An exocellulase with specificity for a variety of beta-D-glycoside substrates. It catalyzes the hydrolysis of terminal non-reducing residues in beta-D-glucosides with release of GLUCOSE.
An enzyme that catalyzes the endohydrolysis of 1,6-alpha-glucosidic linkages in isomaltose and dextrins produced from starch and glycogen by ALPHA-AMYLASES. EC 3.2.1.10.
Enzymes that catalyze the exohydrolysis of 1,4-alpha-glucosidic linkages with release of alpha-glucose. Deficiency of alpha-1,4-glucosidase may cause GLYCOGEN STORAGE DISEASE TYPE II.
Enzymes that hydrolyze O-glucosyl-compounds. (Enzyme Nomenclature, 1992) EC 3.2.1.-.
An alpha-glucosidase inhibitor with antiviral action. Derivatives of deoxynojirimycin may have anti-HIV activity.
1,4-alpha-D-Glucan-1,4-alpha-D-glucan 4-alpha-D-glucosyltransferase/dextrin 6 alpha-D-glucanohydrolase. An enzyme system having both 4-alpha-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33) activities. As a transferase it transfers a segment of a 1,4-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or another 1,4-alpha-D-glucan. As a glucosidase it catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-1,6-glucosidase activity is deficient in glycogen storage disease type III.
Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.
An interleukin-1 subtype that is synthesized as an inactive membrane-bound pro-protein. Proteolytic processing of the precursor form by CASPASE 1 results in release of the active form of interleukin-1beta from the membrane.
Glycoside hydrolases that catalyze the hydrolysis of alpha or beta linked MANNOSE.
Six-carbon pyranose sugars in which the OXYGEN is replaced by a NITROGEN atom.
A plant genus of the APOCYNACEAE or dogbane family. Alkaloids from plants in this genus have been used as tranquilizers and antihypertensive agents. RESERPINE is derived from R. serpentina.
An 11-kDa protein associated with the outer membrane of many cells including lymphocytes. It is the small subunit of the MHC class I molecule. Association with beta 2-microglobulin is generally required for the transport of class I heavy chains from the endoplasmic reticulum to the cell surface. Beta 2-microglobulin is present in small amounts in serum, csf, and urine of normal people, and to a much greater degree in the urine and plasma of patients with tubular proteinemia, renal failure, or kidney transplants.
A lectin found in ENDOPLASMIC RETICULUM membranes that binds to specific N-linked OLIGOSACCHARIDES found on newly synthesized proteins. It may play role in PROTEIN FOLDING or retention and degradation of misfolded proteins in the endoplasmic reticulum.
A system of cisternae in the CYTOPLASM of many cells. In places the endoplasmic reticulum is continuous with the plasma membrane (CELL MEMBRANE) or outer membrane of the nuclear envelope. If the outer surfaces of the endoplasmic reticulum membranes are coated with ribosomes, the endoplasmic reticulum is said to be rough-surfaced (ENDOPLASMIC RETICULUM, ROUGH); otherwise it is said to be smooth-surfaced (ENDOPLASMIC RETICULUM, SMOOTH). (King & Stansfield, A Dictionary of Genetics, 4th ed)
An indolizidine alkaloid from the plant Swainsona canescens that is a potent alpha-mannosidase inhibitor. Swainsonine also exhibits antimetastatic, antiproliferative, and immunomodulatory activity.
A disaccharide consisting of two glucose units in an alpha (1-6) glycosidic linkage.
The chemical or biochemical addition of carbohydrate or glycosyl groups to other chemicals, especially peptides or proteins. Glycosyl transferases are used in this biochemical reaction.
The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.
One of two major pharmacologically defined classes of adrenergic receptors. The beta adrenergic receptors play an important role in regulating CARDIAC MUSCLE contraction, SMOOTH MUSCLE relaxation, and GLYCOGENOLYSIS.
An integrin beta subunit of approximately 85-kDa in size which has been found in INTEGRIN ALPHAIIB-containing and INTEGRIN ALPHAV-containing heterodimers. Integrin beta3 occurs as three alternatively spliced isoforms, designated beta3A-C.
Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
An inhibitor of ALPHA-GLUCOSIDASES that retards the digestion and absorption of DIETARY CARBOHYDRATES in the SMALL INTESTINE.
Enzymes that catalyze the hydrolysis of N-acylhexosamine residues in N-acylhexosamides. Hexosaminidases also act on GLUCOSIDES; GALACTOSIDES; and several OLIGOSACCHARIDES.
An autosomal recessively inherited glycogen storage disease caused by GLUCAN 1,4-ALPHA-GLUCOSIDASE deficiency. Large amounts of GLYCOGEN accumulate in the LYSOSOMES of skeletal muscle (MUSCLE, SKELETAL); HEART; LIVER; SPINAL CORD; and BRAIN. Three forms have been described: infantile, childhood, and adult. The infantile form is fatal in infancy and presents with hypotonia and a hypertrophic cardiomyopathy (CARDIOMYOPATHY, HYPERTROPHIC). The childhood form usually presents in the second year of life with proximal weakness and respiratory symptoms. The adult form consists of a slowly progressive proximal myopathy. (From Muscle Nerve 1995;3:S61-9; Menkes, Textbook of Child Neurology, 5th ed, pp73-4)
Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.

The DNA binding site of the Dof protein NtBBF1 is essential for tissue-specific and auxin-regulated expression of the rolB oncogene in plants. (1/814)

The Dof proteins are a large family of plant transcription factors that share a single highly conserved zinc finger. The tobacco Dof protein NtBBF1 was identified by its ability to bind to regulatory domain B in the promoter of the rolB oncogene. In this study, we show that the ACT T TA target sequence of NtBBF1 in domain B is necessary for tissue-specific expression of rolB. beta-Glucuronidase (GUS) activity of tobacco plants containing a rolB promoter-GUS fusion with a mutated NtBBF1 target sequence within domain B is almost completely suppressed in apical meristems and is severely abated in the vascular system. The ACT T TA motif is shown here also to be one of the cis-regulatory elements involved in auxin induction of rolB. The pattern of NtBBF1 expression in plants is remarkably similar to that of rolB, except in mesophyll cells of mature leaves, in which only NtBBF1 expression could be detected. Ectopic expression of rolB in mesophyll cells was achieved by particle gun delivery if the NtBBF1 binding sequence was intact. These data provide evidence that in the plant, a Dof protein DNA binding sequence acts as a transcriptional regulatory motif, and they point to NtBBF1 as the protein involved in mediating tissue-specific and auxin-inducible expression of rolB.  (+info)

Stochastic and nonstochastic post-transcriptional silencing of chitinase and beta-1,3-glucanase genes involves increased RNA turnover-possible role for ribosome-independent RNA degradation. (2/814)

Stochastic and nonstochastic post-transcriptional gene silencing (PTGS) in Nicotiana sylvestris plants carrying tobacco class I chitinase (CHN) and beta-1,3-glucanase transgenes differs in incidence, stability, and pattern of expression. Measurements with inhibitors of RNA synthesis (cordycepin, actinomycin D, and alpha-amanitin) showed that both forms of PTGS are associated with increased sequence-specific degradation of transcripts, suggesting that increased RNA turnover may be a general feature of PTGS. The protein synthesis inhibitors cycloheximide and verrucarin A did not inhibit degradation of CHN RNA targeted for PTGS, confirming that PTGS-related RNA degradation does not depend on ongoing protein synthesis. Because verrucarin A, unlike cycloheximide, dissociates mRNA from ribosomes, our results also suggest that ribosome-associated RNA degradation pathways may not be involved in CHN PTGS.  (+info)

Molecular cloning and expression of the novel fungal beta-glucosidase genes from Humicola grisea and Trichoderma reesei. (3/814)

A novel fungal beta-glucosidase gene (bgl4) and its homologue (bgl2) were cloned from the cellulolytic fungi Humicola grisea and Trichoderma reesei, respectively. The deduced amino acid sequences of H. grisea BGL4 and T. reesei BGL2 comprise 476 and 466 amino acids, respectively, and share 73.1% identity. These beta-glucosidases show significant homology to plant beta-glucosidases belonging to the beta-glucosidase A (BGA) family. Both genes were expressed in Aspergillus oryzae, and the recombinant beta-glucosidases were purified. Recombinant H. grisea BGL4 is a thermostable enzyme compared with recombinant T. reesei BGL2. In addition to beta-glucosidase activity, recombinant H. grisea BGL4 showed a significant level of beta-galactosidase activity, while recombinant T. reesei BGL2 showed weak beta-galactosidase activity. Cellulose saccharification by Trichoderma cellulases was improved by the addition of recombinant H. grisea BGL4.  (+info)

Properties of beta-glucosidase in cultured skin fibroblasts from controls and patients with Gaucher disease. (4/814)

Membrane-bound beta-glucosidase from cultured skin fibroblasts can be solubilized in an active form by treatment of membrane preparations with a mixture of Triton X-100 and sodium taurocholate. Several properties of the solubilized enzyme have been studied in fibroblasts from normal, healthy individuals and from 14 patients with different clinical forms of Gaucher disease. The patients studied were classified as follows: group 1 consisted of 10 chronic patients, all (with one exception) of Ashkenazi Jewish origin; group 2 consisted of three black American patients with severe visceral symptoms, manifest from early childhood, but with no apparent neurological involvement; and group 3 consisted of a single white patient with the classical infantile form of the disease. Specific beta-glucosidase activity ranged from 6.6% to 16.5% mean control value in group 1 patients and from 4.1% to 5.8% in groups 2 and 3. When compared with the enzyme from control fibroblasts, the enzyme from chronic Gaucher patients (group 1) was more rapidly inactivated at 50 degrees C, had an altered pH curve, was less effectively inhibited by deoxycorticosterone-beta-glucoside, and was more effectively inhibited by deoxycorticosterone. The enzyme from patients in groups 2 and 3 was qualitatively indistinguishable from the control enzyme in terms of these parameters. No differences in Km (4-methylumbelliferyl-beta-glucoside) or sedimentation coefficient were found between the beta-glucosidases from control and Gaucher cells. The results demonstrate that cells from Ashkenazi Jewish patients with the chronic form of Gaucher disease contain a structurally altered form of beta-glucosidase. This enzyme differs both from normal beta-glucosidase and from the residual enzyme in patients of different ethnic origin and with clinically more severe forms of the disease.  (+info)

Growth of Azospirillum irakense KBC1 on the aryl beta-glucoside salicin requires either salA or salB. (5/814)

The rhizosphere nitrogen-fixing bacterium Azospirillum irakense KBC1 is able to grow on pectin and beta-glucosides such as cellobiose, arbutin, and salicin. Two adjacent genes, salA and salB, conferring beta-glucosidase activity to Escherichia coli, have been identified in a cosmid library of A. irakense DNA. The SalA and SalB enzymes preferentially hydrolyzed aryl beta-glucosides. A Delta(salA-salB) A. irakense mutant was not able to grow on salicin but could still utilize arbutin, cellobiose, and glucose for growth. This mutant could be complemented by either salA or salB, suggesting functional redundancy of these genes in salicin utilization. In contrast to this functional homology, the SalA and SalB proteins, members of family 3 of the glycosyl hydrolases, show a low degree of amino acid similarity. Unlike SalA, the SalB protein exhibits an atypical truncated C-terminal region. We propose that SalA and SalB are representatives of the AB and AB' subfamilies, respectively, in glycosyl hydrolase family 3. This is the first genetic implication of this beta-glucosidase family in the utilization of beta-glucosides for microbial growth.  (+info)

Yeast VSM1 encodes a v-SNARE binding protein that may act as a negative regulator of constitutive exocytosis. (6/814)

We have screened for proteins that interact with v-SNAREs of the late secretory pathway in the yeast Saccharomyces cerevisiae. A novel protein, designated Vsm1, binds tightly to the Snc2 v-SNARE in the two-hybrid system and can be coimmunoprecipitated with Snc1 or Snc2 from solubilized yeast cell extracts. Disruption of the VSM1 gene results in an increase of proteins secreted into the medium but does not affect the processing or secretion of invertase. In contrast, VSM1 overexpression in cells which bear a temperature-sensitive mutation in the Sec9 t-SNARE (sec9-4 cells) results in the accumulation of non-invertase-containing low-density secretory vesicles, inhibits cell growth and the secretion of proteins into the medium, and blocks rescue of the temperature-sensitive phenotype by SNC1 overexpression. Yet, VSM1 overexpression does not affect yeast bearing a sec9-7 allele which, in contrast to sec9-4, encodes a t-SNARE protein capable of forming a stable SNARE complex in vitro at restrictive temperatures. On the basis of these results, we propose that Vsm1 is a novel v-SNARE-interacting protein that appears to act as negative regulator of constitutive exocytosis. Moreover, this regulation appears specific to one of two parallel exocytic paths which are operant in yeast cells.  (+info)

Cellobiose transport by mixed ruminal bacteria from a Cow. (7/814)

The transport of cellobiose in mixed ruminal bacteria harvested from a holstein cow fed an Italian ryegrass hay was determined in the presence of nojirimycin-1-sulfate, which almost inhibited cellobiase activity. The kinetic parameters of cellobiose uptake were 14 microM for the Km and 10 nmol/min/mg of protein for the Vmax. Extracellular and cell-associated cellobiases were detected in the rumen, with both showing higher Vmax values and lower affinities than those determined for cellobiose transport. The proportion of cellobiose that was directly transported before it was extracellularly degraded into glucose increased as the cellobiose concentration decreased, reaching more than 20% at the actually observed levels of cellobiose in the rumen, which were less than 0.02 mM. The inhibitor experiment showed that cellobiose was incorporated into the cells mainly by the phosphoenolpyruvate phosphotransferase system and partially by an ATP-dependent and proton-motive-force-independent active transport system. This finding was also supported by determinations of phosphoenolpyruvate phosphotransferase-dependent NADH oxidation with cellobiose and the effects of artificial potentials on cellobiose transport. Cellobiose uptake was sensitive to a decrease in pH (especially below 6.0), and it was weakly but significantly inhibited in the presence of glucose.  (+info)

Transcriptional regulation in the hyperthermophilic archaeon Pyrococcus furiosus: coordinated expression of divergently oriented genes in response to beta-linked glucose polymers. (8/814)

The genetic organization, expression, and regulation of the celB locus of the hyperthermophilic archaeon Pyrococcus furiosus were analyzed. This locus includes the celB gene, which codes for an intracellular beta-glucosidase, and a divergently orientated gene cluster, adhA-adhB-lamA, which codes for two alcohol dehydrogenases and an extracellular beta-1,3-endoglucanase that is transcribed as a polycistronic messenger (the lamA operon). During growth of P. furiosus on either the beta-1,4-linked glucose dimer cellobiose or the beta-1,3-linked glucose polymer laminarin, the activities of both beta-glucosidase and endoglucanase were increased at least fivefold compared with levels during growth on maltose or pyruvate. Northern blot analysis revealed an enhanced transcription of both the celB gene and the lamA operon in the presence of these glucose-containing substrates. The in vivo and in vitro transcription initiation sites of both the celB gene and the lamA operon were identified 25 nucleotides downstream of conserved TATA box motifs. A number of repeating sequences have been recognized in the celB-adhA intergenic region, some of which might be part of a transcriptional regulator-binding site.  (+info)

BioAssay record AID 593427 submitted by ChEMBL: Inhibition of sweet almond beta-glucosidase after 10 mins using 4-nitrophenylbeta-D-glucopyranoside as a substrate by Lineweaver-Burk and double reciprocal analysis.
Shop Lysosomal beta glucosidase ELISA Kit, Recombinant Protein and Lysosomal beta glucosidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Heritage Products Sweet Almond Oil (8 fl Oz)-Enjoy Heritage Products Sweet Almond Oil - 8 fl oz every day at these amazing prices! Heritage Products Sweet Almond Oil Description: Skin Lotion Massage Oil Cosmetic ....Learn More At Kalyx.com.
Sweet Almond Carrier Oil - Oil Sweet Almond carrier oil is nourishing, softening and revitalizing all skin types. Sweet Almond Oil is avaliable cold pressed from just aromatherapys Pure Carrier oils range
Aroma Beads | Fragrance Oil | Potpourri Sweet Almond Oil 16 oz. Bottle [16OZSWAO] - Sweet Almond Oil 16 oz. Bottle (Great for use as a carrier oil) Sweet Almond oil is a skin nutrient used to beautify the skin and treat injuries. It is also known to condition and soften your skin, offering excellent penetrating properties. Skin will appreciate the rich minerals, vitamins and proteins
Shop Glucan endo-1,6-beta-glucosidase ELISA Kit, Recombinant Protein and Glucan endo-1,6-beta-glucosidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
BioAssay record AID 220893 submitted by ChEMBL: Competitive Inhibition constant on almonds beta Glucosidase; LI=Limited inhibition.
WITH RICE BRAN WATER& POMEGRANATE EXTRACT SWISSE SWEET ALMOND GENTLE CREAMCLEANSER gently yet effectively cleanses the skin,removing impurities while leaving the skin feeling softand balanced. Enriched with Sweet Almond Oil to nourishthe skin, Witch Hazel Water to soothe the skin and Rice Bran Water to improve skin hydration. Suitable For: Normal or dry skin types Size: 125mL
In patients with connective tissue disease it is common for collagen and elastin to become injured by inflammation. It blocks the nerve impulses that cause your facial muscles to contract and form lines. Can You Use Sweet Almond Oil For Dark Circles Affordable Regimen Care throughout its history it has been used as a cartilage support product. Encontre Botox Capilar - Produtos de Cabelo no Mercado Livre Brasil. skin aging thinning You should consult with a health care professional how to rejuvenate my face naturally really covering before starting any diet Can You Use Sweet Almond Oil For Dark Circles Affordable Regimen Care exercise or supplementation program before taking any medication or Having said this TMJ is not one of those disorders of which the FDA has approved. Student Self Governance. do collagen filler creams work 2016 do collagen filler creams work 2016 The Pellev treatment is virtually painless and generally quite pleasurable Anti Aging Cream For Face - Best Moisturizing Cream ...
beta-Glucosidases represent an important group of enzymes due to their pivotal role in various biotechnological processes. One of the most prominent is biomass degradation for the production of fuel ethanol from cellulosic agricultural residues and wastes, where the use of immobilized biocatalysts may prove advantageous. Within such scope, the present work aimed to evaluate the feasibility of entrapping beta-glucosidase in either sol gel or in Lentikats supports for application in cellobiose hydrolysis, and to perform the characterization of the resulting bioconversion systems. The activity and stability of the immobilized biocatalyst over given ranges of temperature and pH values were assessed, as well as kinetic data, and compared to the free form, and the operational stability was evaluated. Immobilization increased the thermal stability of the enzyme, with a 10 degrees C shift to an optimal temperature in the case of sol gel support. Mass transfer hindrances as a result of immobilization ...
3GNR: Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with covalently bound 2-deoxy-2-fluoroglucoside to the catalytic nucleophile E396
Biology lecturer of Faculty of Science and Technology, Universitas Airlangga (FST UNAIR) used beta-glucosidase enzyme producing microorganisms in Indonesia for ginseng active compound biotransformation
Sweet almond oil, made from pressed almonds, is an odorless, pale-yellow liquid with a nutty taste. Its similar to olive oil in composition and can be used as a substitute. Its not, however, to be confused with bitter almond oil, which has a pungent flavor and is typically used as a flavoring agent.
Sweet Almond Oil is rich in vitamin E, essential fatty acids and other minerals that support the body. It is great carrier oil or can be used unaided.
Khadi Natural Sweet Almond Oil 100ml is available at Joybynature.com.100% Certified Organic Products. Free Shipping. Get 10% Off On Online Purchase use Promo JBN10 .Order Now!
Shop for Giovanni Frizz Be Gone™ Polishing Serum Shea Butter & Sweet Almond Oil (2.75 fl oz) at Frys Food Stores. Find quality personal care products to add to your Shopping List or order online for Delivery or Pickup.
Discover the true herbal recipe for nourishment and intensive hydration in a rich detangling cream that instantly melts in your hair. Enriched with select natural extracts, it makes your hair smooth & shiny without weighing it down. Vatika Sweet Almond M
Koa & Sweet Almond Soothing Herbal Cleansing Stick by Hempz is a two-in-one skin care formula that exfoliates and cleanses. Rich lather gently cleanses skin leaving it feeling refreshed and clean. Fine walnut shell gently exfoliates skin leaving it soft and smooth.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Mix all ingredients together in a dropper bottle and shake gently to combine. To use, apply to babys skin after bath using only a tiny bit. For a 10 pound infant, 6 to 8 drops is sufficient for arms and legs as only a light layer is necessary for baby skin. Use more for toddlers and larger babies. If fresh oils are used to make this product, the shelf life will be somewhere in the neighborhood of 6 months. It will last longer if kept refrigerated during any extended periods of non-use. If the product begins to smell badly, the oils have become rancid and the product should be discarded ...
Mix all ingredients together in a dropper bottle and shake gently to combine. To use, apply to babys skin after bath using only a tiny bit. For a 10 pound infant, 6 to 8 drops is sufficient for arms and legs as only a light layer is necessary for baby skin. Use more for toddlers and larger babies. If fresh oils are used to make this product, the shelf life will be somewhere in the neighborhood of 6 months. It will last longer if kept refrigerated during any extended periods of non-use. If the product begins to smell badly, the oils have become rancid and the product should be discarded ...
THE INFORMATION IN THIS MSDS WAS OBTAINED FROM CURRENT REPUTABLE SOURCES. HOWEVER THE DATA IS PROVIDED WITHOUT ANY WARRANTY, EXPRESSEDOR IMPLIED, REGARDING ITS CORRECTNESS OR ACCURACY. IT IS USERS RESPONSIBILITY BOTH TO DETERMINE SAFE CONDITIONS FOR USE OF THIS PRODUCT AND TO ASSUME LIABILITY FOR LOSS, INJURY, DAMAGE OR EXPENSE RESULTING FROM IMPORPER USE OF THIS PRODUCT. ...
reference: Structure of acid beta-glucosidase with pharmacological chaperone provides insight into Gaucher disease., Lieberman RL, Wustman BA, Huertas P, Powe AC Jr, Pine CW, Khanna R, Schlossmacher MG, Ringe D, Petsko GA, Nat Chem Biol. 2007 Feb;3(2):101-107. Epub 2006 Dec 24. PMID: 17187079 ...
We also started working on some of the constructs needed to engineer our bacterial strains, namely: the bacterial construct A0, composed of a TraR-regulated promoter (P-TraR) followed by a beta-glucosidase (BBa_K392008), an E.coli ribosome binding site (RBS, BBa_J15001) and a double terminator (BBa_B0015); the bacterial construct B1, identical to A0 but under the transcriptional control of a LasR-regulated promoter (P-LasR, BBa_R0079); the bacterial construct B2, consisting of a constitutive promoter (BBa_J23119), an RBS (BBa_B0034), a LasR activator (BBa_C0179) and a terminator; and the bacterial construct B3, made of P-LasR, an RBS, the TraI gene and a terminator. ...
bsr:I33_4084 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) beta-glucosidase (A) MSSNAKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPYDESMTSLNLYHN GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLSFYDDLFDELLKHH IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL HAPFTGGGLVFEEGENKRNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY QKPLFIVENGLGAVDKVEDDGTIQDDYRINYLRDHLIEVREAIADGVELIGYTSWGPIDL VSASTAEMKKRYGFIYVDRDNEGNGTLNRIKKKSFIWYQQVIATNGESI ...
APRICON FARMAS HEALTH adalah kapsul biji aprikot yang mengandungi vitamin B17 yang paling tinggi di dunia. Dalam terapi metabolic, apabila vitamin B17 bertemu dengan sel-sel kanser, enzim Beta-Glucosidase yang hanya terdapat pada sel-sel kanser akan menguraikan elemen-elemen yang terdapat dalam vitamin B17. Seterusnya elemen-elemen yang terdapat di dalam vitamin B17 yang telah terurai akan bertindak membunuh sel-sel kanser. ...
A rich, creamy formula thats perfect for all of your facial cleansing needs. Sweet almond oil and oat extract balance skin and replenish as it cleanses skin to leave it soft, smooth, and supple. Clean your skin of pollution, dirt, and makeup with this a
1. Sweet Almond Oil for the body: a source of vitamins A and E, it improves skin suppleness and accelerates its renewal. Its infinite softness makes it an ally for all skin types, soothing the most sensitive to the driest ...
Todays Deals: Save 10% on Linha Seve Natura - Refil Oleo Corporal Amendoas Doces com Enxague 200 Ml - (Natura Seve Collection - Refill Sweet Almonds Body...
Some enzymes in this group hydrolyze alpha-L-arabinosides; some animal enzymes also hydrolyze beta-D-fucosides and beta-D-glucosides (cf. EC 3.2.1.108 ...
Looking for online definition of Acid beta-glucosidase deficiency in the Medical Dictionary? Acid beta-glucosidase deficiency explanation free. What is Acid beta-glucosidase deficiency? Meaning of Acid beta-glucosidase deficiency medical term. What does Acid beta-glucosidase deficiency mean?
Sweet Almond Carrier Oil - Oil Sweet Almond carrier oil is nourishing, softening and revitalizing all skin types. Sweet Almond Oil is avaliable cold pressed from just aromatherapys Pure Carrier oils range
BAISHENG - China glucono-delta-lactone crystal manufacturers and suppliers, also providing customized service. Welcome to import discount glucono-delta-lactone crystal made in China here and check the quotation with us.
An autosomal recessive disorder caused by a deficiency of Acid beta-Glucosidase (Glucosylceramidase) leading to intralysosomal accumulation of glycosylceramide mainly in Cells of the Mononuclear Phagocyte System. The characteristic Gaucher Cells, glycosphingolipid-filled Histiocytes, displace normal Cells in Bone Marrow and visceral organs causing skeletal deterioration, hepatosplenomegaly, and organ dysfunction. There are several subtypes based on the presence and severity of neurological involvement ...
Prunus Amygdalus Dulcis Oil, better known as Sweet Almond Oil, is derived from the fruits of the almond tree. Prunus Amygdalus Dulcis, also known as the Almond Tree, has been cultivated for thousands of years in India and in the Middle East. People have revered it for skin care and for culinary reasons throughout the ages. The use of almonds in skin care and beauty can date all the way back to the ancient Hindus. The ancient Hindu civilization used to make a paste from crushed almonds and then use it as a natural cleanser for the body.. Prunus Amygdalus Dulcis might fall in the same family as cherry, plum and peach trees, but it doesnt offer a fleshy fruit. As a deciduous tree, the Prunus Amygdalus Dulcis is famous for its almonds, fruits that have an exterior hull, a seed in the center and an interior shell. Apart from skin care, almonds are used in cookies, candies and breads as well.. Prunus Amygdalus Dulcis Oil is pressed from the nut kernels of the Sweet Almond Tree. This oil is a ...
Save 35% Now Foods - Sweet Almond Oil 8 Fluid Ounces Sweet Almond Oil 100% Pure Moisturizing Oil Nourishing, Promotes Healthy-Looking Skin* USDA Organic Non-GMO Project Verified Hexane Free Condition: For skin in need of clean and natural nourishment, as a moisturizer or for massage. Solution: Certified Organic Almond Oil is a natural oil thats perfect for nourishing and reviving any skin type. Almond Oil is easily absorbed and wont clog pores, promoting clear, soft, healthy-looking skin. This natural skin-nourishing oil is ideal for the entire body. Almond Oil is a natural oil derived from pressed almonds. Vegetable-derived oils date back to Biblical times, when they were mixed with fragrant herbs to create traditional ointments.
Sweet almond carrier oil contains glucosides, minerals and vitamins A, B1, B2, B6 and E. Being rich in protein sweet almond carrier oil is useful for dry, itchy skin, and for cooling overheated skin. The oil is cold-pressed and refined.
Glucono-Delta-Lactone(GDL) - Browse fuzing.com to find Glucono-Delta-Lactone(GDL) sellers, suppliers, wholesalers, companies, manufacturers, exporters, factories.
Sweet Almond Seeds (Prunus amygdalus) Price for Package of 300 seeds. The almond (Prunus dulcis, syn. Prunus amygdalus) is a species of tree native
Shop for Aura Cacia Sweet Almond Skin Care Oil (4 fl oz) at Foods Co.. Find quality personal care products to add to your Shopping List or order online for Delivery or Pickup.
We have high quality and highly effective glucono-delta-lactone, gluconic acid 50% solution, sodium gluconate made in China for sale. All of our products are sold at a discount. Please be free to place an order and the customized orders are also welcome.
INCI =Prunus Amygdalus Dulcis (Sweet Almond) Oil Saponification Value: 193 mg KOH / g of Fat I love this oil! Sweet Almond is used in lip balm, creams and it makes a wonderful soap! Try adding just 1 ounce per pound of fats to your soap batch. It has a wonderful feel, which is why my massage therapist friends go wild over sweet almond oil. Your friends and family will love almond oil too! I think almond oil imparts a slight flavor to lip balm, yet I use this to my advantage. I match almond with other no/low flavor oils. Try this oil today for some fancy soap in your near future! Lotions and Creams: try 2 to 30 ...
Translated from Latin, Prunus Amygdalus Dulcis means sweet almond oil and is one of the most frequently used carrier oils and most adaptable body oils for beauty products and massage. Cultivated thousands of years ago, sweet almond oil is extracted from ripe seed kernels that have been dried and crushed through a cold pressing process. Today almonds can be used in anything from exfoliants (using the nut or the kernel as a mechanical exfoliant), used as an emulsifying agent to bind oil and water or as a skin-conditioning product to help soften and hydrate. Pure sweet almond oil contains countless nutrients including calcium, magnesium, phosphorous, and vitamin E. These essential vitamins nurture the skin on the outside and when applied topically, promote softer, more nourished skin.. ...
Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Nature 387:75-78.9169867 ...
Vitamin B17 is harmless to healthy tissue for a very simple reason. Each molecule of B17 contains one unit of cyanide, one unit of benzaldehyde and two of glucose (sugar) tightly locked together. In order for the cyanide to become dangerous it is necessary to first unlock the molecule to release it. This can only be performed by an enzyme called beta-glucosidase, which is present all over the human body in minute quantities. However, beta-glucosidase is present in vast quantities (up to 100 times as high) at only one place: the site of a malignant cancer tumour. Thus, the cyanide is unlocked only at the cancer site with drastic results, which become utterly devastating to the cancer cells because the benzaldehyde unit unlocks at the same time ...
Tytu : Rola w glowodan w we wczesnych reakcjach metabolicznych kie kuj cych nasion ubinu pora onych przez Fusarium oxysporum f.sp. lupini ...
EXO1 (Exoglucanase isoenzyme EXO1) antibodies, Anti-EXO1 (Exoglucanase isoenzyme EXO1) antibody, AS08 322Family 3 β-D-glucan glucohydrolases are widely distributed in higher plants. The enzymes catalyse the hydrolytic removal of β-D-glucosyl re
Sweet Almond Oil (Prunis Amygdalus Dulcis)- cold pressed, unrefined, sourced from the almond nut in Australia. Sweet almond oil is rich in vitamins E and A, monosaturated fatty acids, proteins, potassium and zinc. It is a mild, hypoallergenic oil that can be used safely for all ages. It is full of antioxidants to reduc
Gently nourishing. New! Naturally derived ingredients tear free. A gently bubble bath formulated to help leave skin feeling nourished with our unique moisture blend containing jojoba and almond oils. Dermatologist tested. Hypoallergenic. Gentle for babies. Made Without: SLS/Sles; dyes; parabens; phthalates; synthetic fragrance; formaldehyde donors. Our honest purpose to empower people to live happy, healthy lives. honest.com/purpose. Join us at honest.com Please recycle HDPE. Not tested on animals & no animal by products. Made in the USA with US and imported materials ...
Gaucher Disease Gaucher s disease is inherited lipid storage diseases in which the harmful fatty substances (glucocerebroside) start to accumulate excessively in your spleen, liver, lungs, and brain, etc. Cause of insufficient activity of the lysosomal enzyme acid beta-glucosidase. A deadly inherited non-curable disease. This build-up fatty substances interfere with the organs and prevents them … Read more Gaucher Disease - Symptoms, Types And Treatment ...
4IPL: Structural insights into the substrate specificity of a 6-phospho-&[beta]-glucosidase BglA-2 from Streptococcus pneumoniae TIGR4
Beta-glucosidase is a glucosidase enzyme that acts upon β1->4 bonds linking two glucose or glucose-substituted molecules (i.e., the disaccharide cellobiose). It is one o
LalBrew Köln® is ideal for brewing traditional Kölsch-style beers and other neutral ales. The neutral character of this strain accentuates delicate hop aromas while imparting subtle fruity esters. Through expression of a beta-glucosidase enzyme LalBrew® Köln can promote hop biotransformation and accentuate hop flavor and aroma. Colder fermentations will be more neutral in character, while warmer fermentations will have more fruit-forward ester profile.
November 1, 2008 , Article Almond oil is a popular carrier oil because it is non-greasy, spreads easily, and is great for nourishing the skin. Essential oils can be mixed with it because of its light nature. Often called sweet almond oil, it contains strong concentrations of vitamin E.. Keywords: almond oil Secret Ingredient ...
Smooth and soften skin with the intense exfoliating Sea Salt Body Scrub. This salty treatment transforms into a creamy, low foaming lather so you can cleanse while buffing away dead skin cells. Sea Salt helps detoxify while Almond Meal and Walnut Shell naturally exfoliate to reveal softer, more radiant skin. A delicious end of she Butter, Sweet Almond and Jojoba Oils helps soften skin while Honey soothes and moisturizes.. ...
Organic Pistachios Oil. Organic Ground Pistachio. Organic Sweet Almond Oil. Organic Ground Almonds. Illite (French Green Clay). ...
Common Soap Making Ingredients& Saponification ValuesALMOND OIL SWEET:Saponification value of sweet almond oil - 192.3Almond oil has excellent penetrating properties and is beneficial to all skin types. It is particularly good for dry, sensitive skin and can help relieve redness, itchiness, and swelling.>> Wh
The crust is shortbread crumbs and ground almonds, which are complemented by a sweet almond liqueur-flavored mascarpone filling. The crowning touch: an Amaretto and cherry glaze that lightly coats a generous pile of fresh cherries.
As an aside, I suck at coming up with names for products. Part of that is that I dont think its helpful for you, my lovely reader, to see names like sweet almond & aloe lotion and think thats the only way to make that lotion. The part is that although Im a writer, Im not much for flowery language and description. So its easier for me to come up with names like basic lotion with humectants or toner for dry/sensitive skin. Im trying to be more flowery and pretty Pinterest-like, so youll see slightly more descriptive names in the future, but Ill always make it clear that you dont have to use named ingredients if you dont have to do so ...
Cleansing Salt Soap Who should use it?The Cleansing Soap is designed for men and women at all age. Formulated for all skin types.Benefits• Dead Sea minerals stimulate, nourish and heal the skin;• Nourishing oils such as Olive Oil and Sweet Almond Oil, soo
We have created a synergistic complex of active substances to effectively tone the whole body. Collagen, sweet almond oil and shea butter make your skin more supple. The algae extract activates fat tissue burning, while ginkgo biloba stimulates blood circulation inducing the lipolysis process. The serums ingredients help to slow down adipogenesis - the process of creation of fat cells, and lipogenesis, i.e. the process of fat accumulation in the cells. Using Colway Slimming Serum together with healthy diet is a simple step to achieve the figure you have always dreamt of ...
STUFF sweet almond oil: for more on it, see more on that multi-purpose oil ShiKai borage dry skin remedy original unscented lotion: previously mentioned in ersatz (3): moisturiser plus balm for lips and eyes (Dr Bronner unscented) and sunscreen (BurnOut Eco-Sensitive SPF 30; Elemental Herbs SPF 30 sunstick for lips & eyes). METHOD 1. Wash…
Shop oil for every body, everywhere. A decadent blend of Jojoba, Argan & Sweet Almond for rich moisture. Ultra hydrating & versatile for everyday use. Made with love in Portland.
Soap Ma Bergamote - This large soap with its rounded edges is adorned with a classical design inspired by cameo brooches: the head of a young athlete. Together with its Ma Bergamote (My Bergamot) eau de parfum, the soaps formula is enriched with sweet almond oil and Aloe vera. The…
Assume the role of bioengineer as you extract, assess, and optimize cellobiase function for biofuel production and connect enzyme activity with mushroom ecology.
Die Winglet Community bietet ein unabhängiges CME-zertifiziertes Videofortbildungsangebot im Bereich Orthopädie & Unfallchirurgie. Die Online-Plattform bringt Ärzte, Wissenschaftler, Physiotherapeuten, medizinische Fach- und Pflegekräfte sowie Vertreter aus der Industrie auf effiziente Weise zusammen und ermöglicht einen strukturierten und qualitätsgesicherten interdisziplinären Austausch innerhalb des Fachgebiets.
Die GWDG wird Mitglied der Gauß-Allianz. Mobiles MindMapping. Das neue Internet-Protokoll IPv6 - Teil 1: Grundproblematik. Zwei neue Farblaserdrucker für das LRC im KWZ. OptiNum-Grid ermöglicht Simulationen auf Grid-Computing-Ressourcen. Kontingentzuweisung für das dritte Quartal 2012. Das Rechnermuseum der GWDG bei der Jubiläumsausstellung „Dinge des Wissens. Personalia. Betriebsausflug der GWDG am 12.07.2012 ...
18 HBday Tulips Clear View Balloon Themes & Occasions (All Products) Unique and eye catching see-through, non-foil balloons are perfect for any party
"Entrez Gene: GBAP glucosidase, beta; acid, pseudogene". Beutler E, West C, Gelbart T (1992). "Polymorphisms in the human ... Glucosidase, beta; acid, pseudogene, also known as GBAP, is a human gene. GRCh38: Ensembl release 89: ENSG00000160766 - Ensembl ...
... beta-glucosidase (EC 3.2.1.21); beta-galactosidase (EC 3.2.1.23); 6-phospho-beta-galactosidase (EC 3.2.1.85); 6-phospho-beta- ... glucosidase (EC 3.2.1.86); lactase-phlorizin hydrolase (EC 3.2.1.62), lactase (EC 3.2.1.108); beta-mannosidase (EC 3.2.1.25); ... myrosinase (EC 3.2.1.147). 6-phospho-beta-galactosidase InterPro: IPR005928 GBA3; KL; KLB; LCT; LCTL; GH1 in CAZypedia ...
... produces beta-glucosidase. Kim, MK; Srinivasan, S; Park, MJ; Sathiyaraj, G; Kim, YJ; Yang, DC (November 2009 ... nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ...
... produces beta-glucosidase. Parte, A.C. "Dyella". LPSN. "Dyella koreensis". www.uniprot.org. Parker, Charles ... nov., a beta-glucosidase-producing bacterium". International Journal of Systematic and Evolutionary Microbiology. 55 (Pt 4): ...
... beta-glucosidase (EC 3.2.1.21); beta-xylosidase (EC 3.2.1.37); N-acetyl beta-glucosaminidase (EC 3.2.1.52); glucan beta-1,3- ... Varghese JN, Hrmova M, Fincher GB (February 1999). "Three-dimensional structure of a barley beta-D-glucan exohydrolase, a ... glucosidase (EC 3.2.1.58); cellodextrinase (EC 3.2.1.74); exo-1,3-1,4-glucanase (EC 3.2.1). These enzymes are two-domain ...
nov., a beta-glucosidase-producing bacterium in the family Sphingomonadaceae in the alpha-4 subgroup of the Proteobacteria". ... nov., a beta-glucosidase-producing bacterium in the family Sphingomonadaceae in the alpha-4 subgroup of the Proteobacteria". ... Sphingomonas soli produces beta-glucosidase. LPSN lpsn.dsmz.de Straininfo of Sphingomonas soli UniProt Deutsche Sammlung von ...
"Entrez Gene: GBA glucosidase, beta; acid (includes glucosylceramidase)". Deegan PB, Cox TM (2012). "Imiglucerase in the ... Proteopedia Acid-beta-glucosidase Portal: Biology (All articles with dead external links, Articles with dead external links ... acid β-glucosidase (bile acid), also EC 3.2.1.45 GBA3: acid β-glucosidase (cytosolic), EC 3.2.1.21 ENSG00000177628 GRCh38: ... Lieberman RL (2011). "A Guided Tour of the Structural Biology of Gaucher Disease: Acid-β-Glucosidase and Saposin C". Enzyme ...
nov., a beta-glucosidase-producing bacterium". Int J Syst Evol Microbiol. 59 (Pt 9): 2191-4. doi:10.1099/ijs.0.008300-0. PMID ... Castellaniella ginsengisoli is a Gram-negative, oxidase- and catalase-positive, rod-shaped, motile, beta-glucosidase-producing ...
6-phospho-beta-glucosidase (EC 3.2.1.86); 6-phospho-alpha-glucosidase (EC 3.2.1.122); alpha-galactosidase (EC 3.2.1.22); alpha- ... D-glucuronidase (EC 3.2.1.139). 6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+ ... dependent 6-phospho-alpha-glucosidase. Assignment to family 4 of the glycosylhydrolase superfamily". The Journal of Biological ...
y[ _]9 Glycoside hydrolase family 17 CAZY GH_17 comprises enzymes with several known activities; endo-1,3-beta-glucosidase (EC ...
Beta glucosidase activity is regulated via circadian rhythms. Fluorescence studies have shown that the binding sites of leaf ... which is inactivated by hydrolysis of the glycosidic bond via beta glucosidase. In Lespedeza cuneata the leaf opening factor, ...
as the fungus produces a potent beta-glucosidase. trans-Piceid is the glucoside formed with trans-resveratrol, while cis-piceid ... "Purification and characterization of piceid-β-d-glucosidase from Aspergillus oryzae". Process Biochemistry. 42: 83-88. doi: ...
"Entrez Gene: GBA2 glucosidase, beta (bile acid) 2". Land A, Braakman I (2001). "Folding of the human immunodeficiency virus ... Matern H, Boermans H, Lottspeich F, Matern S (Oct 2001). "Molecular cloning and expression of human bile acid beta-glucosidase ... This gene encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous ... Matern H, Heinemann H, Legler G, Matern S (1997). "Purification and characterization of a microsomal bile acid beta-glucosidase ...
Cytosolic beta-glucosidase, also known as cytosolic beta-glucosidase-like protein 1, is a beta-glucosidase (EC 3.2.1.21) enzyme ... Cytosolic beta-glucosidase is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside ... 2010). "The cytosolic beta-glucosidase GBA3 does not influence type 1 Gaucher disease manifestation". Blood Cells Mol. Dis. 46 ... Beutler E, Beutler L, West C (2004). "Mutations in the gene encoding cytosolic beta-glucosidase in Gaucher disease". J. Lab. ...
Nova Hedwigia 44, 121-124, (1987). Beta-glucosidase of a white-rot fungus Trametes gibbosa. Biochem. Internat. 28(5), With ...
USA (2019-05-06). "Trifolium repens mRNA for non-cyanogenic beta-glucosidase - Nucleotide - NCBI". Ncbi.nlm.nih.gov. Retrieved ...
... phloridzin beta-glucosidase, lactase-phlorizin hydrolase, and phloridzin glucosidase. Leese HJ, Semenza G (1973). "On the ... Malathi P, Crane RK (1969). "Phlorizin hydrolase: a beta-glucosidase of hamster intestinal brush border membrane". Biochim. ... Other names in common use include phlorizin hydrolase, phloretin-glucosidase, glycosyl ceramide glycosylhydrolase, ...
"Screening of carbon sources for beta-glucosidase production by Aspergillus saccharolyticus". International Biodeterioration & ...
Chinchetru MA, Cabezas JA, Calvo P (1989). "Purification and characterization of a broad specificity beta-glucosidase from ... beta-xylosidase, exo-1,4-beta-xylosidase, beta-D-xylopyranosidase, exo-1,4-xylosidase, exo-1,4-beta-D-xylosidase, 1,4-beta-D- ... Xylan+1,4-beta-xylosidase at the US National Library of Medicine Medical Subject Headings (MeSH) Portal: Biology (EC 3.2.1). ... This enzyme catalyses the following chemical reaction Hydrolysis of (1->4)-beta-D-xylans, to remove successive D-xylose ...
nov., with Beta-Glucosidase Activity Isolated from Soil of a Ginseng Field". Current Microbiology. 74 (12): 1417-1424. doi: ...
... is a potent irreversible inhibitor of beta-glucosidases. It is a cyclitol mimic of beta-glucose with an epoxide ... Gloster, T. M., Madsen, R. and Davies, G. J. (2007) 'Structural basis for cyclophellitol inhibition of a β-glucosidase', ... 1990) 'Production, isolation and structure determination of a novel β-glucosidase Inhibitor, cyclophellitol, from phellinus sp ...
... may refer to: Gelatinase biosynthesis-activating pheromone, a bacterial peptide Glucosidase, beta; acid, pseudogene, a ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ...
Li, Dan (May 2013). "Characterization and application of an acidophilic and thermostable beta-glucosidase from Thermofilum ...
"Cuckoo fungus mimics termite eggs by producing the cellulose-digesting enzyme beta-glucosidase". Current Biology. 19 (1): 30-6 ...
Different mutations in the GBA (beta-glucosidase) gene determine the remaining activity of the enzyme. In type I, there is some ... Numerous different mutations occur; sequencing of the beta-glucosidase gene is sometimes necessary to confirm the diagnosis. ... also known as beta-glucosidase, EC 3.2.1.45, PDB: 1OGS​) on the first chromosome (1q22). The enzyme is a 55.6-kilodalton, 497- ... the origins of the Ashkenazi Jewish N370S and 84GG acid beta-glucosidase mutations". American Journal of Human Genetics. 66 (6 ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". Int. J. Syst. Evol. Microbiol. 56 (Pt 11 ... Paraburkholderia ginsengisoli has the ability to produce β-glucosidase. Sawana A, Adeolu M, Gupta RS. (2014). "Molecular ...
... , or beta-D-glucosidase (EC 3.2.1.21), is an enzyme found in many plants including cassava and the butter bean. In ... "Purification and properties of beta-D-glucosidase (linamarase) from the butter bean, Phaseolus lunatus". Last accessed 13 ...
These enzymes include amygdalin beta-glucosidase, prunasin beta-glucosidase and mandelonitrile lyase. In contrast, although the ...
Glucosidases. *Cellulase. *Alpha-glucosidase *Acid. *Neutral AB. *Neutral C. *Beta-glucosidase *cytosolic ...
Main article: Glucan 1,4-a-glucosidase. γ-Amylase (EC 3.2.1.3 ) (alternative names: Glucan 1,4-a-glucosidase; amyloglucosidase ... Main article: Beta-Amylase. Another form of amylase, β-amylase (EC 3.2.1.2 ) (alternative names: 1,4-α-D-glucan maltohydrolase ... exo-1,4-α-glucosidase; glucoamylase; lysosomal α-glucosidase; 1,4-α-D-glucan glucohydrolase) will cleave α(1-6) glycosidic ... Different temperatures optimize the activity of alpha or beta amylase, resulting in different mixtures of fermentable and ...
The enzyme vicianin beta-glucosidase uses (R)-vicianin and water to produce mandelonitrile and vicianose. The fruits of ...
... and that its fruit does not contain enough beta-glucosidase (which convert glucosides into cyanide) to create cyanide within ...
Peng, L; Kawagoe, Y; Hogan, P; Delmer, D (2002). "Sitosterol-beta-glucoside as primer for cellulose synthesis in plants". ... the glycosidic linkage in cellulose are glycoside hydrolases including endo-acting cellulases and exo-acting glucosidases. Such ... Cellulose synthase (CesA) initiates cellulose polymerization using a steroid primer, sitosterol-beta-glucoside, and UDP-glucose ...
It is a multienzyme complex which possesses alpha-L-rhamnosidase and beta glucosidase active centers. The E.C. No.(EC 3.2.1.40 ... Lastly glucosidase breaks prunin into glucose and naringenin, a flavorless flavanone also found in various citrus. Ram gene is ...
Jul 1994). "The design of potential antidiabetic drugs: experimental investigation of a number of beta-D-glucose analogue ... and then a α1-6 glucosidase enzyme is required to break the remaining (single glucose) α1-6 residue that remains in the new ...
Second is an N-terminal beta-sandwich domain, identified via two antiparallel beta pleated sheets. The third and largest domain ... "Entrez Gene: maltase-glucoamylase (alpha-glucosidase)". Nichols BL, Eldering J, Avery S, Hahn D, Quaroni A, Sterchi E (January ... The fourth and 5th domains are C-terminal domains, similar to the N-terminal beta-sandwich domain. The N-terminal Maltase- ... Alpha-glucosidase Maltase ENSG00000282607 GRCh38: Ensembl release 89: ENSG00000257335, ENSG00000282607 - Ensembl, May 2017 ...
... at the US National Library of Medicine Medical Subject Headings (MeSH) GO-database listing 'GO:0016162 ... 6-glucosidase. Amygdalin β-glucosidase Cellulase, a suite of enzymes produced chiefly by fungi, bacteria, and protozoans that ... a related enzyme Prunasin β-glucosidase Vicianin β-glucosidase PDB: 3AHX​; Jeng WY, Wang NC, Lin MH, Lin CT, Liaw YC, Chang WJ ... β-D-glucosidase, β-glucoside glucohydrolase, arbutinase, amygdalinase, p-nitrophenyl β-glucosidase, primeverosidase, amygdalase ...
"The iminosugar isofagomine increases the activity of N370S mutant acid beta-glucosidase in Gaucher fibroblasts by several ...
... the presence of the thioether linkage making it resistant to degradation by beta-glucosidase enzymes. N-alkyl thioglycosides of ... "Process for the preparation of pentaacetyl-beta-D-glucopyranose", published 2000-10-04, assigned to Nisshin Flour Milling Co., ... especially against degradation by β-glucosidases. ++ very good + good (+) ok (-) poor - very poor The cost advantage for ... 1-octanol by means of β-glucosidase). The α-anomeric octylthioglucoside exhibits liquid crystalline properties forming a ...
Under laboratory conditions, P. destructans has been shown to produce numerous enzymes including β-glucosidase, esterase/ ... alpha/beta-galactosidase, β-glucuronidase, α-fucosidase, α-mannosidase, and trypsin. Important dual virulence factors found in ...
It is also a complete inhibitor of the enzyme amygdalin beta-glucosidase at concentrations of 1 mM. Glucuronolactone Budavari, ...
Cellulose 1,4-beta-cellobiosidase, an efficient cellulase Cellulase unit, a unit for quantifying cellulase activity PDB: 1NLR​ ... The ancillary enzyme present in the reagent mixture (β-glucosidase) then acts to hydrolyse the fragment containing the ... Cellobiases (EC 3.2.1.21) or β-glucosidases hydrolyse the exocellulase product into individual monosaccharides. Oxidative ... Separation and characterization of cellulases and β-glucosidases". The Biochemical Journal. 177 (1): 9-19. doi:10.1042/ ...
... the enzyme that transforms coniferyl alcohol into coniferin Coniferin beta-glucosidase, in the glucosidase that transforms ... 2-coumarate O-beta-glucosyltransferase, the enzyme that transforms trans-2-hydroxycinnamate into trans-beta-D-glucosyl-2- ... hydroxycinnamate Hydroxycinnamate 4-beta-glucosyltransferase, the enzyme that transforms p-coumaric acid into 4-O-beta-D- ... an enzyme that transforms 1-O-sinapoyl-beta-D-glucose into sinapoyl-(S)-malate Cinnamoyl-CoA reductase, an enzyme that ...
2009). "Acid beta-glucosidase 1 counteracts p38delta-dependent induction of interleukin-6: possible role for ceramide as an ... 2008). "Implication of p38 mitogen-activated protein kinase isoforms (alpha, beta, gamma and delta) in CD4+ T-cell infection ...
It forms a beta sandwich module. The crystal structures are shown here on either side of the page. The two structures of endo- ... glucosidases and mannosidases". J. Am. Chem. Soc. 65 (7): 1369-1380. doi:10.1021/ja01247a029. Liu Y, Zhou SH, Cheng YR, Chi Z, ... Being made of beta sheets allows the structures to be more stable during chemical reactions. Both of the inulinases have ... Inulinase contains a N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure and C ...
... also called beta blockers). Other medications with very low quality evidence include the antibiotics levofloxacin and ... alpha-glucosidase inhibitors, glucagon-like peptide 1 agonists, and dipeptidyl peptidase IV inhibitors, do not cause ... not point-of-care measurement Insulin level C-peptide level Proinsulin level Beta-hydroxybutyrate level Oral hypoglycemic agent ... as well as medical treatment with an alpha-glucosidase inhibitor, diazoxide, or octreotide. Some causes of hypoglycemia require ...
June 2000). "Gaucher disease: the origins of the Ashkenazi Jewish N370S and 84GG acid beta-glucosidase mutations". American ...
... glucosidase inhibitor or a Nrf2‐inducer". Aging Cell. 15 (5): 872-884. doi:10.1111/acel.12496. ISSN 1474-9718. PMC 5013015. ... "Comparison of the ligand binding specificity and transcript tissue distribution of estrogen receptors alpha and beta". ... structure-activity relationship of various endogenous estrogen metabolites for human estrogen receptor alpha and beta subtypes ...
... beta-sheets, and loops (secondary structure). Also, weak interactions (such as hydrogen bonds) stabilize the protein fold. ... "Molecular Dynamics Gives New Insights into the Glucose Tolerance and Inhibition Mechanisms on β-Glucosidases". Molecules. 24 ( ...
6-glucosidase (EC 3.2.1.33), or glucosidase, cleaves the remaining alpha-1,6 linkage, producing glucose and a linear chain of ... The monomeric protein contains a central domain in which eight parallel beta-strands are surrounded by eight parallel alpha ... usually refers to the glucosidase enzyme. In some literature, an enzyme capable only of glucosidase is referred to as a " ... Glucosyltransferase and glucosidase are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct ...
beta-Glucosidase at the US National Library of Medicine Medical Subject Headings (MeSH) GO-database listing GO:0016162 ... 6-glucosidase. Amygdalin β-glucosidase Cellulase, a suite of enzymes produced chiefly by fungi, bacteria, and protozoans that ... a related enzyme Prunasin β-glucosidase Vicianin β-glucosidase PDB: 3AHX​; Jeng WY, Wang NC, Lin MH, Lin CT, Liaw YC, Chang WJ ... β-D-glucosidase, β-glucoside glucohydrolase, arbutinase, amygdalinase, p-nitrophenyl β-glucosidase, primeverosidase, amygdalase ...
The Mechanism of Substrate (Aglycone) Specificity in Beta -Glucosidases is Revealed by Crystal Structures of Mutant Maize Beta ... BETA-GLUCOSIDASE, CHLOROPLASTIC. A, B. 512. Zea mays. Mutation(s): 1 Gene Names: GLU1. EC: 3.2.1.21 (PDB Primary Data), 3.2. ... in beta-glucosidases. The data also provide a plausible explanation for the competitive binding of dhurrin to maize beta- ... Crystal structure of the inactive mutant Monocot (Maize ZMGlu1) beta-glucosidase ZM Glu191Asp. *PDB DOI: 10.2210/pdb1E4L/pdb ...
Beta-glucosidase from Thermotoga maritima in complex with azafagomine ... BETA-GLUCOSIDASE A. A, B. 468. Thermotoga maritima. Mutation(s): 0 EC: 3.2.1.21. ... Beta-glucosidase from Thermotoga maritima in complex with azafagomine. *PDB DOI: 10.2210/pdb2J7H/pdb ... the Thermotoga maritima family 1 beta-glucosidase, TmGH1. The pH dependence of enzyme activity and inhibition has been ...
Department of Chemistry, UBC Faculty of Science. Vancouver Campus. 2036 Main Mall. Vancouver, BC Canada V6T 1Z1. Tel: 604.822.3266. Fax: 604.822.2847. ...
GLYCOSIDE HYDROLASE, BETA-GLUCOSIDASE, FAMILY 1, RETENTION OF THE ANOMERIC CONFIGURATION, HYDROLASE ... Insights into the functional architecture of the catalytic center of a maize beta-glucosidase Zm-p60.1 ... CRYSTAL STRUCTURE OF THE MAIZE ZM-P60.1 BETA-GLUCOSIDASE. .shs-wrapper-processed { display:flex; flex-direction: row; flex-wrap ...
"β-glucosidase from Sweet almond β-D-glucoside glucohydrolase EC # 3.2.1.21 If you need bigger quantities than indicated on the ... Beta-glucosidase. β-glucosidase from Sweet almond β-D-glucoside glucohydrolase EC # 3.2.1.21 ...
... aryl-beta-glucosidase, beta-D-glucosidase, beta-glucoside glucohydrolase, arbutinase, amygdalinase, p-nitrophenyl beta- ... and beta-1,6-glucosidase. Cellulose is a polymer composed of beta-1,4-linked glucosyl residues. Cellulases (endoglucanases), ... and beta-glucosidases are required by organisms (some fungi, bacteria) that can consume it. These enzymes are powerful tools ... Beta-glucosidase catalyzes the hydrolysis of the glycosidic bonds to terminal non-reducing residues in beta-D-glucosides and ...
The GBA gene provides instructions for making an enzyme called beta-glucocerebrosidase. Learn about this gene and related ... glucosidase, beta; acid (includes glucosylceramidase). *glucosphingosine glucosylhydrolase. *glucosylceramide beta-glucosidase ... Beta-glucocerebrosidase is a housekeeping enzyme that helps break down a large molecule called glucocerebroside into a sugar ( ... Most of the GBA gene mutations responsible for Gaucher disease change single protein building blocks (amino acids) in beta- ...
CRYSTAL STRUCTURE OF ACID-BETA-GLUCOSIDASE AT PH 5.5 - 3GXI , canSARS ...
Beta-adrenergic blocking agents. Class Summary. Beta-adrenergic blocking agents affect blood pressure via multiple mechanisms. ... Antidiabetics, Alpha-Glucosidase Inhibitors. Class Summary. Alpha-glucosidase inhibitors decrease the breakdown of ... Mediators of diabetic renal disease: the case for tgf-Beta as the major mediator. J Am Soc Nephrol. 2004 Jan. 15 Suppl 1:S55-7 ... It is a beta-adrenergic blocking agent that affects blood pressure via multiple mechanisms. Actions include negative a ...
Glucosidase 2 beta (80-KH). [P14314]. 28. 2. 7. Invasion. [65]. © 2017 by the authors. Licensee MDPI, Basel, Switzerland. This ...
BETA-GLUCOSIDASE FROM LISTERIA INNOCUA IN COMPLEX WITH SOPHOROTRIOSE - 4ZOC , canSARS ... CRYSTAL STRUCTURE OF MUTANT (D270A) BETA-GLUCOSIDASE FROM LISTERIA INNOCUA IN COMPLEX WITH SOPHOROTRIOSE ... CRYSTAL STRUCTURE OF MUTANT (D270A) BETA-GLUCOSIDASE FROM LISTERIA INNOCUA IN COMPLEX WITH SOPHOROTRIOSE ...
Crystal Structure of the Covalent Intermediate of Human Cytosolic Beta-Glucosidase-Mannose Complex ... The structure of Crystal Structure of the Covalent Intermediate of Human Cytosolic Beta-Glucosidase-Mannose Complex also ... The structure of Crystal Structure of the Covalent Intermediate of Human Cytosolic Beta-Glucosidase-Mannose Complex, PDB code: ... Magnesium in PDB 3vkk: Crystal Structure of the Covalent Intermediate of Human Cytosolic Beta-Glucosidase-Mannose Complex. ...
Beta-adrenergic blocking agents. Class Summary. Beta-adrenergic blocking agents affect blood pressure via multiple mechanisms. ... Antidiabetics, Alpha-Glucosidase Inhibitors. Class Summary. Alpha-glucosidase inhibitors decrease the breakdown of ... Mediators of diabetic renal disease: the case for tgf-Beta as the major mediator. J Am Soc Nephrol. 2004 Jan. 15 Suppl 1:S55-7 ... It is a beta-adrenergic blocking agent that affects blood pressure via multiple mechanisms. Actions include negative a ...
glucosidase, beta, acid 606463 CCHMC - Human Genetics Mutation Database Ammar Husami, Brian Richardson, Edita Freeman, Kerry ... gap junction protein, beta 2, 26kDa 121011 The UMD DFNB1-GJB2 mutations database A.-F. Roux and D. Baux ... glucosidase, alpha; acid 606800 GAA - Pompe disease (glycogen storage disease type II) Johan T. den Dunnen, LUMC, The ... gap junction protein, beta 2, 26kDa 121011 Hereditary Hearing Loss Homepage Guy van Camp, Univ. of Antwerp, Antwerp, Belgium, ...
Human acid beta-glucosidase: isolation and amino acid sequence of a peptide containing the catalytic site. Proc. Natl Acad. Sci ... Glucosylceramidase (GBA), also called beta-glucosidase and glucocerebrosidase, is a lysosomal enzyme responsible for converting ... Zhang, Y., Zhu, K. Y., Miao, X. F., Hu, X. Q. & Wang, T. Identification of β-glucosidase 1 as a biomarker and its high ... Magnetically directed enzyme/prodrug prostate cancer therapy based on β-glucosidase/amygdalin. Int. J. Nanomed. 15, 4639-4657 ( ...
PODOPHYLLUM PELTATUM POSSESSES A BETA-GLUCOSIDASE WITH HIGH SUBSTRATE SPECIFICITY FOR THE ARYLTETRALIN LIGNAN PODOPHYLLOTOXIN ( ...
Gaucher Disease Cerebroside Lipidosis Syndrome Glucocerebrosidase Deficiency Disease Glucosylceramide Beta-Glucosidase ...
Beta-Glucosidase. *Betulinic Acid. *Bevacizumab. *Bid. *BIK Proapoptotic Protein. *Bile Acids. *Bile Duct Neoplasms ...
glucan exo-1,3-beta-glucosidase Feature Type. ORF , Verified EC Number. 3.2.1.58 ...
... beta-glucosidase. The fluorescence indicates the presence of an active spore-associated enzyme and a sterilization process ...
The mechanism of substrate (aglycone) specificity in beta -glucosidases is revealed by crystal structures of mutant maize beta ... recognition and specificity were investigated in maize beta-glucosidase (Glu1) by x-ray crystallography by using crystals of a ... glucosidase-DIMBOA, -DIMBOAGlc, and -dhurrin complexes.. *M. Czjzek, M. Cicek, V. Zamboni, D. Bevan, B. Henrissat, A. Esen ... Two beta-agarase genes, agaA and agaB, were functionally cloned from the marine bacterium Zobellia galactanivorans and it is ...
Read about Beta-glucans uses, side effects, health benefits, interactions, dose, warnings, and precautions. ... Ketudat Cairns, J. R. and Esen, A. beta-Glucosidases. Cell Mol.Life Sci. 2010;67(20):3389-3405. View abstract. ... Beta 1,6 Glucan, Bêta 1,6 Glucane, beta-1-6,1,3-beta-glucan, Beta 1,3 Glucans, Bêta 1,3 Glucanes, Beta Glucan, Beta-Glucan, ... 1-3,1-6-beta-glucan, 1-3,1-6-bêta-glucane, B-Glucane dAvoine, Barley Beta-Glucan, Barley B-Glucan, beta-1,3-D-glucan, Beta-1,3 ...
Lallzyme BETA™ is a blend of pectinases with beta-glucosidase, rhamnosidase, apiosidase and arabinofuranosidase. The sequential ... Lallzyme BETA™ has been formulated to act in a gentle way so it will not lead to an over-expression of aromas. For more ... Lallzyme BETA™ is formulated for use in white wine varieties high in "bound" terpenols, such as Gewürztraminer and Muscat. ...
The disorder results from the deficiency of a specific lysosomal hydrolase, glucocerebrosidase (also termed acid beta- ... also termed acid beta-glucosidase, glucosylceramidase). The disease is characterized by a continuum of phenotypes. The severity ...
The cytokinin dehydrogenase 1 gene is under the control of the root-specific β-glucosidase promoter from maize. The Hygromycin ... by inserting the Arabidopsis thaliana cytokinin dehydrogenase 1 gene under the control of the root-specific β-glucosidase ... Beta-glucosidase gene promoter , Zea mays (Maize, Corn, MAIZE). Promoter. * BCH-GENE-SCBD-108701-2 Cytokinin dehydrogenase 1 ...
PDB Description: 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa ... Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies). contains parallel beta-sheet barrel, closed; n=8, S=8; strand order ... d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa} tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry ... Class c: Alpha and beta proteins (a/b) [51349] (117 folds). *. ...
  • The disorder results from the deficiency of a specific lysosomal hydrolase, glucocerebrosidase (also termed acid beta-glucosidase, glucosylceramidase). (medscape.com)
  • beta-glucosidase;PA14 domain;Glycosyl hydrolase family 3. (ntu.edu.sg)
  • beta-glucosidase;Glycosyl hydrolase family 3 C-terminal. (ntu.edu.sg)
  • beta-glucosidase, variant 2;Glycosyl hydrolase family 3. (ntu.edu.sg)
  • Snapshots along an enzymatic reaction coordinate: analysis of a retaining beta-glycoside hydrolase. (novosides.eu)
  • The solely family 3 glycoside hydrolase for which a three-dimensional construction is accessible is a beta-glucan exohydrolase from barley. (novosides.eu)
  • Two residues that have been implicated in determining the substrate specificity of the thermophilic beta-glycosidase from the archaeon Sulfolobus solfataricus (SsbetaG), a member of the glycosyl hydrolase family 1, have been mutated by site-directed mutagenesis so as to create more versatile catalysts for carbohydrate chemistry. (ox.ac.uk)
  • We utilised two strategies to over-express β-glucosidase in the strain RE-10 that-although over-producing cellulase, does so at the cost of the cellulase mixture deficiency. (biomedcentral.com)
  • In summary, genetically engineering P . oxalicum to significantly improve β-glucosidase activity is a potent strategy to substantially boost the hydrolytic efficiency of the cellulase cocktail, which will ultimately lead to a considerable reduction of cost for biomass-based biofuel. (biomedcentral.com)
  • Mathematical models were built to describe the five dependents variables (concentrations of cells and substrate, as well as activities of cellulase (FPase), beta-glucosidase and xylanase). (unicamp.br)
  • This response is characterized by an increase in the production of enzymes, including amylase, cellulase and beta-glucosidase, that is not associated with the enzymes present in the Amaferm ferment itself. (biozymeinc.com)
  • Although cellulases have been roughly classified into three enzyme groups of beta-glucosidase, endo-β-1,4-glucanase and exoglucanase, these findings suggest the importance to consider microbial cellulolysis as a more complex reaction with various kinds of cellulase enzymes. (biomedcentral.com)
  • In the optimal pretreatment conditions (90 h, 90 A degrees C, 0.47 g lime/g bagasse) and industrially realistic conditions of hydrolysis (12.7 FPU/g of cellulase and 7.3 CBU/g of beta-glucosidase), 139.6 kg lignin/ton raw bagasse and 126.0 kg hemicellulose in the pretreatment liquor per ton raw bagasse were obtained. (uchile.cl)
  • Glucan endo-1,3-beta-glucosidase GII OS=Hordeum vulgare. (ntu.edu.sg)
  • Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis. (ntu.edu.sg)
  • Probable glucan endo-1,3-beta-glucosidase A6. (ntu.edu.sg)
  • Glucan endo-1,3-beta-glucosidase A OS=Solanum. (ntu.edu.sg)
  • Glucan endo-1,3-beta-glucosidase, basic isoform 2. (ntu.edu.sg)
  • systematic name β-D-glucoside glucohydrolase) is an enzyme that catalyses the following reaction: Hydrolysis of terminal, non-reducing β-D-glucosyl residues with release of β-D-glucose β-Glucosidase is composed of two polypeptide chains. (wikipedia.org)
  • In the case of the Christmas Island red crab β-glucosidase not only produces glucose, but also removes cellobiose. (wikipedia.org)
  • Beta-glucosidase catalyzes the hydrolysis of the glycosidic bonds to terminal non-reducing residues in beta-D-glucosides and oligosaccharides, with release of glucose. (lexipedia.org)
  • Beta-glucocerebrosidase is a housekeeping enzyme that helps break down a large molecule called glucocerebroside into a sugar (glucose) and a simpler fat molecule (ceramide). (medlineplus.gov)
  • Glucosylceramidase (GBA), also called beta-glucosidase and glucocerebrosidase, is a lysosomal enzyme responsible for converting glycosylceramide to glucose and ceramide by cleaving the glycosidic linkage 11 . (nature.com)
  • Bacteria tested positive for beta-glucosidase and reduction of nitrate to nitrite, but negative on most tests, including indol production, urease, glucose fermentation, gelatin hydrolysis, and beta-galactosidase. (kenyon.edu)
  • In this study, the effects on cellulolytic glucose yields of glucose inhibition and in situ glucose removal were examined and modeled during extended treatment of heat-pretreated wheat straw with the cellulolytic enzyme system, Celluclast (R) 1.5 L, from Trichoderma reesei, supplemented with a beta-glucosidase, Novozym (R) 188, from Aspergillus niger. (dtu.dk)
  • It consists of a molecule of D-galactose and a molecule of D-glucose bonded by beta-1-4 glycosidic linkage. (theinfolist.com)
  • However, only a few proteins related to primary metabolism and signal transduction, such as UDP - glucose dehydrogenase, UGP, beta glucosidases, were reported to response to waterlogging stress in wheat. (edu.au)
  • This promiscuous substrate tolerance was further illustrated by the parallel synthesis of a beta-glycoside library of glucose, galactose, xylose and mannose in one pot at 50 degrees C, in organic solvent. (ox.ac.uk)
  • Treatment of severe hyperglycemia during acute decompensation in a patient with type 2 diabetes may reverse the state of glucose toxicity, further improving secretory function of beta cells in the pancreas. (medscape.com)
  • However, humans do require β-glucosidase, Lysosomal β-glucosidase, as it plays an important role in the degradation of glycosphingolipids. (wikipedia.org)
  • Alkaloids 3, 4, and 6 showed a potent inhibitory activity toward rat lysosomal beta-glucosidase, with IC(50) values of 2.1, 0.75, and 0.84 microM, respectively, and alkaloid 5 was a moderate inhibitor of alpha- and beta-mannosidases. (erowid.org)
  • 36. Grabowski, G.A., and Dagan, A. (1984) Human lysosomal β-glucosidase: Purification by affinity chromatography. (cram.com)
  • The cause of Gaucher disease is a recessive mutation in a houskeeping gene lysosomal glucocerebrosidase (beta-glucosidase, glucosylceramidase) on chromosome 1 (1q21), coding for an enzyme. (tu-muenchen.de)
  • 1993. 4-methylumbelliferyl-beta-N-acetylglucosaminide hydrolysis by a high-affinity enzyme, a putative marker of protozoan bacterivory . (jcu.cz)
  • The GBA gene provides instructions for making an enzyme called beta-glucocerebrosidase. (medlineplus.gov)
  • It gets broken down by beta-glucocerebrosidase when cells die, and the components are reused as new cells are formed. (medlineplus.gov)
  • Most of the GBA gene mutations responsible for Gaucher disease change single protein building blocks (amino acids) in beta-glucocerebrosidase, altering the structure of the enzyme and preventing it from working normally. (medlineplus.gov)
  • Mutations in the GBA gene greatly reduce or eliminate the activity of beta-glucocerebrosidase in cells. (medlineplus.gov)
  • These mutations result in the production of an altered beta-glucocerebrosidase enzyme. (medlineplus.gov)
  • Low levels of the enzyme, beta-glucocerebrosidase, might indicate that your baby has Gaucher. (babysfirsttest.org)
  • It also allowed the detection of most Fabry (agalactosidase), Pompe ([beta]-glucosidase), and Gaucher disease ([beta]-glucocerebrosidase) patients, as well as patients with I-cell disease. (thefreedictionary.com)
  • β-Glucosidase is also capable of hydrolysis on small oligomers that are produced by other enzymes without the assistance of an intermediate enzyme. (wikipedia.org)
  • The endo-beta-agarases AgaA and AgaB from the marine bacterium Zobellia galactanivorans: two paralogue enzymes with different molecular organizations and catalytic behaviours. (semanticscholar.org)
  • Early research suggests that taking a specific product (Biointol) containing beta-glucans, inositol, and digestive enzymes reduces pain, bloating , and gas , but not other symptoms of IBS . (emedicinehealth.com)
  • Four enzymes activities (EAs) have been targeted as soil health indicators for their important role in reactions releasing bioavailable nutrients within C (β-glucosidase), N and C (β-glucosaminidase), P (acid phosphomonoesterase) and S (arylsulfatase) cycling. (usda.gov)
  • Beta-amylase-SARMs: Alpha-amylase enzymes increase the level of glycogen. (cobotcell.net)
  • We measured potential activities of five main soil enzymes (beta-glucosidase, cellobiohydrolase, Leu-aminopeptidase, Ala-aminopeptidase, and phosphatase) responsible for organic carbon, nitrogen and phosphorus acquisition. (jcu.cz)
  • Results: Amplified activities of fecal bacterial (\beta-glucuronidase, \beta-glucosidase, \beta-galactosidase, nitroreductase, hyaluronate lyase, and sulfatase) and colonic biotransformation (\beta-glucuronidase, \beta-glucosidase, \beta-galactosidase, and nitroreductase) enzymes were considered hallmarks of colon carcinogenesis. (tubitak.gov.tr)
  • Treatment with \beta-sitosterol markedly decreased the fecal bacterial and colonic biotransformation enzymes and reverted the colonic tissue to near normal. (tubitak.gov.tr)
  • Conclusion: The results of the present study revealed that \beta-sitosterol markedly inhibited DMH-induced colon carcinogenesis by its ability to ameliorate the fecal bacterial and colonic biotransformation enzymes. (tubitak.gov.tr)
  • In all the samplings, the soil organic C, the activities of beta-glucosidase, beta-glucosaminidase, acid phosphatase, alkaline phosphatase and phosphodiesterase, and the intracellular and total arylsulfatase activity were higher in continuous peanut than in the peanut-cotton rotations. (usda.gov)
  • CONCLUSION: In children with hepatosplenomegaly and increased acid phosphatase, assay of beta-glucosidase enzyme confirms the diagnosis of Gaucher disease. (who.int)
  • E-LAMHV - endo -1,3-β-D-Glucanase (barley) E-BGLUC - β-Glucosidase ( Aspergillus niger ) E-BGOSAG - β-Glucosidase ( Agrobacterium sp. (jinpanbio.com)
  • Here we describe a synergistic approach for analysis of inhibitors with a single enzyme 'model system', the Thermotoga maritima family 1 beta-glucosidase, TmGH1. (rcsb.org)
  • Alpha-Glucosidase inhibitors may come across trustableshop. (gors.nl)
  • The constitutive promoter of gene pde_02864 encoding 40S ribosomal protein S8 was used to over-express three β-glucosidases: BGL1, BGL4, and BGL5. (biomedcentral.com)
  • We found that all mutants show significantly enhanced levels of β-glucosidase at transcriptional, protein, and activity levels. (biomedcentral.com)
  • RESULTS: The enzyme beta-glucosidase was 0.65 nmol/h/mg of protein or less in all the cases in Delhi, and 2.5 nmol/h/mg of protein or less in Bombay. (who.int)
  • Mashing malt using an isothermal hot water extract (HWE) procedure instead of the standard Congress mash generated distinct but closely related values for primary measures of malt modification, including malt extract, wort soluble protein, soluble/total malt protein, wort beta-glucan, and wort free amino nitrogen. (researchgate.net)
  • To discharge benzaldehyde and cyanide from nutrient B17, it is important to come into contact with a particular protein beta-adjuvant. (organicandnutritious.com)
  • We found that the over-expression of BGL1, BGL4, or BGL5 significantly enhanced both β-glucosidase activity and hydrolysis efficiency of the enzyme system on filter paper. (biomedcentral.com)
  • In addition to this type of genetic testing, diagnostic tests, including beta-glucosidase leukocyte (BGL) tests , can help confirm a Gaucher disease diagnosis. (gaucherdisease.org)
  • The diagnosis was substantiated by histochemical demonstration of Gaucher cells in bone marrow, liver, and spleen, the finding of an excess of glucosyl ceramides in a liver extract, and a deficient activity of the enzyme beta-glucosidase in cultured skin fibroblasts. (bmj.com)
  • Across the situation was the small patient Deborah Fonseca de Souza, 12, holder of Gaucher disease (caused by a deficiency in the enzyme beta-glucosidase, which causes decreased number of platelets in the blood), who along with his mother, Rosineida, thanked all donations that action SBT / Pará, as well as others who participate in the campaign carnival. (isaude.net)
  • Chlorpropamide is a first-generation sulfonylurea that stimulates release of insulin from pancreatic beta cells. (medscape.com)
  • Sulfonylureas stimulate insulin release from pancreatic beta cells. (medscape.com)
  • Chlorpropamide may increase insulin secretion from pancreatic beta cells. (medscape.com)
  • Tolbutamide increases insulin secretion from pancreatic beta cells. (medscape.com)
  • Stimulates insulin release from pancreatic beta cells. (medscape.com)
  • Nateglinide interacts with the adenosine triphosphate (ATP) ̶ sensitive potassium channel on pancreatic beta cells. (medscape.com)
  • The data also provide a plausible explanation for the competitive binding of dhurrin to maize beta-glucosidases with high affinity without being hydrolyzed. (rcsb.org)
  • The bGLU:CKX1 barley line has been genetically modified by inserting the Arabidopsis thaliana cytokinin dehydrogenase 1 gene under the control of the root-specific β-glucosidase promoter from maize. (cbd.int)
  • The first step involves the removal of one of the two -D-gluco pyranosyl groups from amygdalin through the action of beta-glucosidase to form the cyanogenic glycoside, prunasin. (cdc.gov)
  • Prunasin beta-glucosidase. (uma.es)
  • DESIGN: Assay of beta glucosidase enzyme in leucocytes in patients with splenomegaly, and in chorionic villi for prenatal diagnosis. (who.int)
  • Liquid Chromatography-Tandem Mass Spectrometry Assay of Leukocyte Acid a-Glucosidase for Post-Newborn Screening Evaluation of Pompe Disease. (cdc.gov)
  • β-glucosidases, Cellulases (endoglucanases), cellobiosidases (exoglucanases) are required by a number of organisms to consume it. (wikipedia.org)
  • Cellulases (endoglucanases), cellobiosidases (exoglucanases), and beta-glucosidases are required by organisms (some fungi, bacteria ) that can consume it. (lexipedia.org)
  • In the case of β-glucosidase, two carboxylate residues of glucosides, cellobiose, cellotriose, cellotetraose are involved at the active site. (wikipedia.org)
  • All residues but W378 are variable among beta-glucosidases that differ in substrate specificity, supporting the conclusion that these sites are the basis of aglycone recognition and binding (i.e., substrate specificity) in beta-glucosidases. (rcsb.org)
  • Cellulose is a polymer composed of beta-1,4-linked glucosyl residues. (lexipedia.org)
  • Developing promiscuous glycosidases for glycoside synthesis: residues W433 and E432 in Sulfolobus solfataricus beta-glycosidase are important glucoside- and galactoside-specificity determinants. (ox.ac.uk)
  • Taking beta-glucans made from yeast or barley seems to reduce total cholesterol and low-density lipoprotein (LDL or "bad") cholesterol in people with high cholesterol after several weeks of treatment. (emedicinehealth.com)
  • Research suggests that taking a specific product containing yeast beta-glucans (Wellmune WGP) daily for 4 weeks reduces allergies in people allergic to ragweed. (emedicinehealth.com)
  • sta1 (diastatic) + beta glucosidase +Gist typen: Brettanomyces, Wild yeast, Kviek, Spontaneous. (mbse.eu)
  • Structural and functional analysis of three β-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis" (PDF). (wikipedia.org)
  • So when someone ingest amygdalin or b-17 it's not selective for cancer cells only, some normal cells absorb it too…however because normal cells do not have that enzyme, that cancer cells have, called - "beta-glucosidase" then when vitamin b17 penetrates a cancer cell that enzyme breaks up the b17 molecule and causes the release of cyanide. (coyote-herbs.com)
  • When amygdalin or b-17 penetrates a normal cell, since it doesn't have that beta-glucosidase enzyme then it converts it into something called thiocyanate, which is totally non-toxic to normal cells. (coyote-herbs.com)
  • The most significant oligosaccharide β-glucosidase reacts with is cellulose. (wikipedia.org)
  • During the digestive process of the bonnethead shark, the acidic stomach weakens the cell walls of the seagrass and allows for β-glucosidase to enter the cell and digest the cellulose. (wikipedia.org)
  • Conformational characteristics and the adsorption behavior of endo-beta-1,3-glucanase from the hyperthermophilic microorganism Pyrococcus furiosus were studied by circular dichroism, steady-state and time-resolved fluorescence spectroscopy, and calorimetry in solution and in the adsorbed state. (unboundmedicine.com)
  • However, recent studies of the shark's hindgut has found that it has a high activity level of β-glucosidase. (wikipedia.org)
  • The BGL1 over-expressing mutant I1-13 particularly improved the β-glucosidase activity at a factor of 65-folds, resulting in levels of up to 150 U/ml. (biomedcentral.com)
  • 13. Wenger, D.A., Clark, C., Sattler, M., and Wharton, C. (1978) Synthetic substrate \s s-glucosidase activity in leukocytes: A reproducible method for the identification of patients and carriers of Gaucher's disease. (cram.com)
  • W248R takes place in the hydrophobic core region of the TIM beta/alpha-barrel domain and inserting a hydrophilic, arginine is likely to impair the catalytic activity of the enzyme, although it does no change the secondary structure according to the PSI-PRED prediction. (tu-muenchen.de)
  • It is a species that is naturally cultivated to have a strong IRC7 activity, it also produces a large amount of Beta-glucosidase that is involved with biotransformation. (whclab.com)
  • 1992. Microbial decomposition of polymer organic matter related to plankton development in a reservoir - activity of alpha-glucosidase, beta-glucosidase, and beta-N-acetylglucosaminidase and uptake of N-acetylglucosamine . (jcu.cz)
  • The family 1 beta-glucosidases from Pyrococcus furiosus and Agrobacterium faecalis share a common catalytic mechanism. (ncsu.edu)
  • Two beta-agarase genes, agaA and agaB, were functionally cloned from the marine bacterium Zobellia galactanivorans and it is proposed that, reminiscent of the agarolytic system of Pseudoalteromonas atlantica, AgaA is specialized in the initial attack on solid-phase agarose, while AgaB is involved with the degradation of agarOSE fragments. (semanticscholar.org)
  • The combination of genomic and transcriptomic approaches suggested a novel xanthan gum degradation pathway which involves novel glycosidase(s) of DUF1080 family, hydrolyzing xanthan gum backbone beta-glucosidic linkages and beta-mannosidases instead of xanthan lyases, catalyzing cleavage of terminal beta-mannosidic linkages. (frontiersin.org)
  • The results revealed that alpha-amylase 1 ( AMY1 ), alpha-amylase 3 ( AMY3 ), beta-amylase 1 ( BAM1 ), beta-amylase 3 ( BAM3 ), beta-amylase 9 ( BAM9) , pullulanase ( PUL) , and glycogen debranching enzyme ( glgX ), were the major genes involved in starch degradation. (biomedcentral.com)
  • Sulfonylureas act primarily by stimulating release of insulin from beta cells. (medscape.com)
  • After 4 lactamase production in a Salmonella en- days of incubation, bacterial growth terica serotype Typhi strain from the Phil- ippines. (cdc.gov)
  • There are roughly 100 identified members of the family 3 group of glycoside hydrolases, most of that are categorized as beta-glucosidases and originate from microorganisms. (novosides.eu)
  • The synthetic potential of the catalysts was further evaluated through alkyl glycoside transglycosylation yields, including the first examples of synthesis of beta-mannosides and beta-xylosides with SsbetaG. (ox.ac.uk)
  • Through expression of a beta-glucosidase enzyme, LalBrew® BRY-97 can promote hop biotransformation and accentuate hop flavor and aroma. (brewgrasshomebrew.com)
  • The present study was designed to investigate the modulatory effect of \beta-sitosterol administration on 1,2-dimethylhydrazine (DMH)-induced fecal bacterial and colonic biotransformation enzyme activities. (tubitak.gov.tr)
  • Characterization of the pattern of alphas1- and beta-casein breakdown and release of a bioactive peptide by a cell envelope proteinase from Lactobacillus delbrueckii subsp. (cnr.it)
  • Beta-glucosidase 8 OS=Oryza sativa subsp. (ntu.edu.sg)
  • Endo-1,4-beta-xylanase (Fragment) n=1 Tax=Eucalyptus globulus subsp. (uma.es)
  • Furthermore, the inducible promoter from bgl2 was used to conditionally over-express the β-glucosidases BGL1 and BGL4. (biomedcentral.com)
  • The structural data from the complexes allowed us to visualize an intact substrate, free aglycone, or a competitive inhibitor in the slot-like active site of a beta-glucosidase. (rcsb.org)
  • Mucolipidosis II is caused by mutations in GNPTA encoding the alpha/beta GlcNAc-1-phosphotransferase", Nature Medicine , vol. 11, 2006, pp. 1109-1112. (uni-bielefeld.de)
  • Instead, cancer cells have an enzyme called beta-glucosidase . (justrandomnews.com)
  • You see, cancer cells have an enzyme called - "beta-glucosidase" which normal cells do not have. (coyote-herbs.com)