleomycin, you and your doctor should talk about the good this medicine will do as well as the ... Bleomycin is to be administered only by or under the immediate supervision of your doctor. ...
Bleomycin A2 is used as the representative structure for Bleomycin. ... A complex of related glycopeptide antibiotics from Streptomyces verticillus consisting of bleomycin A2 and B2 (B2 CAS # 9060-10 ... DNA cleavage by bleomycin depends on oxygen and metal ions, at least in vitro. It is believed that bleomycin chelates metal ... Bleomycin. ATC Codes. L01DC01 - Bleomycin*L01DC - Other cytotoxic antibiotics. *L01D - CYTOTOXIC ANTIBIOTICS AND RELATED ...
Bleomycin for Injection, USP is available as follows:. NDC 0143-9240-01, 15 units of bleomycin per vial as bleomycin sulfate ... Bleomycin has been shown to be mutagenic both in vitro and in vivo. The effects of bleomycin on fertility have not been studied ... Because of bleomycins sensitization of lung tissue, patients who have received bleomycin are at greater risk of developing ... Bleomycin is inactivated by a cytosolic cysteine proteinase enzyme, bleomycin hydrolase. The enzyme is widely distributed in ...
In this study, we have demonstrated that alveolar macrophages stimulated by bleomycin-induced injury secrete large quantities ... The findings in this study demonstrate that during bleomycin-induced injury, alveolar macrophages not only secrete large ... In a model of pulmonary inflammation and fibrosis induced by the antineoplastic antibiotic, bleomycin, we previously ... Regulation of alveolar macrophage transforming growth factor-beta secretion by corticosteroids in bleomycin-induced pulmonary ...
Patients receiving their total dose of bleomycin at a rate of 25 +/- 2 (S.D.) units/week developed a linear decrease in DLCO ... Changes in FVC did not correlate with bleomycin total dose. Although both the mean DLCO and FVC decreased after completion of ... Of the pulmonary function tests used, the DLCO was shown to be the most sensitive indicator of subclinical bleomycin pulmonary ... Role of single-breath carbon monoxide-diffusing capacity in monitoring the pulmonary effects of bleomycin in germ cell tumor ...
Bleomycin-induced fibrosis is probably the composition of several mechanisms working in sequence and simultaneously. The role(s ... and interaction of the cellular, biochemical, and molecular elements of bleomycin-induced fibrosis are examined. ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
Bleomycin-related pneumonitis (BIP) has recently emerged as one of the main causes of death in Hodgkins disease treated with ... FDG-PET in bleomycin-induced pneumonitis following ABVD chemotherapy for Hodgkins disease--a useful tool for monitoring ... scanning in a patient with Hodgkins disease who developed bleomycin lung toxicity following the 4(th) cycle of chemotherapy. ... standard chemotherapy ABVD (doxorubicin, bleomycin, vinblastine, dacarbazine). We used 18-fluorodeoxyglucose (FDG) positron ...
Bleomycin sulfate forms complexes with iron that reduce molecular oxygen to superoxide and hydroxyl radicals which cause single ... bleomycin sulfas. bleomycin sulphate. bleomycini sulfas. blexane. Foreign brand name:. Blanoxan. Bleo-cell. Bleocin. Bleolem. ... bleomycin sulfate A mixture of the sulfate salts of basic glycopeptide antineoplastic antibiotics isolated from Streptomyces ... Bleomycin sulfate forms complexes with iron that reduce molecular oxygen to superoxide and hydroxyl radicals which cause single ...
Bleomycin-treated rats receiving flaxseed oil had reduced pulmonary septal thickness (,svg style=vertical-align:-0.17555pt; ... Previous work has shown a reduction in bleomycin-induced lung pathology by long-chain omega-3 fatty acids. Treatment by short- ... Lungs were harvested at 2, 7, and 21 days after bleomycin or saline treatment. Animals receiving flaxseed oil showed a delay in ... bleomycin produced a reduction in pulmonary arterial lumen patency (,svg style=vertical-align:-0.17555pt;width:56.150002px; ...
The cytotoxic agent bleomycin is feared for its induction of sometimes fatal pulmonary toxicity, also known as bleomycin- ... were determined in whole lungs of normal and bleomycin-treated rats. Two days after bleomycin treatment total lung SOD, CAT, ... Total lung MDA levels were increased by 17% at 2 and 4 days (p less than .05) after bleomycin treatment, and returned to normal ... The widely used transfer capacity of the lungs for carbon monoxide appeared recently not to be specific when bleomycin is used ...
For patients who lack risk factors for bleomycin lung toxicity, consider using no more than 2 cycles of bleomycin-containing ... In this issue of Blood, Böll et al report on the toxicity of 2 vs 4 cycles of bleomycin-containing chemotherapy in older, early ... Bleomycin in older early-stage favorable Hodgkin lymphoma patients: analysis of the German Hodgkin Study Group (GHSG) HD10 and ... Furthermore, bleomycin lung toxicity was observed in 43% of older patients treated with ABVD, which is significantly higher ...
  • The aim of this study was to assess whether adult mice bearing a smooth muscle cell/fibroblast-specific deletion of CCN2 are resistant to bleomycin-induced skin scleroderma. (nih.gov)
  • In response to bleomycin, wild-type mice possessed, but CCN2-deficient mice lacked, abundant α-SMA-expressing myofibroblasts within fibrotic lesions. (nih.gov)
  • A progressive increase in MMP-2, S100A4, α -SMA, HIF-1 α , ZEB1, CD44, phospho-p44/42 (p-p44/42), and phospho-p38 MAPK (p-p38) protein levels as well as activation of EMT was observed in the lung tissues of bleomycin mice. (hindawi.com)
  • Bleomycin was instilled intranasally into wild-type or PAR-2-deficient mice in the presence/absence of a specific PAR-2 antagonist (P2pal-18S). (springer.com)
  • In our in vivo study in mice, nifedipine prevented bleomycin-induced fibrotic changes (increased lung stiffness, overexpression of smooth muscle actin, increased extracellular matrix deposition, and increased soluble collagen and hydroxyproline content). (nih.gov)
  • Materials and Methods 60 U of bleomycin was instilled into the lungs of 6-8 week old male C57Bl/6 mice. (bmj.com)
  • Results Mice exposed to bleomycin and infected with influenza lost less weight compared with saline-exposed influenza-infected animals. (bmj.com)
  • However, the lungs from bleomycin-exposed, influenza-infected mice showed increased lung damage with more matrix deposition on trichrome staining than saline-exposed, influenza-infected mice. (bmj.com)
  • However, in bleomycin-exposed mice, influenza infection did not promote enhanced BAL lymphocytosis or apoptosis. (bmj.com)
  • However, influenza appeared to enhance the fibrotic response demonstrated by an increase in matrix deposition on masson's trichrome and increased lung hydroxyproline levels in influenza infected bleomycin exposed mice, as early as 5 days post infection. (bmj.com)
  • At MD Biosciences, we have refined the oral aspiration administration to allow for more even distribution of disease throughout both right and left lungs, making bleomycin-induced injury in mice a reliable model for research. (mdbiosciences.com)
  • Mmp-8 steady state mRNA and protein levels increase in whole lung and bronchoalveolar lavage samples when WT mice are treated with bleomycin. (jimmunol.org)
  • Whereas bleomycin-treated Mmp-8 −/− and WT mice have similar lung levels of several pro- and antifibrotic mediators (TGF-β, IL-13, JE, and IFN-γ), Mmp-8 −/− mice have higher lung levels of IFN-γ-inducible protein-10 (IP-10) and MIP-1α. (jimmunol.org)
  • Genetically deleting either Ip-10 or Mip-1 α in Mmp-8 −/− mice abrogates their lung inflammatory response to bleomycin, but reconstitutes their lung fibrotic response to bleomycin. (jimmunol.org)
  • Net collagen synthesis, as assessed by measuring the rate of incorporation of tritiated proline in an organ culture system, was increased above control values in both nude and euthymic mice at 14 days after bleomycin treatment, although these values returned to normal at 30 days. (biomedsearch.com)
  • However, lung collagen synthetic rates, normalized to dry lung weights, were significantly higher at 14 days in euthymic bleomycin-treated control mice than in the nude bleomycin-treated animals. (biomedsearch.com)
  • Mice subjected to intratracheal administration of bleomycin developed significant lung injury. (ersjournals.com)
  • An increase in immunoreactivity to nitrotyrosine, poly(ADP ribose) polymerase (PARP) and inducible nitric oxide synthase as well as a significant loss of body weight and mortality was observed in the lung of bleomycin-treated mice. (ersjournals.com)
  • These results demonstrate that the two peroxisome proliferator-activated receptor-γ agonists, rosiglitazone and 15-deoxy-Δ 12,14 -prostaglandin J 2 , significantly reduce lung injury induced by bleomycin in mice. (ersjournals.com)
  • BALB/c mice (n=30), resistant to bleomycin, were primed with murine gammaherpesvirus 68 and then given intraperitoneal bleomycin. (ersjournals.com)
  • The mice were sacrificed at 28 days after bleomycin and their lungs assessed histologically and biochemically. (ersjournals.com)
  • Similarly mice given both virus and bleomycin showed more lung inflammation (median score 1.9) compared to those given bleomycin (median 0.5), virus (median 0.8), or PBS control (median 0.2). (ersjournals.com)
  • All experiments were performed using bleomycin resistant BALB/c mice aged 5-6 weeks and weighing between 21-29 g. (ersjournals.com)
  • Recombinant human erythropoietin reduces epithelial cell apoptosis and attenuates bleomycin-induced pneumonitis in mice. (wikipedia.org)
  • Some people who have received bleomycin injection for treatment of lymphomas had a severe allergic reaction. (medlineplus.gov)
  • tell your doctor and pharmacist if you are allergic to bleomycin or any of the ingredients in bleomycin injection. (medlineplus.gov)
  • You should not become pregnant while you are receiving bleomycin injection. (medlineplus.gov)
  • For intrapleural administration, dissolve 60 units of bleomycin in 50 to 100 mL of sodium chloride 0.9% injection. (drugs.com)
  • The cost for bleomycin injectable powder for injection 15 units is around $38 for a supply of 1 powder for injection, depending on the pharmacy you visit. (drugs.com)
  • Bleomycin for injection is provided as a sterile, white to off-white, lyophilized cake or powder in vials for intramuscular, intravenous, or subcutaneous administration. (nih.gov)
  • Please read this leaflet carefully before you start using Cipla Bleomycin 15K Powder for injection. (nps.org.au)
  • This leaflet answers some common questions about CIPLA BLEOMYCIN 15K for Injection. (nps.org.au)
  • Your doctor has weighed the risks of you taking CIPLA BLEOMYCIN 15K for Injection against the benefits they expect it will have for you. (nps.org.au)
  • Approximately 15 minutes after the intratumoral injection, patients receive bleomycin IV over 10 minutes. (bioportfolio.com)
  • We conclude that there is no biochemically detectable turnover of mature lung collagen, defined as that pool of lung collagen that is obligatorily extracellular (i.e., crosslinked and containing labeled hydroxylysine from an injection of precursor 5 to 15 wk earlier), in either normal rat lungs or lungs of rats made fibrotic with bleomycin. (osti.gov)
  • The first bleomycin injection was performed in February 2002 ( Fig 1 ). (ajnr.org)
  • It has thus been possible to chelate radioactive isotopes of such metals to bleomycin and thereby produce radioactive agents which can be used to detect and visualize tumors. (google.com)
  • Although 111 In alone will localize tumors to some extent, the results indicate that tumor localization occurs more frequently with 111 In-labeled bleomycin. (google.com)
  • Human lung tumors: SPECT quantitation of differences in Co-57 bleomycin uptake. (nih.gov)
  • The in vivo concentration of intravenously injected bleomycin labeled with cobalt-57 was measured over time in 14 human lung tumors. (nih.gov)
  • Significant differences were found in the uptake of bleomycin by the tumors, even those with the same histologic characteristics, when the concentration over time, the tumor/blood ratio at 30 minutes, and the tumor cumulative concentration were measured in vivo. (nih.gov)
  • The metabolism of bleomycin B 2 in homogenates from benign and malignant human tumors was studied, and all 14 tumors were capable of metabolizing bleomycin to desamidobleomycin B 2 . (aacrjournals.org)
  • Role of single-breath carbon monoxide-diffusing capacity in monitoring the pulmonary effects of bleomycin in germ cell tumor patients. (uptodate.com)
  • Inhibition of this phosphorylation by PI3K inhibitors or by dominant-negative Akt (T308A/S473A) expression abrogated the effects of bleomycin on fibroblast proliferation and collagen production, suggesting the role of PI3K/Akt in the fibrogenic process. (cdc.gov)
  • Activation of PI3K/Akt by bleomycin also led to transcriptional activation and protein expression of hypoxia-inducible factor-la (HIF-1 alpha) and vascular endothelial growth factor, which contributed to the fibroproliferative and collagen-inducing effects of bleomycin. (cdc.gov)
  • The fibrogenic effects of bleomycin were dependent on ROS generation, particularly superoxide anion and hydrogen peroxide, which were induced by bleomycin. (cdc.gov)
  • Inhibition of ROS generation by antioxidant enzymes, catalase and superoxide dismutase mimetic MnTBAP, abrogated the fibrogenic effects of bleomycin as well as its induction of PI3K/Akt and HIF-1 alpha activation. (cdc.gov)
  • In the last few decades, many Americans were diagnosed with Hodgkin's lymphoma and testicular cancer, and a majority received bleomycin as part of their chemotherapeutic regimen. (hindawi.com)
  • A 42 year old man, treated for testicular carcinoma with combination chemotherapy that included bleomycin, developed life threatening interstitial pneumonitis. (bmj.com)
  • It is often given in combination with other drugs (such as bleomycin in treating testicular cancer). (wikipedia.org)
  • MMP-2 protein level has been previously reported to be increased in the lung tissues of bleomycin-treated animals and is preferentially secreted by fibroblasts and epithelial cells [ 8 ]. (hindawi.com)
  • The synthetic cannabinoid prevented fibroblasts activation induced by bleomycin, paralleled by a strong inhibition of TGFβ, CTGF and PDGF-BB expression. (bmj.com)
  • An ultrarapid phase of cellular recovery, as measured in liquid holding type experiments, was studied in stationary-phase human fibroblasts exposed to bleomycin or cobalt-60 γ-irradiation yielding comparable levels of cell killing. (aacrjournals.org)
  • Following intravenous bolus administration of 30 units of bleomycin to one patient with a primary germ cell tumor of the brain, a peak CSF level was 40% of the simultaneously-obtained plasma level and was attained in two hours after drug administration. (nih.gov)
  • DOSE EQUIVALENCE: 1,500 International Units of bleomycin are equivalent to 1.5 USP units and approximately equivalent to 1.5 mg (by potency) or 1 mg (by weight). (eviq.org.au)
  • The rat lung tumor-derived cell lines I149 and R623, with a methylated and unmethylated endogenous p16 gene, respectively were used to determine the effect of bleomycin on transcriptional activity of a 162-bp minimized p16 promoter. (aacrjournals.org)
  • Your doctor will order certain tests to check your body's response to bleomycin. (medlineplus.gov)
  • Using a function blocking anti-RHAMM antibody (R36), we investigated the expression and role of RHAMM in the inflammatory response to intratracheal bleomycin in rats. (nih.gov)
  • Equal protein was loaded from samples obtained from uninjured animals and compared with those from rats given either intratracheal saline or bleomycin. (nih.gov)
  • Three bleomycin-treated rats and two age-matched control rats were sacrificed at the end of each of the 1st, 2nd and 4th weeks of the experiment. (nih.gov)
  • A study was undertaken to investigate the effects of erythromycin (EM) on experimental bleomycin-induced acute lung injury in rats. (bmj.com)
  • This study examined the inhibitory effects of erythromycin in bleomycin-induced lung injury and evaluated the mechanisms of the prophylactic effect of erythromycin on acute lung oedema and neutrophil chemotaxis in rats. (bmj.com)
  • This reaction may occur immediately or several hours after the first or second dose of bleomycin is given. (medlineplus.gov)
  • Bleomycin is widely distributed throughout the body with a mean volume of distribution of 17.5 L/m 2 in patients following a 15 units/m 2 IV bolus dose. (nih.gov)
  • Patients receiving their total dose of bleomycin at a rate of 25 +/- 2 (S.D.) units/week developed a linear decrease in DLCO with increasing total doses of bleomycin. (uptodate.com)
  • Changes in FVC did not correlate with bleomycin total dose. (uptodate.com)
  • The recommended dose and dosing schedule of bleomycin varies according to the specific disease being treated, the response to therapy, and other drugs or treatments being used. (medbroadcast.com)
  • Calculate cumulative bleomycin dose after 6 cycles. (eviq.org.au)
  • The amount of both ultrarapid (within 2 to 10 min) and slower recovery was dose dependent after irradiation with 200 to 800 rads or 30-min exposures to bleomycin (5 to 100 µg/ml). (aacrjournals.org)
  • On day 8, intraperitoneal bleomycin was administered (without sedation), at a dose of 40 mg·kg −1 ·day −1 on alternate days for 3 days (cumulative dose of 120 mg·kg −1 ). (ersjournals.com)
  • One vial (15 U) of bleomycin was dissolved in 15 mL of sterile water. (ajnr.org)
  • As a secondary metabolite, the biosynthesis of bleomycin is precisely controlled by the complex extra-/intracellular regulation mechanisms, it is imperative to investigate the global metabolic and regulatory system involved in bleomycin biosynthesis for increasing bleomycin production. (springer.com)
  • The biosynthesis of the bleomycin aglycon can be visualized in three stages: NRPS-mediated formation of P-3A from Ser, Asn, His, and Ala PKS-mediated elongation of P-3A by malonyl CoA and AdoMet to yield P-4 NRPS-mediated elongation of P-4 by Thr to P-5 that is further elongated by β-Ala, Cys, and Cys to get P-6m. (wikipedia.org)
  • Phosphatidylinositol-3-Kinase/Akt regulates bleomycin-induced fibroblast proliferation and collagen production. (cdc.gov)
  • Results: After 14 days, bleomycin caused increased macrophages and lymphocytes in the BALF and elevated IL-1β, TIMP-1 and collagen levels in the lung. (ersjournals.com)
  • There was a significant difference in collagen content between the bleomycin and virus group (mean 1.86 mg) compared to the belomycin alone group (mean 1.52 mg). (ersjournals.com)
  • We previously established an experimental mouse model for scleroderma by repeated local injections of bleomycin, a DNA damaging agent. (nih.gov)
  • A severe idiosyncratic reaction consisting of hypotension, mental confusion, fever, chills, and wheezing has been reported in approximately 1% of lymphoma patients treated with bleomycin. (nih.gov)
  • OUTLINE: Patients receive bleomycin intratumorally during laparotomy. (bioportfolio.com)
  • Arm I: Patients receive bleomycin intratumorally on day 1. (knowcancer.com)
  • Bleomycin is also used to treat Hodgkin's lymphoma (Hodgkin's disease) and non-Hodgkin's lymphoma (cancer that begins in the cells of the immune system) in combination with other medications. (medlineplus.gov)
  • Bleomycin is rapidly absorbed following either intramuscular, subcutaneous, intraperitoneal or intrapleural administration reaching peak plasma concentrations in 30 to 60 minutes. (nih.gov)
  • Systemic bioavailability of bleomycin is 100% and 70% following intramuscular and subcutaneous administrations, respectively, and 45% following both intraperitoneal and intrapleural administrations, compared to intravenous and bolus administration. (nih.gov)