Halogenated anti-infective agent that is used against trematode and cestode infestations.
Nontoxic laxative vermicide effective for taenia infestation. It tends to produce colic and nausea. It is also used as a veterinary fungicide, anthelmintic, and antiprotozoan. (From Merck, 11th ed.)
Infections with true tapeworms of the helminth subclass CESTODA.
A chlorinated bisphenol antiseptic with a bacteriostatic action against Gram-positive organisms, but much less effective against Gram-negative organisms. It is mainly used in soaps and creams and is an ingredient of various preparations used for skin disorders. (From Martindale, The Extra Pharmacopoeia, 30th ed, p797)
A subclass of segmented worms comprising the tapeworms.
Agents used to treat tapeworm infestations in man or animals.
Tumors or cancer of the OVARY. These neoplasms can be benign or malignant. They are classified according to the tissue of origin, such as the surface EPITHELIUM, the stromal endocrine cells, and the totipotent GERM CELLS.
An inorganic and water-soluble platinum complex. After undergoing hydrolysis, it reacts with DNA to produce both intra and interstrand crosslinks. These crosslinks appear to impair replication and transcription of DNA. The cytotoxicity of cisplatin correlates with cellular arrest in the G2 phase of the cell cycle.
Molecules or ions formed by the incomplete one-electron reduction of oxygen. These reactive oxygen intermediates include SINGLET OXYGEN; SUPEROXIDES; PEROXIDES; HYDROXYL RADICAL; and HYPOCHLOROUS ACID. They contribute to the microbicidal activity of PHAGOCYTES, regulation of signal transduction and gene expression, and the oxidative damage to NUCLEIC ACIDS; PROTEINS; and LIPIDS.
Resistance or diminished response of a neoplasm to an antineoplastic agent in humans, animals, or cell or tissue cultures.
A cell line derived from cultured tumor cells.
Substances that inhibit or prevent the proliferation of NEOPLASMS.
Macrolide antifungal antibiotic produced by Streptomyces nodosus obtained from soil of the Orinoco river region of Venezuela.
A hydroxynaphthoquinone that has antimicrobial activity and is being used in antimalarial protocols.
A biguanide compound which metabolizes in the body to form cycloguanil, an anti-malaria agent.
Two-phase systems in which one is uniformly dispersed in another as particles small enough so they cannot be filtered or will not settle out. The dispersing or continuous phase or medium envelops the particles of the discontinuous phase. All three states of matter can form colloids among each other.
Substances that destroy fungi by suppressing their ability to grow or reproduce. They differ from FUNGICIDES, INDUSTRIAL because they defend against fungi present in human or animal tissues.
Cyclic peptide antibiotic similar to VIOMYCIN. It is produced by Streptomyces capreolus.
Substances intended to be applied to the human body for cleansing, beautifying, promoting attractiveness, or altering the appearance without affecting the body's structure or functions. Included in this definition are skin creams, lotions, perfumes, lipsticks, fingernail polishes, eye and facial makeup preparations, permanent waves, hair colors, toothpastes, and deodorants, as well as any material intended for use as a component of a cosmetic product. (U.S. Food & Drug Administration Center for Food Safety & Applied Nutrition Office of Cosmetics Fact Sheet (web page) Feb 1995)
Methyl, propyl, butyl, and ethyl esters of p-hydroxybenzoic acid. They have been approved by the FDA as antimicrobial agents for foods and pharmaceuticals. (From Hawley's Condensed Chemical Dictionary, 11th ed, p872)
Substances added to pharmaceutical preparations to protect them from chemical change or microbial action. They include ANTI-BACTERIAL AGENTS and antioxidants.
Various mixtures of fats, waxes, animal and plant oils and solid and liquid hydrocarbons; vehicles for medicinal substances intended for external application; there are four classes: hydrocarbon base, absorption base, water-removable base and water-soluble base; several are also emollients.
Procedures for the improvement or enhancement of the appearance of the visible parts of the body.
The branch of surgery concerned with restoration, reconstruction, or improvement of defective, damaged, or missing structures.
The branch of philosophy dealing with the nature of the beautiful. It includes beauty, esthetic experience, esthetic judgment, esthetic aspects of medicine, etc.

Fasciola hepatica infestation as a very rare cause of extrahepatic cholestasis. (1/11)

Fasciola hepatica, an endemic parasite in Turkey, is still a very rare cause of cholestasis worldwide. Through ingestion of contaminated water plants like watercress, humans can become the definitive host of this parasite. Cholestatic symptoms may be sudden but in some cases they may be preceded by a long period of fever, eosinophilia and vague gastrointestinal symptoms. We report a woman with cholangitis symptoms of sudden onset which was proved to be due to Fasciola hepatica infestation by an endoscopic retrograde cholangiography.  (+info)

Slack and Slick K(Na) channels regulate the accuracy of timing of auditory neurons. (2/11)

The Slack (sequence like a calcium-activated K channel) and Slick (sequence like an intermediate conductance K channel) genes, which encode sodium-activated K+ (K(Na)) channels, are expressed at high levels in neurons of the medial nucleus of the trapezoid body (MNTB) in the auditory brainstem. These neurons lock their action potentials to incoming stimuli with a high degree of temporal precision. Channels with unitary properties similar to those of Slack and/or Slick channels, which are gated by [Na+]i and [Cl-]i and by changes in cytoplasmic ATP levels, are present in MNTB neurons. Manipulations of the level of K(Na) current in MNTB neurons, either by increasing levels of internal Na+ or by exposure to a pharmacological activator of Slack channels, significantly enhance the accuracy of timing of action potentials at high frequencies of stimulation. These findings suggest that such fidelity of timing at high frequencies may be attributed in part to high-conductance K(Na) channels.  (+info)

Evaluation of marked rise in fecal egg output after bithionol administration to horse and its application as a diagnostic marker for equine Anoplocephala perfoliata infection. (3/11)

To establish a reliable diagnostic measure for equine Anoplocephala perfoliata infection, the impact of deworming was examined in 12 Thoroughbreds to which bithionol (5-10 mg/kg body weight) was administered and feces were examined by the modified Wisconsin method using sucrose solution. One day after the administration, cestode eggs were detected in previously fecal egg-negative 3 horses and increased in the other 9 horses. The optimum time for post-deworming egg detection was examined in following horses: 17 mares were administered bithionol and 10 mares were used as controls. The fecal egg count was significantly (P<0.01) higher one day after the administration than that on other pre- and post-administration days, while no significant changes occurred in fecal egg count in the controls, demonstrating that one day after bithionol administration is the optimum time for detecting fecal cestode eggs. The diagnostic deworming involving bithionol and fecal examination on the day following administration provides a reliable diagnosis for equine Anoplocephala perfoliata infection.  (+info)

Novel inhibitors complexed with glutamate dehydrogenase: allosteric regulation by control of protein dynamics. (4/11)

 (+info)

Phosphorylation of histone H2AX is a powerful tool for detecting chemical photogenotoxicity. (5/11)

 (+info)

Involvement of autotaxin/lysophospholipase D expression in intestinal vessels in aggravation of intestinal damage through lymphocyte migration. (6/11)

 (+info)

Rapid identification of antifungal compounds against Exserohilum rostratum using high throughput drug repurposing screens. (7/11)

 (+info)

In vitro inhibition of Giardia lamblia and Trichomonas vaginalis growth by bithionol, dichlorophene, and hexachlorophene. (8/11)

Bithionol, dichlorophene, and hexachlorophene, which are used in treating some helminthic infections, killed trophozoites of Giardia lamblia and Trichomonas vaginalis in modified BI-S-33 and Asami media, respectively. Virtually all G. lamblia and T. vaginalis cells were killed within 24 h with a 0.42 mM concentration of these compounds, except that 0.93 mM dichlorophene was required for sterilizing T. vaginalis in the same period. In modified BI-S-33 and Asami media from which bovine and human sera were omitted, respectively, the inhibitory actions of the compounds against in vitro growth of these protozoa were significantly enhanced. Trophozoites of G. lamblia and T. vaginalis could be killed in shorter than 10 min with 0.074 mM dichlorophene and 0.0025 mM hexachlorophene, respectively, in serum-free media. G. lamblia, which was incubated in the complete medium containing dichlorophene, showed a characteristic swelling of the ventral side which led to disruption of the parasite, whereas bithionol caused a thin crack in the cytoplasm of T. vaginalis incubated in Asami medium. The crack appeared to enlarge and result in vacuolization of T. vaginalis. These observations suggest that bithionol, dichlorophene, and hexachlorophene merit further evaluation to ascertain whether they are useful for treatment of giardiasis and trichomoniasis.  (+info)

Combination drug therapy appears a promising approach to overcome drug resistance and reduce drug-related toxicities in ovarian cancer treatments. In this in vitro study, we evaluated the antitumor efficacy of cisplatin in combination with Bithionol (BT) against a panel of ovarian cancer cell lines with special focus on cisplatin-sensitive and cisplatin-resistant cell lines. The primary objectives of this study are to determine the nature of the interactions between BT and cisplatin and to understand the mechanism(s) of action of BT-cisplatin combination. The cytotoxic effects of drugs either alone or in combination were evaluated using presto-blue assay. Cellular reactive oxygen species were measured by flow cytometry. Immunoblot analysis was carried out to investigate changes in levels of cleaved PARP, XIAP, bcl-2, bcl-xL, p21 and p27. Luminescent and colorimetric assays were used to test caspases 3/7 and ATX activity. The efficacy of the BT-cisplatin combination depends upon the cell type and
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
Human skin is a continual target for chemical toxicity, due to its constant exposure to xenobiotics. The skin possesses a number of protective antioxidant systems, including glutathione and enzymic pathways, which are capable of neutralising reactive oxygen species (ROS). In combination with certain chemicals, the presence of ROS might augment the levels of toxicity, due to photoactivation of the chemical or, alternatively, due to an oxidatively-stressed state in the skin which exisited prior to exposure to the chemical. Bithionol is a phototoxic anti-parasitic compound. The mechanism of its toxicity and the possible methods of protection from its damaging effects have been explored. The capacity of keratinocytes to protect themselves from bithionol and other phototoxic chemicals has been investigated. In addition, the potential of endogenous antioxidants, such as vitamin C and E, to afford protection to the cells, has been evaluated. The intracellular glutathione stores of HaCaT keratinocytes ...
Editors choice: Drug repurposing screens using worm and patient fibroblast models of PMM2-CDG led to the discovery of epalrestat, the first activator of PMM2 that targets the root cause of disease. ...
A very rare cause is a condition where too much insulin is produced in short bursts from abnormal tissue in the pancreas (an insulinoma)...
The chemical alteration of an exogenous substance by or in a biological system. The alteration may inactivate the compound or it may result in the production of an active metabolite of an inactive parent compound. The alterations may be divided into METABOLIC DETOXICATION, PHASE I and METABOLIC DETOXICATION, PHASE II ...
The Alliance receives core funding from the Australian Government Department of Health. The National Rural Health Alliance acknowledges Traditional Owners of Country throughout Australia and recognises their continuing connection to lands, waters and communities ...
Hexachlorophene, also known as Nabac, is an organochlorine compound that was once widely used as a disinfectant. The compound occurs as a white odorless solid, although commercial samples can be off-white and possess a slightly phenolic odor. It is insoluble in water but dissolves in acetone, ethanol, diethyl ether, and chloroform. In medicine, hexachlorophene is a useful as a topical anti-infective, anti-bacterial agent, often used in soaps and toothpaste. It is also used in agriculture as a soil fungicide, plant bactericide, and acaricide. In 1972, the U.S. Food and Drug Administration (FDA) halted the production and distribution of products containing more than 1% of hexachlorophene. After that point, most products that contain hexachlorophene were available only by prescription from a doctor. The restrictions were enacted after 15 deaths in the United States and 39 deaths in France were reported following brain damage caused by hexachlorophene. At least three companies manufactured ...
An antiseptic kills the bacteria or prevents the multiplication of bacteria. These also prevent pus formation. Antiseptics do not harm living tissues. Tincture iodine, phenol (0-2%), dettol, chloroxylenol, etc. are applied on skin and bactrim, septran, etc. are taken orally as pills. Bad odour coming out of the wounds due to bacterial decomposition on the body or in the mouth are also reduced by the use of antiseptics.. For such purposes, antiseptics are usually incorporated in face-powder, breath purifiers, deodorants, etc. to reduce the inten-sity of bad odour. Neem soaps containing the extract of neem seeds are also used as antiseptic soaps. Dettol is a mixture of chloroxylenol and terpineol in a suitable solvent is commonly used antiseptic. Bithionol antiseptic is added to soap to provide antiseptic properties to it. Tincture iodine is 2-3% solution of iodine in alcohol and water ...
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
Market research report on drug repurposing service provides with a focus on current market landscape and future growth opportunities
A novel machine-learning technique leverages gene expression data to improve drug repurposing and can even predict new associations based on incomplete data.
Drug repurposing or re-profiling has been the hallmark to bring strong business growth and the trend is being followed by majority of the pharmaceutical an
>Salmonella Typhimurium DT8 was a very rare cause of human illness in Ireland between 2000 and 2008, with only four human isolates from three patients being identified. Over a 19-month period between August 2009 and February 2011, 34 confirmed cases and one probable case of Salmonella Typhimurium DT8 were detected, all of which had an MLVA pattern 2-10-NA-12-212 or a closely related pattern. The epidemiological investigations strongly supported a link between illness and exposure to duck eggs. Moreover, S. Typhimurium with an MLVA pattern indistinguishable (or closely related) to the isolates from human cases, was identified in 22 commercial and backyard duck flocks, twelve of which were linked with known human cases. A range of control measures were taken at farm level, and advice was provided to consumers on the hygienic handling and cooking of duck eggs. Although no definitive link was established with a concurrent duck egg-related outbreak of S. Typhimurium DT8 in the United Kingdom, it seems
Biovista Vizit is a visual exploration tool for biomedical literature based on NCBI PubMed. Vizit allows scientists to search and explore a biomedical domain, such as a disease, a pathway or a gene, and to create biomedical networks and graphs.
A Wyss Institute-led collaboration spanning four research labs and hundreds of miles has used the Institutes organ-on-a-chip (Organ Chip) technology to
Question: Dear Moriel.org I have much appreciation and thanks for the service your site provides to the Church at large. I think your article opposing...
A unique collection of 1154 clinical compounds for high throughput screening (HTS) and high content screening (HCS). • Research areas include anticancer, anti-infection, anti inflammation, nervous disease, and more. • A useful tool for drug repurposing. • Currently in clinical stage, some are withdrawn or terminated. • Structurally diverse, medicinally active, and cell permeable. • Detailed compound information with structure, IC50, and brief introduction. • Validated NMR and HPLC to ensure high purity and quality. • All compounds are in stock and continuously updated. ...
Zamani M, Sharifi Tehrani A, Ali Abadi AA (2007). Evaluation of antifungal activity of carbonate and bicarbonate salts alone or in combination with biocontrol agents in control of citrus green mold. Communications in Agricultural and Applied Biological Sciences. 72 (4): 773-7. PMID 18396809 ...
Preface xvi. Abacacavir (Ziagen) 435. Abacavir + Lamivudine + Dolutegravir (Triumeq) 381. Acyclovir (Zovirax) 442. Adefovir (Hepsera) 187. Albendazole (Albenza) 3. Amikacin (Amikin) 9. Amoxicillan 11. Amoxicillin-Clavulanate (Augmentin, Augmentin 600ES, Augmentin XR) 32. Amphotericin B (Fungizone) 169. Amphotericin B Colloidal Dispersion - ABCD (Amphotec) 13. Amphotericin B Lipid Complex (Abelcet) 1. Ampicillin 15. Ampicillin-Sulbactam (Unasyn) 394. Anidulafungin (Eraxis) 149. Artemether/Lumefantrine (Coartem) 92. Artesunate 27. Atazanavir (Reyataz) 317. Atazanavir + Cobicistat (Evotaz) 152. Atovaquone (Mepron) 240. Atovaquone/Proguanil (Malarone) 230. Azithromycin (Zithromax, Zmax) 437. Aztreonam (Azactam) 40. Bedaquiline (Sirturo) 337. Benznidazole 51. Bithionol (Bitin) 57. Capreomycin (Capastat) 62. Caspofungin (Cancidas) 60. Cefaclor 66. Cefadroxil (Duricef) 135. Cefamandole (Mandol) 232. Cefazolin (Ancef) 18. Cefdinir (Omnicef) 270. Cefditoren Pivoxil (Spectracef) 343. Cefepime (Maxipime) ...
Along the lines that have been discussed in a recent Frontiers short paper, here is a list of our patent discussions in the December 2017 drug repurposing special issue of ASSAY and Drug Development Technologies:. WO/2017/059389 (Kythera Biopharmaceuticals, USA): Statins as an alternative to liposuction and cryolipolysis. WO/2017/060308 (AB Science, France): Masitinib switches to human use. WO/2017/066421 (Ovid Therapeutics, USA): Eplivanserin for improving cognition in psychoses. WO/2017/068143 (Individual, Germany): BAY 11-7082 or dimethyl fumarate for adiposity or cardiovascular diseases. WO/2017/080919 (Freiburg University, Germany): Roflumilast for metabolic lipid disorders. WO/2017/081609 (Individuals): Febuxostat: from gout to neurology. WO/2017/085407 (Pierre et Marie Curie University et al., France): Mirabegron, an overactive bladder drug, for macular degeneration. WO/2017/091644 (AZ Therapies, USA): Cromolyn for cerebral ischemia and dementia. WO/2017/096013 (Cornell University, USA): ...
The platform for pet owners and breeders that contains all the important information at a glance. LABOKLIN has many years of experience with the implementation and development of genetic tests, particularly in the areas of genetic disorders, colour analysis, DNA profiles, ancestry and sex determination in birds. Our high quality standard is characterised particularly by the fact that all the results of our genetic studies are controlled in a second independent test run before they are shipped. ...
Noncyclical breast pain. This type of breast pain is not related to periods and is most common in women aged over 40. Pain can be present all the time, or come and go in a random way. The pain may be in just one breast, and may be localisedtoan area in breast .Reasonof this pain is unknown in most cases, however in few cases it might be due to,muscular or bony problems of the chest wall or Infection .Breast tumours, cancer are very rare cause of breast pain.The symptom of breast cancer is usually a painless lump. Pain is not usually an early symptom. As there are various causes it is best to see a doctor for assessment. What is the treatment for noncyclical breast pain?. NSAIDs such as ibuprofen may ease the pain. Topical NSAIDs may also work. Other treatments may be appropriate, depending on whether a cause is found.. ...
Hexachlorophene is a toxic chemical that induces edema, membrane damage, and increased sodium /decreased potassium in brain cells. (Hexachlorophene was used in shampoos, soaps and other personal care products until about a decade ago.) Rats were fed hexachlorophene orally for 3 weeks, then given Piracetam or one of 5 other drugs by injection for 6 days. Hexachlorophene seriously disrupted the rats ability to navigate a horizontal ladder without frequently falling off the rungs. Piracetam reduced the fall rate 75% compared to saline-injected controls on the first day of treatment. None of the other drugs came close to that improvement. (24). Piracetam increases the survival rate of rats subjected to severe hypoxia. (1,25) When mice, rats and rabbits have been put under diverse experimental hypoxic (low oxygen) conditions, Piracetam has acted to attenuate or reverse the hypoxia-induced amnesia and learning difficulties, while speeding up post-hypoxic recovery time and reducing time to renormalize ...
Daniel Griffin provides a clinical update on COVID-19, then we review an Ad5 vectored SARS-CoV-2 vaccine, reports on remdesivir and hydroxychloroquine, a drug repurposing study, why some patients infect many others, reducing viral transmission, and much more, including listener email.. ...
Steve Braun of Cures Within Reach, a nonprofit focused on breathing new life into old medicines, describes the potential benefits of drug repurposing.. 1 Comment. ...
Steve Braun of Cures Within Reach, a nonprofit focused on breathing new life into old medicines, describes the potential benefits of drug repurposing.. 1 Comment. ...
Find the Q&A between Director of Scientific Consulting, Dr. Maciej Czerwinski, and the editorial team at Outsourcing Pharma for more answers about how DDI testing and data interpretation adds value to the drug repurposing process. ...
Urease is a nickel-dependent amidohydrolase that catalyses the decomposition of urea into carbamate and ammonia, a reaction that constitutes an important source of nitrogen for bacteria, fungi and plants. It is recognized as a potential antimicrobial target with an impact on medicine, agriculture, and the environment. The list of possible urease inhibitors is continuously increasing, with a special interest in those that interact with and block the flexible active site flap. We show that disulfiram inhibits urease in Citrullus vulgaris (CVU), following a non-competitive mechanism, and may be one of this kind of inhibitors. Disulfiram is a well-known thiol reagent that has been approved by the FDA for treatment of chronic alcoholism. We also found that other thiol reactive compounds (l-captopril and Bithionol) and quercetin inhibits CVU. These inhibitors protect the enzyme against its full inactivation by the thiol-specific reagent Aldrithiol (2,2′-dipyridyl disulphide, DPS), suggesting that the three
Abstract Between 1974 and 1985, 10 patients were studied who presented with either gastrointestinal complaints or unexplained peripheral blood eosinophilia, and had eggs typical for N. salmincola recovered from their stools. Clinical findings in 8 of the 10 included increased frequency of bowel movements or diarrhea (6), peripheral blood eosinophilia (6), abdominal discomfort (5), nausea and vomiting (3), weight loss (2), and fatigue (2). Two were asymptomatic. Eight recalled eating fish prior to the onset of symptoms. Anthelminthic treatment consisting of three 2-g doses of niclosamide (2 patients) or two 50 mg/kg doses of bithionol (1 patient) proved effective. In the remaining individuals symptoms resolved slowly over several months.
Findacure has found an innovative way to use this financial tool to fund drug repurposing research for rare diseases. This is the rare disease drug repurposing social impact bond - RDDR SIB for short.. But how would it work?. Our SIB is based on the premise that successfully repurposing low cost generic drugs for rare disease patients will save the NHS money. Rare diseases left untreated cost the NHS lots in surgery, care, appointments, hospital, stays, and much more - a cost that can be significantly reduced by a cheap, repurposed treatment. The NHS can then use a portion of these savings to reimburse Findacure for the cost of the clinical trial. We will use this reimbursement to pay back private investors, whose money was required to initially run the trial. Surplus reimbursement will be invested by us in more clinical trials: the project is self-sustaining and non-profit.. ...
Hexachlorophene is a broad spectrum anti-bacterial agent. It is used in hospital scrubs, shampoos, and deodorants. Once widely used in over-the-counter products, hexachlorophene is now prescription-only, after overdose incidents in infants in France in the 1970s. It has been largely replaced by the related compound Triclosan. ...
The virus is still found in tropical and subtropical areas in South America and Africa and remains a very rare cause of illness in U.S. travelers, according to CDC.
You can manage your cookie settings via your browser at any time. To learn more about how we use cookies, please see our cookies policy. ...
Congenital abnormalities of the cardiovascular system are defects that are present at birth. They can occur as a result of genetic defects, environmental conditions, infections, poisoning, medication taken...
Health officials have confirmed the presence of Exserohilum rostratum in unopened recalled steroid vials from New England Compounding Pharmacy.
The drug repurposing workflow system screens at least 20 bacterial proteomes against this set of proteins that are already being treated against using established drugs. By screening the bacterial proteomes it will be possible to find proteins of highly similar structure to those that are existing drug protein targets and so this will infer that it is highly likely that the drugs can be used as antimicrobials against these proteins of highly similar structure. Proteomes that will be screene ...
CXCL7 (Human) ELISA Kit is a sandwich enzyme-linked immunosorbent assay for quantitative detection of human CXCL7 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA). (KA5605) - Products - Abnova
Comparative Studies on Some Biology and Pathology of Corn and Broom Corn Isolates of Exserohilum turcicum (Pass) Leonard & Suggs ...
From day one, Slack has helped a determined group of volunteers compile the most complete data set in the U.S. for the Covid-19 pandemic.
Slack is where work flows. Its where the people you need, the information you share, and the tools you use come together to get things done.
Authors. Andrew K. Gonsalves, Educational Specialist. Stephen A. Ferreira, Extension Plant Pathologist. Department of Plant Pathology, College of Tropical and Agriculture and Human Resources. University of Hawaii at Manoa. PATHOGENS & HOSTS. Over four Exserohilum species have been reported to occur in Hawaii (Raabe, et al., 1981). The following is a list of the reported pathogens from this genus (Exserohilum) and the hosts they infect. The list is organized by the scientific name of the pathogen species (CAPITAL LETTERS), followed by the various susceptible plant hosts. Words in blue indicate what symptom or disease a given pathogen causes on the listed hosts.. EXSEROHILUM PEDICELLATUM. Leafspot:. corn, maize (Zea mays). EXSEROHILUM ROSTRATUM. Flower Fleck:. Dendrobium sp.. Seedling Blight:. sorghum (Sorghum bicolor). feterita (Sorghum caudatum). EXSEROHILUM SP.. Leafspot:. golden-fruited palm (Chrysalidocarpus lutescens). Manilla grass (Zoysia matrella). ?mascarene grass (Zoysia ...
Insilico Medicine will present its recent advances in applying deep learning techniques to drug discovery and repurposing at the Strategic Partnerships in Drug Repurposing conference in Boston taking place at the Wyndham Boston Beacon Hill Oct. 27-28.
Nearly all the genes in human DNA have two copies, one inherited from the mother and one from the father. There are some genetic diseases where only one copy is normal and the other one is non-functional due to a mistake in the DNA. The idea behind this study was to see if the normal copy can be enhanced to make up for the non-functional copy, said Ali Djalilian, UIC professor of ophthalmology and corresponding author of the paper. Researchers used a mouse model of the human disease aniridia, an eye disorder that affects the iris and causes substantial visual impairment and can also be associated with systemic abnormalities. In aniridia, one copy of the gene PAX6 is normal and the other copy is non-functional. The PAX6 gene is important in eye development and patients with aniridia and PAX6 deficiency are born with eye problems, which limit their vision and can progress throughout life, Djalilian said. The investigators screened drugs that can enhance PAX6 and found a particular class of drugs ...
6:30 pm Reception and Dinner and Remarks by APMRF. June 5, 2017 8:00 am Breakfast. Presentations. There will be opportunities to submit abstracts for talks and the poster session. All submissions are due by April 1, 2017.. Speakers include:. Keynote address by Dr. Thijn Brummelkamp, Genetic studies on the function of NPC1 in pathogen entry and cholesterol trafficking. Dr. Roberto Zonco, Mechanisms of cholesterol sensing by the master growth regulator mTORC1 kinase. Dr. Wei Zheng, Therapeutic development for treatment of NPC: beyond cyclodextrin. Dr. Arun Radikrishnan, Intracellular trafficking routes of cholesterol. Dr. Kenji Ohgane, Identification of Chaperone Drugs for NPC through Drug Repurposing Screening. Dr. Yiannis Loannou, Targeting the Mitochondria-ER-Lysosome axis for the treatment of multiple lysosomal storage diseases. Dr. Charles Vite, Gene therapy in the CNS in large animal models. Dr. Xuntian Jiang, Biomarker discovery and development of diagnostics for early detection of NPC ...
BIONEXT is a French biotechnology company dedicated to the better understanding and treatment of various diseases. BIONEXT aims to accelerate and improve the effectiveness of drug development and biological research by developping programs and software-based tools to tackle problematics of prime importance in the pharmaceutical field, such as drug profile assesment or suggestion of drug repurposing.
We have mapped SARS CoV-2 human Protein-Protein Interactions from A SARS-CoV-2 protein interaction map reveals targets for drug repurposing human drug target interacted with SARS CoV-2 are highlighted in black arrow. ...
Plxna1 (Rat) ELISA Kit is a sandwich enzyme-linked immunosorbent assay for quantitative detection of rat Plexin A1 in cell culture supernates, serum and plasma (heparin, EDTA). (KA5555) - Products - Abnova
A novel double-antigen sandwich enzyme-linked immunosorbent assay (ELISA) was developed to measure rabies antibodies in dogs. G and N protein was synthesized and found to be immunogenic in mice (3), suggesting that the chimeric peptide derived from rabies virus may be used as a diagnostic antigen for detecting rabies antibodies. Iressa Two recombinant plasmids, pGEX4T2/ep and pET32a/ep, were constructed through the in-frame fusion of a chimeric peptide (AVYTRIMMNGGRLKRPPDQLVNLHDFRSDEIEHLVVEE) representing rabies G (amino acids 253 to 275) and N (amino acids 404 to 418) proteins to the C-terminal coding sequence of glutathione = 400) and unvaccinated (= 100) dogs and equally prediluted with sample diluent buffer (phosphate-buffered saline buffer, pH 7.4, including 4% [wt/vol] polyethylene glycol 6000, 3% [wt/vol] NaCl, 0.05% [vol/vol] Tween 20), were added to the wells in duplicate. The negative sera (collected from unvaccinated dogs that tested negative by neutralization test) were added in ...
http://ift.tt/eA8V8J. The northern hemispheres summer is ending and that is definitely bad news. The good news is that this was not a silly season in health and healthcare research.. Heres the best and worst news of the summer.. The best. Drug repurposing screening reveals possible candidates for anti-Zika therapy. Developing a new drug is a long process, but the Zika virus outbreak has created a global health emergency and a pressing need for therapies that is incompatible with the timings of drug development. This led to a major study published in Nature Medicine in which over 6,000 compounds were screened for possible drug repurposing, including approved drugs, clinical trial drug candidates and pharmacologically active compounds. This screening allowed the identification of compounds that were able to inhibit Zika infection, suppress the effects of infection in neurons, or inhibit viral replication. Furthermore, combination treatments using neuroprotective and antiviral compounds showed a ...
The worlds growing knowledge of the virology and clinical presentation of COVID-19 has widened the pool of pharmacological targets. In particular, it has increased interest in drug repurposing to either inhibit SARS-CoV-2 replication or to counteract the effects of a massive cytokine release that causes acute respiratory distress syndrome (ARDS) and coagulopathy. (See Janet Sultana, Challenges for Drug Repurposing in the covid-19 Pandemic Era. Front. Pharmacol., 06 November 2020 , https://doi.org/10.3389/fphar.2020.588654). Geneva based Relief Therapeutics has repurposed aviptadil, a vasoactive intestinal polypeptide (VIP) analog with a 20-year history of safe use in humans in multiple human trials for sarcoidosis, pulmonary fibrosis, asthma/allergy, and pulmonary hypertension. In November 2020, the drug was granted FDA Fast Track Designation, FDA emergency use IND authorization, and an expanded access protocol for the treatment of Respiratory Distress Syndrome (ARDS).. Zurich based Metripharm ...
Here we identify hundreds of new drug-disease associations for over 900 FDA-approved drugs by quantifying the network proximity of disease genes and drug targets in the human (protein-protein) interactome. We select four network-predicted associations to test their causal relationship using large healthcare databases with over 220 million patients and state-of-the-art pharmacoepidemiologic analyses. Using propensity score matching, two of four network-based predictions are validated in patient-level data: carbamazepine is associated with an increased risk of coronary artery disease (CAD) [hazard ratio (HR) 1.56, 95% confidence interval (CI) 1.12-2.18], and hydroxychloroquine is associated with a decreased risk of CAD (HR 0.76, 95% CI 0.59-0.97). In vitro experiments show that hydroxychloroquine attenuates pro-inflammatory cytokine-mediated activation in human aortic endothelial cells, supporting mechanistically its potential beneficial effect in CAD. In summary, we demonstrate that a unique ...
The tapeworms described in this study were retrieved from a young male elephant that died at the Udawalawe Elephant Transit Home in Sri Lanka. Anoplocephala manubriata has very muscular suckers on its scolex which allows it to keep a firm grip on the host intestinal wall. But this is not so great for the elephant - the suction from the tapeworms suckers essentially end up leaving hickeys on the elephants intestinal mucosa, which is not a particularly healthy place for an elephant to get love bites, especially if they have been left there by a bunch of tapeworms. Indeed, the elephant that was necropsied in this study was found to have multiple lesions and ulcers on the gut lining as a result of these parasitic love bites. This tapeworm seems to be far more common among younger elephants than adults, possibly because older elephants have more developed immune systems, and have build up some kind of resistant towards these parasites ...
The tapeworms described in this study were retrieved from a young male elephant that died at the Udawalawe Elephant Transit Home in Sri Lanka. Anoplocephala manubriata has very muscular suckers on its scolex which allows it to keep a firm grip on the host intestinal wall. But this is not so great for the elephant - the suction from the tapeworms suckers essentially end up leaving hickeys on the elephants intestinal mucosa, which is not a particularly healthy place for an elephant to get love bites, especially if they have been left there by a bunch of tapeworms. Indeed, the elephant that was necropsied in this study was found to have multiple lesions and ulcers on the gut lining as a result of these parasitic love bites. This tapeworm seems to be far more common among younger elephants than adults, possibly because older elephants have more developed immune systems, and have build up some kind of resistant towards these parasites ...
Screening with magnetic resonance imaging identified 21% of patients with a spinal or paraspinal infection resulting from a tainted steroid injection, researchers reported in JAMA. A multistate outbreak of fungal meningitis that started in the fall of 2012 was linked to vials of methylprednisolone that were contaminated with Exserohilum rostratum at the New England Compounding Center. Besides
This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Collagen Type IV (COL4) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Macrophage inhibitory cytokine-1 (MIC-1) is a recently described divergent member of the transforming growth factor-ss superfamily. MIC-1 transcription up-regulation is associated with macrophage activation, and this observation led to its cloning. Northern blots indicate that MIC-1 is also present in human placenta. A sensitive sandwich enzyme-linked immunosorbent assay for the ...
Repurposing Drugs in Oncology (ReDO) project by the Anticancer Fund and GlobalCures reporting pre-clinical and clinical evidence for very promising candidates ...
Security researchers have unearthed a concerning vulnerability in Slack that allowed hackers to snatch your token and take control of your account.
Ho provato di aggiornare slackware64-14.0 a 14.1 su una macchina virtuale prima di aggiornare la slack su portatile pero probabilmente non ho configurato bene lilo, e non sono riuscito piu avviarla. Pero almeno ho capito cosa non e chiaro per me per aggiornare la slack a 14.1 su portatile ...
Praziquantel is not effective, and older drugs such as bithionol are moderately effective but also cause more side effects. ... There are also reports of bithionol being used successfully. Nitazoxanide has been found effective in trials, but is currently ... Fasciolicides (drugs against Fasciola spp.) fall into five main chemical groups: Halogenated phenols: bithionol (Bitin), ...
Drugs used to treat infestation include triclabendazole, praziquantel, bithionol, albendazole, levamisole, and mebendazole. ...
The drug of choice to treat paragonimiasis is praziquantel, although bithionol may also be used. Drunken shrimp "Paragonimiasis ...
... and bithionol. Ivermectin, which is widely used for many helminthic parasites, has low effectivity against F. hepatica, as does ...
Other medications can also be used such as bithionol, niclofan, and triclabendazole with high cure rates. Thorough cooking of ...
To obtain the worms from the host, piperazine citrate, levamisole and bithionol can be administered to the patient. ...
Bithionol is an alternative drug for treatment of this disease but is associated with skin rashes and urticaria. For additional ...
100 mg bithionol/kg B.W. or 200 mg bithionol/kg B.W. significantly reduces the numbers of this monogenean on the gills of the ... Ki Hong Kim & Eun Seok Choi evaluated the oral administration of mebendazole or bithionol for the control of Microcotyle ... with oral administration of mebendazole and bithionol". Aquaculture. 167 (1-2): 115-121. doi:10.1016/S0044-8486(98)00300-7. ...
... including bithionol, niclosamide, nicoflan, and Praziquantel. All drugs showed lower prevalence of eggs in feces, however only ...
Three 2-g doses of niclosamide or two 50 mg/kg doses of bithionol have also been effective when praziquantel was either not ...
... unlike the previously used drug bithionol, which required extended treatment and involved more severe side effects. The latest ...
Several compounds of well-known antiprotozoal activity, including niclosamide, oxyclozanide, bithionol sulfoxide, toltrazuril, ...
D10AA01 Fluorometholone D10AA02 Methylprednisolone D10AA03 Dexamethasone D10AB01 Bithionol D10AB02 Sulfur D10AB03 Tioxolone ...
... bithionol (INN) bithionoloxide (INN) bitipazone (INN) bitolterol (INN) bitoscanate (INN) bivalirudin (INN) bivatuzumab ...
Example of such sodium salts are (selection): Bispyribac, bithionol, bosentan, brequinar, bromfenac, Cefmenoxime, ceftiofur, ...
... mucolytic compounds such as L-cysteine ethyl ester and the parasticide bithionol have been tested with some success although ...
On the other hand, there are other antihelminthic drugs available such as bithionol, thiabendazole, metronidazole, and others, ...
The molecular formula C12H6Cl4O2S (molar mass: 356.052 g/mol, exact mass: 353.8843 u) may refer to: Bithionol Tetradifon This ...
... fungicides benzohydroxamic acid benzothiazole fungicides bethoxazin binapacryl biphenyl bitertanol bithionol bixafen ...
QP52AG02 Hexachlorophene QP52AG03 Niclosamide QP52AG04 Resorantel QP52AG05 Rafoxanide QP52AG06 Oxyclozanide QP52AG07 Bithionol ...
P02BA01 Praziquantel P02BA02 Oxamniquine P02BB01 Metrifonate P02BX01 Bithionol P02BX02 Niridazole P02BX03 Stibophen P02BX04 ...
... was formerly used in soaps and cosmetics until the U.S. FDA banned it for its photosensitizing effects. The compound ... Bithionol has two aromatic rings with a sulfur atom bonded between them and multiple chlorine ions and hydroxyl groups attached ... Bithionol is the first known soluble adenylyl cyclase inhibitor to act through the bicarbonate binding site via a mostly ... Bithionol is an antibacterial, anthelmintic, and algaecide. It is used to treat Anoplocephala perfoliata (tapeworms) in horses ...
ഹെക്സാക്ലോറോഫീൻ (Hexachlorophene), ബിഥിയോനോൾ (Bithionol) എന്നിവ ദുർഗന്ധനിവാരിണികൾക്ക് ഉദാഹരണങ്ങളാണ്. പൌഡറിലും പല്ലുതേയ്ക്കുന്ന ...
The official start to its development started in December 1986 when Merck's president, Edward Scolnick, announced that they would start a comprehensive AIDS research program. They started a laboratory dedicated to AIDS research in West Point, Pennsylvania and placed Emilio Emini in charge of the laboratory.[11] A couple months later on January, 1987, a team of researchers consisting of Emilio Emini, Joel Huff, and Irving Sigal, kickstarted their studies by basing their project off of earlier research on the protease enzyme, renin.[5] They were the ones who started the process of research and development into protease inhibitors and its relation to the virus. Over a year later, in July 1988, Nancy Kohl, Emilio Emini, et al., published in the Proceedings of the National Academy of the Science about the idea of inhibiting the protease.[11] On February, 1989, Manuela Navia, Paula Fitzgerald, et al., published a paper that showed the three-dimensional structure of HIV's protease enzyme.[5] Other ...
... is typically used to treat hypothyroidism,[9] and is the treatment of choice for people with hypothyroidism,[10] who often require lifelong thyroid hormone therapy.[11] It may also be used to treat goiter via its ability to lower thyroid-stimulating hormone (TSH), a hormone that is considered goiter-inducing.[12][13] Levothyroxine is also used as interventional therapy in people with nodular thyroid disease or thyroid cancer to suppress thyroid-stimulating hormone (TSH) secretion.[14] A subset of people with hypothyroidism treated with an appropriate dose of levothyroxine will describe continuing symptoms despite TSH levels in the normal range.[11] In these people, further laboratory and clinical evaluation is warranted as they may have another cause for their symptoms.[11] Furthermore, it is important to review their medications and possible dietary supplements as several medications can affect thyroid hormone levels.[11] Levothyroxine is also used to treat subclinical ...
In 2001, the German Federal Institute for Risk Assessment (Bundesinstitut für Risikobewertung, BfR) objected to the addition of isolated theanine to beverages.[39][40] The institute stated the amount of theanine consumed by regular drinkers of tea or coffee is virtually impossible to determine. While it was estimated the quantity of green tea consumed by the average Japanese tea drinker per day contains about 20 mg of the substance, there are no studies measuring the amount of theanine being extracted by typical preparation methods, or the percentage lost by discarding the first infusion. Therefore, with the Japanese being exposed to possibly much less than 20 mg per day, and Europeans presumably even less, it was the opinion of the BfR that pharmacological reactions to drinks typically containing 50 mg of theanine per 500 milliliters could not be excluded-reactions such as impairment of psychomotor skills and amplification of the sedating effects of alcohol and hypnotics.[41] In 2006, a study ...
The substance appears to have a slight toxicity in higher doses, with effects such as liver and intestinal disorders at high exposure in test animals (just below LD50 level).[citation needed] Some reproductive disorders and decreasing weaning weight have been observed, also at high exposure. Effects on humans from use as a drug include nausea, vomiting, loss of appetite, diarrhea, dizziness, drowsiness, or headache; very rarely also ringing in the ears, vision changes, stomach pain, yellowing eyes and skin, dark urine, fever, fatigue, increased thirst and change in the amount of urine occur.[citation needed] Carcinogenic effects have been shown at higher doses.[11] ...
GAD67 and GAD65 are also regulated differently post-translationally. Both GAD65 and GAD67 are regulated via phosphorylation of a dynamic catalytic loop,[10][11] but the regulation of these isoforms differs; GAD65 is activated by phosphorylation while GAD67 is inhibited by phosphorylation. GAD67 is predominantly found activated (~92%), whereas GAD65 is predominantly found inactivated (~72%).[12] GAD67 is phosphorylated at threonine 91 by protein kinase A (PKA), while GAD65 is phosphorylated, and therefore regulated by, protein kinase C (PKC). Both GAD67 and GAD65 are also regulated post-translationally by Pyridoxal 5'-phosphate (PLP); GAD is activated when bound to PLP and inactive when not bound to PLP.[12] Majority of GAD67 is bound to PLP at any given time, whereas GAD65 binds PLP when GABA is needed for neurotransmission.[12] This reflects the functional properties of the two isoforms; GAD67 must be active at all times for normal cellular functioning, and is therefore constantly activated by ...
InChI=1S/C48H74O14.C47H72O14/c1-11-25(2)43-28(5)17-18-47(62-43)23-34-20-33(61-47)16-15-27(4)42(26(3)13-12-14-32-24-55-45-40(49)29(6)19-35(46(51)58-34)48(32,45)52)59-39-22-37(54-10)44(31(8)57-39)60-38-21-36(53-9)41(50)30(7)56-38;1-24(2)41-27(5)16-17-46(61-41)22-33-19-32(60-46)15-14-26(4)42(25(3)12-11-13-31-23-54-44-39(48)28(6)18-34(45(50)57-33)47(31,44)51)58-38-21-36(53-10)43(30(8)56-38)59-37-20-35(52-9)40(49)29(7)55-37/h12-15,19,25-26,28,30-31,33-45,49-50,52H,11,16-18,20-24H2,1-10H3;11-14,18,24-25,27,29-30,32-44,48-49,51H,15-17,19-23H2,1-10H3/b13-12+,27-15+,32-14+;12-11+,26-14+,31-13+/t25-,26-,28-,30-,31-,33+,34-,35-,36-,37-,38-,39-,40+,41-,42-,43+,44-,45+,47+,48+;25-,27-,29-,30-,32+,33-,34-,35-,36-,37-,38-,39+,40-,41+,42-,43-,44+,46+,47+/m00/s1 ...
... is a low cost drug.[7] In the United States, Salix Pharmaceuticals holds a US Patent for rifaximin and markets the drug under the name Xifaxan.[17][18] In addition to receiving FDA approval for traveler's diarrhea and (marketing approved for)[18] hepatic encephalopathy, rifaximin received FDA approval for IBS in May 2015.[19] No generic formulation is available in the US and none has appeared due to the fact that the FDA approval process was ongoing. If rifaximin receives full FDA approval for hepatic encephalopathy it is likely that Salix will maintain marketing exclusivity and be protected from generic formulations until March 24, 2017.[18] Rifaximin is approved in 33 countries for GI disorders.[20][21] On August 13, 2013, Health Canada issued a Notice of Compliance to Salix Pharmaceuticals Inc. for the drug product Zaxine.[22] In India it is available under the brand names Ciboz and Xifapill.[citation needed] In Russia and Ukraine the drug is sold under the name Alfa Normix ...
Bithionol was formerly used in soaps and cosmetics until the U.S. FDA banned it for its photosensitizing effects. The compound ... Bithionol has two aromatic rings with a sulfur atom bonded between them and multiple chlorine ions and hydroxyl groups attached ... Bithionol is the first known soluble adenylyl cyclase inhibitor to act through the bicarbonate binding site via a mostly ... Bithionol is an antibacterial, anthelmintic, and algaecide. It is used to treat Anoplocephala perfoliata (tapeworms) in horses ...
After two to five doses of bithionol, no Paragonimus eggs appeared in bloody sputum or in feces, and eosinophilia decreased to ... Bithionol was not effective in one observed case of clonorchiasis. ... Summary Bithionol in daily doses of 20 to 50 mg/kg given orally, on alternate days, was used in the treatment of 80 patients ... Bithionol in daily doses of 20 to 50 mg/kg given orally, on alternate days, was used in the treatment of 80 patients with ...
Abstract Bithionol-2,2′thiobis(4,6-bichlorphenol)-was used for the mass treatment of 1,355 patients with proved infections with ... Bithionol-2,2′thiobis(4,6-bichlorphenol)-was used for the mass treatment of 1,355 patients with proved infections with ...
The report generally describes bithionol sodium salt, examines its uses, production methods, patents. BITHIONOL SODIUM SALT ... Bithionol sodium salt prices in other regions. 7. BITHIONOL SODIUM SALT END-USE SECTOR 7.1. Bithionol sodium salt market by ... 6. BITHIONOL SODIUM SALT MARKET PRICES. 6.1. Bithionol sodium salt prices in Europe. 6.2. Bithionol sodium salt prices in Asia ... 2. BITHIONOL SODIUM SALT APPLICATIONS. 2.1. Bithionol sodium salt application spheres, downstream products. 3. BITHIONOL SODIUM ...
In this in vitro study, we evaluated the antitumor efficacy of cisplatin in combination with Bithionol (BT) against a panel of ... From: Evaluation of the cytotoxicity of the Bithionol - cisplatin combination in a panel of human ovarian cancer cell lines ...
We focused on Bithionol (BT), a clinically approved anti-parasitic drug as an anti-ovarian cancer drug. BT has previously been ... From: Bithionol inhibits ovarian cancer cell growth In Vitro- studies on mechanism(s) of action ...
Bithionol. Bithionol is a potent inhibitor of soluble adenylyl cyclase(sAC) with an IC50 of 4 μM and has antibacterial and ... Bithionol. Bithionol is a potent inhibitor of soluble adenylyl cyclase(sAC) with an IC50 of 4 μM and has antibacterial and ...
700.11 Cosmetics containing bithionol.. (a) Bithionol has been used to some extent as an antibacterial agent in cosmetic ... 700.11 Cosmetics containing bithionol.. §700.13 Use of mercury compounds in cosmetics including use as skinbleaching agents in ... It is, therefore, the view of the Food and Drug Administration that bithionol is a deleterious substance which may render any ... Accordingly, any cosmetic containing bithionol is deemed to be adulterated under section 601(a) of the Federal Food, Drug, and ...
a) The prescription-dispensing requirements of section503(b)(1)(B) of the Federal Food, Drug, and Cosmetic Act are not necessary for the protection of the public health with respect to the following drugs subject to new drug applications: (1) N -Acetyl-p -aminophenol (acetaminophen, p -hydroxy-acetanilid) preparations meeting all the following conditions: (i) The N -acetyl-p -aminophenol is prepared, with or without other drugs, in tablet or other dosage form suitable for oral use in self-medication, and containing no drug limited to prescription sale under the provisions of section 503(b)(1) of the act. (ii) The N -acetyl-p -aminophenol and all other components of the preparation meet their professed standards of identity, strength, quality, and purity. (iii) If the preparation is a new drug, an application pursuant to section 505 (b) of the act is approved for it. (iv) The preparation contains not more than 0.325 gram (5 grains) of N -acetyl-p -aminophenol per dosage unit, or if it is in ...
a) A number of active ingredients have been present in OTC drug products for various uses, as described below. However, based on evidence currently available, there are inadequate data to establish general recognition of the safety and effectiveness of these ingredients for the specified uses: (1) Topical acne drug products. Alcloxa Alkyl isoquinolinium bromide Aluminum chlorohydrex Aluminum hydroxide Benzocaine Benzoic acid Boric acid Calcium polysulfide Calcium thiosulfate Camphor Chloroxylenol Cloxyquin Coal tar Dibenzothiophene Estrone Magnesium aluminum silicate Magnesium sulfate Phenol Phenolate sodium Phenyl salicylate Povidone-iodine Pyrilamine maleate Resorcinol (as single ingredient) Resorcinol monoacetate (as single ingredient) Salicylic acid (over 2 up to 5 percent) Sodium borate Sodium thiosulfate Tetracaine hydrochloride Thymol Vitamin E Zinc oxide Zinc stearate Zinc sulfide. (2) Anticaries drug products - (i) Approved as of May 7, 1991. Hydrogen fluoride Sodium carbonate Sodium ...
ChEMBL Compound Description] ID:, InChI_Key:, Tradenames:LOROTHIDOL, Synonyms:LOROTHIDOL , BITHIONOLATE SODIUM , BITHIONOL , ... D10AB01 - bithionol. P - ANTIPARASITIC PRODUCTS, INSECTICIDES AND REPELLENTS. P02 - ANTHELMINTICS. P02B - ANTITREMATODALS. ...
ii) Any ingredients labeled with any of the following or similar claims. Instant protection or protection immediately upon application. Claims for "all-day" protection or extended wear claims citing a specific number of hours of protection that is inconsistent with the directions for application in 21 CFR 201.327. (30) [Reserved] (b) Any OTC drug product that is labeled, represented, or promoted for the uses specified and containing any active ingredient(s) as specified in paragraph (a) of this section is regarded as a new drug within the meaning of section 210(p) of the Federal Food, Drug, and Cosmetic Act (the Act), for which an approved new drug application under section 505 of the Act and part 314 of this chapter is required for marketing. In the absence of an approved new drug application, such product is also misbranded under section 502 of the Act. (c) Clinical investigations designed to obtain evidence that any drug product labeled, represented, or promoted for the OTC uses and ...
Bithionol potently inhibits human soluble adenylyl cyclase through binding to the allosteric activator site. In: The Journal of ... Bithionol potently inhibits human soluble adenylyl cyclase through binding to the allosteric activator site ... To analyze the interaction details, we solved a crystal structure of a sAC/bithionol complex. The structure reveals that the ... Structural comparison of the bithionol complex with apo sAC and other sAC/ligand complexes, along with mutagenesis experiments ...
Bithionol (Bitin) 57. Capreomycin (Capastat) 62. Caspofungin (Cancidas) 60. Cefaclor 66. Cefadroxil (Duricef) 135 ...
bithionol. *chlorofluorocarbon propellants. *chloroform. *halogenated salicylanilides, di-, tri-, metabromsalan and ...
The present invention relates to the use of phosphated 2-propylheptanol, phosphated 2-proyplheptanol alkoxylate and/or mixtures thereof in agricultural formulations. The invention also relates to agri
Bithionol: All drug products containing bithionol.. Bromfenac sodium: All drug products containing bromfenac sodium (except ...
Praziquantel is not effective, and older drugs such as bithionol are moderately effective but also cause more side effects. ... There are also reports of bithionol being used successfully. Nitazoxanide has been found effective in trials, but is currently ... Fasciolicides (drugs against Fasciola spp.) fall into five main chemical groups: Halogenated phenols: bithionol (Bitin), ...
Bithionol Anti-s CAS No.: 97-18-7. USD $35.00-60.00 / Kilogram ...
Bithionol: A Possible Substitute For Hexachlorophene Henry C. Powell, Peter W. Lampert ... Bithionol: A Possible Substitute For Hexachlorophene Henry C. Powell, Peter W. Lampert ...
Triethylene glycol/bithionol amine. Ref No. 004426 Filed: 01-24-92. Toilet soap. Ref No. 004428 Filed: 01-24-92. Pure vegetable ...
Index: IMEMR (Eastern Mediterranean) Main subject: Bithionol / T-Lymphocyte Subsets / Liver Language: English Journal: J. Egypt ... Index: IMEMR (Eastern Mediterranean) Main subject: Bithionol / T-Lymphocyte Subsets / Liver Language: English Journal: J. Egypt ... After bithionol a noticable regression of the OKT3[+] lymphocytic in all liver sections. The majority of the lymphocytic ... Before bithionol treatment, lymphocytic infiltration in all hepatic lesions were predominantly of OKT3[+] [pan T] lymphocytes. ...
Index: IMEMR (Eastern Mediterranean) Main subject: Bithionol / Gamma-Glutamyltransferase / Glutathione / Glutathione ... Index: IMEMR (Eastern Mediterranean) Main subject: Bithionol / Gamma-Glutamyltransferase / Glutathione / Glutathione ... Glutathione and related enzymes in fascioliasis before and after treatment with bithionol ... Glutathione and related enzymes in fascioliasis before and after treatment with bithionol ...
Study CHEMOTHERAPEUTIC DRUGS - ANTIPROTOZOAL AND ANTHELMINTIC DRUGS flashcards from Tiago Rodrigues
This updated edition in the long standing series provides the latest information on many individual drugs, including the most complete coverage of their adverse reactions and interactions.
Bithionol. Not Available. DB12035. Sarecycline. Sarecycline is a tetracycline-class drug indicated for the treatment of ...
Treatment with anthelminthics (praziquantel for most; bithionol, paromomycin, or sodium amidotrizoate and meglumine ...
... manufacturer factory of Veterinary APIs in India Animal or Veterinary products producer by Aarambh life science is Bithionol ...
  • This inhibition of the soluble adenylyl cyclase by bithionol at the bicarbonate binding site is demonstrated through a mixed-inhibition graph, where higher concentrations of bithionol have a lower Vmax and a larger Km. (wikipedia.org)
  • We also found that other thiol reactive compounds ( l -captopril and Bithionol) and quercetin inhibits CVU. (mdpi.com)
  • They also synthesized new compounds, to learn more about how bithionol works and enhance its potential for clinical use. (blogspot.com)
  • Multidrug resistant malaria in children and adolescents with benign prostatic hypertrophy , a lower rate than expected, an ultrasound can provide visualization of the foot on the age group and related compounds: Phenol, cresol, chlorocresol, hexylre-sorcinol, bithionol, thymol, hexachlorophane, chlorhexidine. (bigsurlandtrust.org)
  • Early oa may be removed before reversal of hirsutism the physiology of the difference between the ages of 40 mm hg, and (d) toxaphene and related compounds: Phenol, cresol, chlorocresol, hexylre-sorcinol, bithionol, thymol, hexachlorophane, chlorhexidine. (yogachicago.com)
  • Complete oedipus complex (1944), and some other unit which express the pressure is negative during inspiration and expiration and prevent musculoaponeurotic necrosis and loss of a suspicion of pernicious anemia, gastric diseases and related compounds: Phenol, cresol, chlorocresol, hexylre-sorcinol, bithionol, thymol, hexachlorophane, chlorhexidine. (yogachicago.com)
  • Liver biopsies from 5 patients with established fascioliasis , before and after bithionol treatment were studied by immunoalkaline phosphatase technique for relative distribution of T cells and their subpopulations. (bvsalud.org)
  • The present work is an update evaluation of the glutathion status in patients with established fascioliasis before and after treatment with bithionol . (bvsalud.org)
  • After treatment , the variations observed in these parameters were restored to the corresponding normal control values confirming the toxic features resulting from fascioliasis and suggesting no insult of bithionol on the parameters studied. (bvsalud.org)
  • La fascioliasis es una zoonosis que puede ocurrir en la poblaci n de cualquier parte del mundo. (medigraphic.com)
  • Aqu se presenta el primer caso en la literatura nacional y el quinto en la literatura mundial de la manifestaci n de fascioliasis como absceso hep tico. (medigraphic.com)
  • L pez LM, Hern ndez S, Acu a AM, Nari A. Fascioliasis en la Rep blica Oriental del Uruguay. (medigraphic.com)
  • Ayyagari VN, Hsieh TJ, Diaz-Sylvester PL , Brard L. Evaluation of the cytotoxicity of the Bithionol - cisplatin combination in a panel of human ovarian cancer cell lines. (siumed.edu)
  • Bithionol in daily doses of 20 to 50 mg/kg given orally, on alternate days, was used in the treatment of 80 patients with paragonimiasis and results were followed for 6 months to 1 year. (ajtmh.org)
  • After two to five doses of bithionol, no Paragonimus eggs appeared in bloody sputum or in feces, and eosinophilia decreased to normal soon after the completion of treatment. (ajtmh.org)
  • All patients demonstrated striking clinical and radiologic improvement following treatment with bithionol (50 mg/kg every other day for 15 doses), which was well tolerated. (aappublications.org)
  • When used in high doses, bithionol causes the cells of bacteria to burst open and die-but this might cause bacteria to become resistant. (anh-usa.org)
  • Researchers found that using lower doses of bithionol to weaken bacteria, and then a traditional antibiotic to finish the job, was more effective. (anh-usa.org)
  • bithionol sodium salt manufacturers and suppliers with contacts and product range are mentioned in the study. (marketpublishers.com)
  • Furthermore, bithionol sodium salt prices in regional markets can be found in the report with regards to countries and companies. (marketpublishers.com)
  • The report also focuses on bithionol sodium salt consumers by providing data on companies that use it. (marketpublishers.com)
  • BITHIONOL SODIUM SALT (CAS 6385-58-6) Market Research Report 2018 contents were prepared and placed on the website in February, 2018. (marketpublishers.com)
  • Please note that BITHIONOL SODIUM SALT (CAS 6385-58-6) Market Research Report 2018 is a half ready publication and contents are subject to change. (marketpublishers.com)
  • Treatment of Microcotyle sebastis (Monogenea) on the gills of cultured rockfish (Sebastes schelegeli) with oral administration of mebendazole and bithionol. (academicjournals.org)
  • Praziquantel is not effective, and older drugs such as bithionol are moderately effective but also cause more side effects. (wikipedia.org)
  • Paragonimus ohirai: Drug-induced changes in the gastrodermal cells after treatment with praziquantel and bithionol. (nii.ac.jp)
  • Older therapies (eg, bithionol, niclofolan), despite their effectiveness (cure rates ≥ 90%), have unacceptable adverse effect profiles compared with praziquantel and are not available in the United States for human use. (medscape.com)
  • Ayyagari V, Diaz-Sylvester PL , Hsieh TJ, Brard L. Evaluation of cytotoxicity of the Bithionol and Paclitaxel combination treatment in a panel of human ovarian carcinoma cell lines.PLoS ONE 12(9):e0185111, 2017. (siumed.edu)
  • The study found that bithionol, a drug that used to treat parasitic infections in horses, could be used to treat antibiotic-resistant bacteria like MRSA , which infects 90,000 Americans each year and kills 20,000. (anh-usa.org)
  • A recent study published in Proceedings of the National Academy of Sciences found that they can repurpose bithionol - a drug formerly used to treat parasitic infections in horses - to kill antibiotic-resistant bacteria, including MRSA, a common hospital-acquired infection. (wrkf.org)
  • Their work helped verify how bithionol - a drug used to treat parasitic infections - can weaken the cell membranes of "persister" cells of methicillin-resistant Staphylococcus aureus (MRSA), a deadly staph bacterium. (blogspot.com)
  • Bithionol has been shown to be a potent inhibitor of soluble adenylyl cyclase, an intracellular enzyme important in the catalysis of adenosine triphosphate (ATP) to cyclic adenosine monophosphate (cAMP). (wikipedia.org)
  • Arginine 176 usually interacts with the ATP and other catalytic ions at the active site, so when it turns from its normal position to interact with the bithionol inhibitor, it no longer functions in keeping the ATP bound to the active site. (wikipedia.org)
  • Bithionol is the first known soluble adenylyl cyclase inhibitor to act through the bicarbonate binding site via a mostly allosteric mechanism. (wikipedia.org)
  • Bithionol is a potent inhibitor of soluble adenylyl cyclase(sAC) with an IC50 of 4 μM and has antibacterial and anthelmintic properties along with algaecide activity. (selleckchem.com)
  • At normoxia, O XPHOS cell respiration was decreased down to ~15 and ~10% by the aminotransferase inhibitor aminooxyacetate (AOA) or with AOA plus the glutamate-dehydrogenase inhibitor bithionol, respectively. (frontiersin.org)
  • These intermolecular interactions are responsible for the binding of bithionol to the bicarbonate binding site of soluble adenylyl cyclase efficiently enough to cause competitive inhibition with the usual bicarbonate substrate. (wikipedia.org)
  • The side chain of arginine 176 within the bicarbonate binding site interacts significantly with the aromatic ring of the bithionol molecule. (wikipedia.org)
  • In another form of inhibition, bithionol is a much larger molecule than simple sodium bicarbonate, so it is large enough to reach through a small channel in the soluble adenylyl cyclase and interfere with binding of ATP, preventing its conversion to cAMP. (wikipedia.org)
  • Bithionol is an antibacterial, anthelmintic, and algaecide. (wikipedia.org)
  • While it was known that bithionol had some antibacterial activity, the results from this study indicate that it "is actually much more potent than what had been previously reported," says Meghan Blackledge , assistant professor of chemistry at High Point University, who researches treatments for MRSA. (wrkf.org)
  • Before bithionol treatment , lymphocytic infiltration in all hepatic lesions were predominantly of OKT3 [+] [pan T] lymphocytes . (bvsalud.org)
  • A similar toxicity to freshwater water was observed with bithionol and bithionol sulphoxide at 10 and 5 mg L-1 following a 72 h treatment. (edu.au)
  • in vitro, an assessment of the toxicity of bithionol to Atlantic salmon and the efficacy as an AGD treatment was evaluated. (edu.au)
  • Bithionol was examined as an in-feed treatment for AGD with and without the administration of a freshwater bath. (edu.au)
  • Bithionol when fed as a two week prophylactic or therapeutic treatment at 25 mg kg' feed delayed the onset of AGD pathology and reduced the percent lesioned gill filaments. (edu.au)
  • For bithionol to be a safe antibiotic treatment in humans, the scientists had to show that it could penetrate only the membranes of bacteria, not those of human cells. (wrkf.org)
  • Treatment is with bithionol. (thefreedictionary.com)
  • This translates to a decreased rate of reaction and a decreased affinity between substrates when bithionol is in higher concentrations. (wikipedia.org)
  • However, concentrations of bithionol that are required inhibit soluble adenylyl cyclase at clinically relevant levels are also cytotoxic in vivo. (wikipedia.org)
  • Bithionol was formerly used in soaps and cosmetics until the U.S. FDA banned it for its photosensitizing effects. (wikipedia.org)
  • Of these, several have vaccines and therapeutics must be evaluated for their advanced beyond pre-clinical studies in animals and en- efficacy in human trials, yet the design of efficacy trials tered phase 1 human trials [3, 4], with two candidates and the appropriate selection of clinical endpoints pose a challenge. (deepdyve.com)
  • Efficacy was determined by examining gill amoeba counts and identifying percent lesioned gill filaments at I and 24 h after bath exposure to bithionol. (edu.au)
  • Bithionol has two aromatic rings with a sulfur atom bonded between them and multiple chlorine ions and hydroxyl groups attached to the phenyl groups. (wikipedia.org)
  • After bithionol a noticable regression of the OKT3 [+] lymphocytic in all liver sections. (bvsalud.org)
  • This thesis investigates in vitro and in vivo effects of bithionol and bithionol sulphoxide on both Neoparamoeba spp. (edu.au)
  • was examined in vitro using isolated gill amoeba and exposing them to seawater, freshwater, alumina (10 mg L-1), bithionol and bithionol sulphoxide at 10, 5, 1, 0.5 and 0.1 mg L. The assays were observed for 72 h with viable amoeba counts using trypan blue exclusion conducted at 0, 24, 48 and 72 h. (edu.au)
  • Here we identify the bisphenols bithionol and hexachlorophene as potent, sAC-specific inhibitors. (uni-bayreuth.de)
  • Evaluation of Marked Rise in Fecal Egg Output after Bithionol Administration to Horse and its Application as a Diagnostic Marker for Equine Anoplocephala perfoliata Infection" (pdf). (wikipedia.org)
  • Following the freshwater bath, clinical signs of AGD recurred at a similar level across all treatments although controls clinical signs were significantly higher than the bithionol treatments to begin with. (edu.au)
  • Bithionol reduced the percentage of lesioned gill filaments to the same level as freshwater. (edu.au)
  • Hence, the control was significantly higher than both bithionol treatments. (edu.au)
  • Using computer simulations, the scientists showed that bithionol could penetrate only the membranes of bacteria, not those of mammalian cells. (wrkf.org)
  • But the researchers found a potential problem with bithionol - it's destructive. (wrkf.org)
  • Bithionol was not effective in one observed case of clonorchiasis. (ajtmh.org)
  • They found 185 drugs that passed this screen, but only a few of them, including bithionol, could penetrate the membrane of persister bacteria. (wrkf.org)
  • To analyze the interaction details, we solved a crystal structure of a sAC/bithionol complex. (uni-bayreuth.de)
  • Of course, the danger of bacteria eventually becoming resistant to bithionol, too, is ever present. (anh-usa.org)
  • Palatability was not a problem with mean feed intake of bithionol over the trial duration higher compared to both the oil and plain controls. (edu.au)