An exocellulase with specificity for a variety of beta-D-glycoside substrates. It catalyzes the hydrolysis of terminal non-reducing residues in beta-D-glucosides with release of GLUCOSE.
An enzyme that catalyzes the endohydrolysis of 1,6-alpha-glucosidic linkages in isomaltose and dextrins produced from starch and glycogen by ALPHA-AMYLASES. EC 3.2.1.10.
Enzymes that catalyze the exohydrolysis of 1,4-alpha-glucosidic linkages with release of alpha-glucose. Deficiency of alpha-1,4-glucosidase may cause GLYCOGEN STORAGE DISEASE TYPE II.
Enzymes that hydrolyze O-glucosyl-compounds. (Enzyme Nomenclature, 1992) EC 3.2.1.-.
An alpha-glucosidase inhibitor with antiviral action. Derivatives of deoxynojirimycin may have anti-HIV activity.
1,4-alpha-D-Glucan-1,4-alpha-D-glucan 4-alpha-D-glucosyltransferase/dextrin 6 alpha-D-glucanohydrolase. An enzyme system having both 4-alpha-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33) activities. As a transferase it transfers a segment of a 1,4-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or another 1,4-alpha-D-glucan. As a glucosidase it catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-1,6-glucosidase activity is deficient in glycogen storage disease type III.
Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.
An interleukin-1 subtype that is synthesized as an inactive membrane-bound pro-protein. Proteolytic processing of the precursor form by CASPASE 1 results in release of the active form of interleukin-1beta from the membrane.
Glycoside hydrolases that catalyze the hydrolysis of alpha or beta linked MANNOSE.
Six-carbon pyranose sugars in which the OXYGEN is replaced by a NITROGEN atom.
A plant genus of the APOCYNACEAE or dogbane family. Alkaloids from plants in this genus have been used as tranquilizers and antihypertensive agents. RESERPINE is derived from R. serpentina.
An 11-kDa protein associated with the outer membrane of many cells including lymphocytes. It is the small subunit of the MHC class I molecule. Association with beta 2-microglobulin is generally required for the transport of class I heavy chains from the endoplasmic reticulum to the cell surface. Beta 2-microglobulin is present in small amounts in serum, csf, and urine of normal people, and to a much greater degree in the urine and plasma of patients with tubular proteinemia, renal failure, or kidney transplants.
A lectin found in ENDOPLASMIC RETICULUM membranes that binds to specific N-linked OLIGOSACCHARIDES found on newly synthesized proteins. It may play role in PROTEIN FOLDING or retention and degradation of misfolded proteins in the endoplasmic reticulum.
A system of cisternae in the CYTOPLASM of many cells. In places the endoplasmic reticulum is continuous with the plasma membrane (CELL MEMBRANE) or outer membrane of the nuclear envelope. If the outer surfaces of the endoplasmic reticulum membranes are coated with ribosomes, the endoplasmic reticulum is said to be rough-surfaced (ENDOPLASMIC RETICULUM, ROUGH); otherwise it is said to be smooth-surfaced (ENDOPLASMIC RETICULUM, SMOOTH). (King & Stansfield, A Dictionary of Genetics, 4th ed)
An indolizidine alkaloid from the plant Swainsona canescens that is a potent alpha-mannosidase inhibitor. Swainsonine also exhibits antimetastatic, antiproliferative, and immunomodulatory activity.
A disaccharide consisting of two glucose units in an alpha (1-6) glycosidic linkage.
The chemical or biochemical addition of carbohydrate or glycosyl groups to other chemicals, especially peptides or proteins. Glycosyl transferases are used in this biochemical reaction.
The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.
One of two major pharmacologically defined classes of adrenergic receptors. The beta adrenergic receptors play an important role in regulating CARDIAC MUSCLE contraction, SMOOTH MUSCLE relaxation, and GLYCOGENOLYSIS.
An integrin beta subunit of approximately 85-kDa in size which has been found in INTEGRIN ALPHAIIB-containing and INTEGRIN ALPHAV-containing heterodimers. Integrin beta3 occurs as three alternatively spliced isoforms, designated beta3A-C.
Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
An inhibitor of ALPHA-GLUCOSIDASES that retards the digestion and absorption of DIETARY CARBOHYDRATES in the SMALL INTESTINE.
Enzymes that catalyze the hydrolysis of N-acylhexosamine residues in N-acylhexosamides. Hexosaminidases also act on GLUCOSIDES; GALACTOSIDES; and several OLIGOSACCHARIDES.
An autosomal recessively inherited glycogen storage disease caused by GLUCAN 1,4-ALPHA-GLUCOSIDASE deficiency. Large amounts of GLYCOGEN accumulate in the LYSOSOMES of skeletal muscle (MUSCLE, SKELETAL); HEART; LIVER; SPINAL CORD; and BRAIN. Three forms have been described: infantile, childhood, and adult. The infantile form is fatal in infancy and presents with hypotonia and a hypertrophic cardiomyopathy (CARDIOMYOPATHY, HYPERTROPHIC). The childhood form usually presents in the second year of life with proximal weakness and respiratory symptoms. The adult form consists of a slowly progressive proximal myopathy. (From Muscle Nerve 1995;3:S61-9; Menkes, Textbook of Child Neurology, 5th ed, pp73-4)
Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.
A species of HENIPAVIRUS, closely related to HENDRA VIRUS, which emerged in Peninsular Malaysia in 1998. It causes a severe febrile VIRAL ENCEPHALITIS in humans and also encephalitis and RESPIRATORY TRACT INFECTIONS in pigs. Fruit bats (PTEROPUS) are the natural host.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
A disaccharide consisting of two glucose units in beta (1-4) glycosidic linkage. Obtained from the partial hydrolysis of cellulose.
Proteins obtained from ESCHERICHIA COLI.
Derivatives of phenylacetic acid. Included under this heading are a variety of acid forms, salts, esters, and amides that contain the benzeneacetic acid structure. Note that this class of compounds should not be confused with derivatives of phenyl acetate, which contain the PHENOL ester of ACETIC ACID.
Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.
A glycosidase that hydrolyzes a glucosylceramide to yield free ceramide plus glucose. Deficiency of this enzyme leads to abnormally high concentrations of glucosylceramide in the brain in GAUCHER DISEASE. EC 3.2.1.45.
An autosomal recessive disorder caused by a deficiency of acid beta-glucosidase (GLUCOSYLCERAMIDASE) leading to intralysosomal accumulation of glycosylceramide mainly in cells of the MONONUCLEAR PHAGOCYTE SYSTEM. The characteristic Gaucher cells, glycosphingolipid-filled HISTIOCYTES, displace normal cells in BONE MARROW and visceral organs causing skeletal deterioration, hepatosplenomegaly, and organ dysfunction. There are several subtypes based on the presence and severity of neurological involvement.
A group of four homologous sphingolipid activator proteins that are formed from proteolytic cleavage of a common protein precursor molecule referred to as prosaposin.
Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.
The most abundant natural aromatic organic polymer found in all vascular plants. Lignin together with cellulose and hemicellulose are the major cell wall components of the fibers of all wood and grass species. Lignin is composed of coniferyl, p-coumaryl, and sinapyl alcohols in varying ratios in different plant species. (From Merck Index, 11th ed)
Hydrocarbon-rich byproducts from the non-fossilized BIOMASS that are combusted to generate energy as opposed to fossilized hydrocarbon deposits (FOSSIL FUELS).
A family of glycosidases that hydrolyse crystalline CELLULOSE into soluble sugar molecules. Within this family there are a variety of enzyme subtypes with differing substrate specificities that must work together to bring about complete cellulose hydrolysis. They are found in structures called CELLULOSOMES.
A polysaccharide with glucose units linked as in CELLOBIOSE. It is the chief constituent of plant fibers, cotton being the purest natural form of the substance. As a raw material, it forms the basis for many derivatives used in chromatography, ion exchange materials, explosives manufacturing, and pharmaceutical preparations.
The process of cleaving a chemical compound by the addition of a molecule of water.
An endocellulase with specificity for the hydrolysis of 1,4-beta-glucosidic linkages in CELLULOSE, lichenin, and cereal beta-glucans.
Cholestane derivatives containing a fused lactone ring at the 16,17-position and a spiroglycosidic linkage at C-22. Members include sarsaponin, DIOSGENIN and yamogenin.
A plant genus of the family Costaceae (sometimes classified in Zingiberaceae), order Zingiberales, subclass Zingiberidae, class Liliopsida (monocotyledons). It is a source of SAPONINS and furostanol glycosides.
A plant genus of the family ZYGOPHYLLACEAE. Members contain steroidal saponins. Ingestion by grazing animals causes PHOTOSENSITIVITY DISORDERS called geeldikkop (yellow thick head) in South Africa.
Root-like underground horizontal stem of plants that produces shoots above and roots below. Distinguished from true roots which don't have buds and nodes. Similar to true roots in being underground and thickened by storage deposits.
Any compound that contains a constituent sugar, in which the hydroxyl group attached to the first carbon is substituted by an alcoholic, phenolic, or other group. They are named specifically for the sugar contained, such as glucoside (glucose), pentoside (pentose), fructoside (fructose), etc. Upon hydrolysis, a sugar and nonsugar component (aglycone) are formed. (From Dorland, 28th ed; From Miall's Dictionary of Chemistry, 5th ed)
A plant genus of the family LILIACEAE. Members contain benzoquinones, steroidal saponin, and ribosome-inactivating proteins.
Cyclopentanophenanthrenes with a 5- or 6-membered lactone ring attached at the 17-position and SUGARS attached at the 3-position. Plants they come from have long been used in congestive heart failure. They increase the force of cardiac contraction without significantly affecting other parameters, but are very toxic at larger doses. Their mechanism of action usually involves inhibition of the NA(+)-K(+)-EXCHANGING ATPASE and they are often used in cell biological studies for that purpose.

The DNA binding site of the Dof protein NtBBF1 is essential for tissue-specific and auxin-regulated expression of the rolB oncogene in plants. (1/814)

The Dof proteins are a large family of plant transcription factors that share a single highly conserved zinc finger. The tobacco Dof protein NtBBF1 was identified by its ability to bind to regulatory domain B in the promoter of the rolB oncogene. In this study, we show that the ACT T TA target sequence of NtBBF1 in domain B is necessary for tissue-specific expression of rolB. beta-Glucuronidase (GUS) activity of tobacco plants containing a rolB promoter-GUS fusion with a mutated NtBBF1 target sequence within domain B is almost completely suppressed in apical meristems and is severely abated in the vascular system. The ACT T TA motif is shown here also to be one of the cis-regulatory elements involved in auxin induction of rolB. The pattern of NtBBF1 expression in plants is remarkably similar to that of rolB, except in mesophyll cells of mature leaves, in which only NtBBF1 expression could be detected. Ectopic expression of rolB in mesophyll cells was achieved by particle gun delivery if the NtBBF1 binding sequence was intact. These data provide evidence that in the plant, a Dof protein DNA binding sequence acts as a transcriptional regulatory motif, and they point to NtBBF1 as the protein involved in mediating tissue-specific and auxin-inducible expression of rolB.  (+info)

Stochastic and nonstochastic post-transcriptional silencing of chitinase and beta-1,3-glucanase genes involves increased RNA turnover-possible role for ribosome-independent RNA degradation. (2/814)

Stochastic and nonstochastic post-transcriptional gene silencing (PTGS) in Nicotiana sylvestris plants carrying tobacco class I chitinase (CHN) and beta-1,3-glucanase transgenes differs in incidence, stability, and pattern of expression. Measurements with inhibitors of RNA synthesis (cordycepin, actinomycin D, and alpha-amanitin) showed that both forms of PTGS are associated with increased sequence-specific degradation of transcripts, suggesting that increased RNA turnover may be a general feature of PTGS. The protein synthesis inhibitors cycloheximide and verrucarin A did not inhibit degradation of CHN RNA targeted for PTGS, confirming that PTGS-related RNA degradation does not depend on ongoing protein synthesis. Because verrucarin A, unlike cycloheximide, dissociates mRNA from ribosomes, our results also suggest that ribosome-associated RNA degradation pathways may not be involved in CHN PTGS.  (+info)

Molecular cloning and expression of the novel fungal beta-glucosidase genes from Humicola grisea and Trichoderma reesei. (3/814)

A novel fungal beta-glucosidase gene (bgl4) and its homologue (bgl2) were cloned from the cellulolytic fungi Humicola grisea and Trichoderma reesei, respectively. The deduced amino acid sequences of H. grisea BGL4 and T. reesei BGL2 comprise 476 and 466 amino acids, respectively, and share 73.1% identity. These beta-glucosidases show significant homology to plant beta-glucosidases belonging to the beta-glucosidase A (BGA) family. Both genes were expressed in Aspergillus oryzae, and the recombinant beta-glucosidases were purified. Recombinant H. grisea BGL4 is a thermostable enzyme compared with recombinant T. reesei BGL2. In addition to beta-glucosidase activity, recombinant H. grisea BGL4 showed a significant level of beta-galactosidase activity, while recombinant T. reesei BGL2 showed weak beta-galactosidase activity. Cellulose saccharification by Trichoderma cellulases was improved by the addition of recombinant H. grisea BGL4.  (+info)

Properties of beta-glucosidase in cultured skin fibroblasts from controls and patients with Gaucher disease. (4/814)

Membrane-bound beta-glucosidase from cultured skin fibroblasts can be solubilized in an active form by treatment of membrane preparations with a mixture of Triton X-100 and sodium taurocholate. Several properties of the solubilized enzyme have been studied in fibroblasts from normal, healthy individuals and from 14 patients with different clinical forms of Gaucher disease. The patients studied were classified as follows: group 1 consisted of 10 chronic patients, all (with one exception) of Ashkenazi Jewish origin; group 2 consisted of three black American patients with severe visceral symptoms, manifest from early childhood, but with no apparent neurological involvement; and group 3 consisted of a single white patient with the classical infantile form of the disease. Specific beta-glucosidase activity ranged from 6.6% to 16.5% mean control value in group 1 patients and from 4.1% to 5.8% in groups 2 and 3. When compared with the enzyme from control fibroblasts, the enzyme from chronic Gaucher patients (group 1) was more rapidly inactivated at 50 degrees C, had an altered pH curve, was less effectively inhibited by deoxycorticosterone-beta-glucoside, and was more effectively inhibited by deoxycorticosterone. The enzyme from patients in groups 2 and 3 was qualitatively indistinguishable from the control enzyme in terms of these parameters. No differences in Km (4-methylumbelliferyl-beta-glucoside) or sedimentation coefficient were found between the beta-glucosidases from control and Gaucher cells. The results demonstrate that cells from Ashkenazi Jewish patients with the chronic form of Gaucher disease contain a structurally altered form of beta-glucosidase. This enzyme differs both from normal beta-glucosidase and from the residual enzyme in patients of different ethnic origin and with clinically more severe forms of the disease.  (+info)

Growth of Azospirillum irakense KBC1 on the aryl beta-glucoside salicin requires either salA or salB. (5/814)

The rhizosphere nitrogen-fixing bacterium Azospirillum irakense KBC1 is able to grow on pectin and beta-glucosides such as cellobiose, arbutin, and salicin. Two adjacent genes, salA and salB, conferring beta-glucosidase activity to Escherichia coli, have been identified in a cosmid library of A. irakense DNA. The SalA and SalB enzymes preferentially hydrolyzed aryl beta-glucosides. A Delta(salA-salB) A. irakense mutant was not able to grow on salicin but could still utilize arbutin, cellobiose, and glucose for growth. This mutant could be complemented by either salA or salB, suggesting functional redundancy of these genes in salicin utilization. In contrast to this functional homology, the SalA and SalB proteins, members of family 3 of the glycosyl hydrolases, show a low degree of amino acid similarity. Unlike SalA, the SalB protein exhibits an atypical truncated C-terminal region. We propose that SalA and SalB are representatives of the AB and AB' subfamilies, respectively, in glycosyl hydrolase family 3. This is the first genetic implication of this beta-glucosidase family in the utilization of beta-glucosides for microbial growth.  (+info)

Yeast VSM1 encodes a v-SNARE binding protein that may act as a negative regulator of constitutive exocytosis. (6/814)

We have screened for proteins that interact with v-SNAREs of the late secretory pathway in the yeast Saccharomyces cerevisiae. A novel protein, designated Vsm1, binds tightly to the Snc2 v-SNARE in the two-hybrid system and can be coimmunoprecipitated with Snc1 or Snc2 from solubilized yeast cell extracts. Disruption of the VSM1 gene results in an increase of proteins secreted into the medium but does not affect the processing or secretion of invertase. In contrast, VSM1 overexpression in cells which bear a temperature-sensitive mutation in the Sec9 t-SNARE (sec9-4 cells) results in the accumulation of non-invertase-containing low-density secretory vesicles, inhibits cell growth and the secretion of proteins into the medium, and blocks rescue of the temperature-sensitive phenotype by SNC1 overexpression. Yet, VSM1 overexpression does not affect yeast bearing a sec9-7 allele which, in contrast to sec9-4, encodes a t-SNARE protein capable of forming a stable SNARE complex in vitro at restrictive temperatures. On the basis of these results, we propose that Vsm1 is a novel v-SNARE-interacting protein that appears to act as negative regulator of constitutive exocytosis. Moreover, this regulation appears specific to one of two parallel exocytic paths which are operant in yeast cells.  (+info)

Cellobiose transport by mixed ruminal bacteria from a Cow. (7/814)

The transport of cellobiose in mixed ruminal bacteria harvested from a holstein cow fed an Italian ryegrass hay was determined in the presence of nojirimycin-1-sulfate, which almost inhibited cellobiase activity. The kinetic parameters of cellobiose uptake were 14 microM for the Km and 10 nmol/min/mg of protein for the Vmax. Extracellular and cell-associated cellobiases were detected in the rumen, with both showing higher Vmax values and lower affinities than those determined for cellobiose transport. The proportion of cellobiose that was directly transported before it was extracellularly degraded into glucose increased as the cellobiose concentration decreased, reaching more than 20% at the actually observed levels of cellobiose in the rumen, which were less than 0.02 mM. The inhibitor experiment showed that cellobiose was incorporated into the cells mainly by the phosphoenolpyruvate phosphotransferase system and partially by an ATP-dependent and proton-motive-force-independent active transport system. This finding was also supported by determinations of phosphoenolpyruvate phosphotransferase-dependent NADH oxidation with cellobiose and the effects of artificial potentials on cellobiose transport. Cellobiose uptake was sensitive to a decrease in pH (especially below 6.0), and it was weakly but significantly inhibited in the presence of glucose.  (+info)

Transcriptional regulation in the hyperthermophilic archaeon Pyrococcus furiosus: coordinated expression of divergently oriented genes in response to beta-linked glucose polymers. (8/814)

The genetic organization, expression, and regulation of the celB locus of the hyperthermophilic archaeon Pyrococcus furiosus were analyzed. This locus includes the celB gene, which codes for an intracellular beta-glucosidase, and a divergently orientated gene cluster, adhA-adhB-lamA, which codes for two alcohol dehydrogenases and an extracellular beta-1,3-endoglucanase that is transcribed as a polycistronic messenger (the lamA operon). During growth of P. furiosus on either the beta-1,4-linked glucose dimer cellobiose or the beta-1,3-linked glucose polymer laminarin, the activities of both beta-glucosidase and endoglucanase were increased at least fivefold compared with levels during growth on maltose or pyruvate. Northern blot analysis revealed an enhanced transcription of both the celB gene and the lamA operon in the presence of these glucose-containing substrates. The in vivo and in vitro transcription initiation sites of both the celB gene and the lamA operon were identified 25 nucleotides downstream of conserved TATA box motifs. A number of repeating sequences have been recognized in the celB-adhA intergenic region, some of which might be part of a transcriptional regulator-binding site.  (+info)

BioAssay record AID 593427 submitted by ChEMBL: Inhibition of sweet almond beta-glucosidase after 10 mins using 4-nitrophenylbeta-D-glucopyranoside as a substrate by Lineweaver-Burk and double reciprocal analysis.
Shop Lysosomal beta glucosidase ELISA Kit, Recombinant Protein and Lysosomal beta glucosidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Heritage Products Sweet Almond Oil (8 fl Oz)-Enjoy Heritage Products Sweet Almond Oil - 8 fl oz every day at these amazing prices! Heritage Products Sweet Almond Oil Description: Skin Lotion Massage Oil Cosmetic ....Learn More At Kalyx.com.
Sweet Almond Carrier Oil - Oil Sweet Almond carrier oil is nourishing, softening and revitalizing all skin types. Sweet Almond Oil is avaliable cold pressed from just aromatherapys Pure Carrier oils range
Aroma Beads | Fragrance Oil | Potpourri Sweet Almond Oil 16 oz. Bottle [16OZSWAO] - Sweet Almond Oil 16 oz. Bottle (Great for use as a carrier oil) Sweet Almond oil is a skin nutrient used to beautify the skin and treat injuries. It is also known to condition and soften your skin, offering excellent penetrating properties. Skin will appreciate the rich minerals, vitamins and proteins
Shop Glucan endo-1,6-beta-glucosidase ELISA Kit, Recombinant Protein and Glucan endo-1,6-beta-glucosidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
BioAssay record AID 220893 submitted by ChEMBL: Competitive Inhibition constant on almonds beta Glucosidase; LI=Limited inhibition.
WITH RICE BRAN WATER& POMEGRANATE EXTRACT SWISSE SWEET ALMOND GENTLE CREAMCLEANSER gently yet effectively cleanses the skin,removing impurities while leaving the skin feeling softand balanced. Enriched with Sweet Almond Oil to nourishthe skin, Witch Hazel Water to soothe the skin and Rice Bran Water to improve skin hydration. Suitable For: Normal or dry skin types Size: 125mL
In patients with connective tissue disease it is common for collagen and elastin to become injured by inflammation. It blocks the nerve impulses that cause your facial muscles to contract and form lines. Can You Use Sweet Almond Oil For Dark Circles Affordable Regimen Care throughout its history it has been used as a cartilage support product. Encontre Botox Capilar - Produtos de Cabelo no Mercado Livre Brasil. skin aging thinning You should consult with a health care professional how to rejuvenate my face naturally really covering before starting any diet Can You Use Sweet Almond Oil For Dark Circles Affordable Regimen Care exercise or supplementation program before taking any medication or Having said this TMJ is not one of those disorders of which the FDA has approved. Student Self Governance. do collagen filler creams work 2016 do collagen filler creams work 2016 The Pellev treatment is virtually painless and generally quite pleasurable Anti Aging Cream For Face - Best Moisturizing Cream ...
beta-Glucosidases represent an important group of enzymes due to their pivotal role in various biotechnological processes. One of the most prominent is biomass degradation for the production of fuel ethanol from cellulosic agricultural residues and wastes, where the use of immobilized biocatalysts may prove advantageous. Within such scope, the present work aimed to evaluate the feasibility of entrapping beta-glucosidase in either sol gel or in Lentikats supports for application in cellobiose hydrolysis, and to perform the characterization of the resulting bioconversion systems. The activity and stability of the immobilized biocatalyst over given ranges of temperature and pH values were assessed, as well as kinetic data, and compared to the free form, and the operational stability was evaluated. Immobilization increased the thermal stability of the enzyme, with a 10 degrees C shift to an optimal temperature in the case of sol gel support. Mass transfer hindrances as a result of immobilization ...
3GNR: Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with covalently bound 2-deoxy-2-fluoroglucoside to the catalytic nucleophile E396
Biology lecturer of Faculty of Science and Technology, Universitas Airlangga (FST UNAIR) used beta-glucosidase enzyme producing microorganisms in Indonesia for ginseng active compound biotransformation
Sweet almond oil, made from pressed almonds, is an odorless, pale-yellow liquid with a nutty taste. Its similar to olive oil in composition and can be used as a substitute. Its not, however, to be confused with bitter almond oil, which has a pungent flavor and is typically used as a flavoring agent.
Sweet Almond Oil is rich in vitamin E, essential fatty acids and other minerals that support the body. It is great carrier oil or can be used unaided.
Koa & Sweet Almond Soothing Herbal Cleansing Stick by Hempz is a two-in-one skin care formula that exfoliates and cleanses. Rich lather gently cleanses skin leaving it feeling refreshed and clean. Fine walnut shell gently exfoliates skin leaving it soft and smooth.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Mix all ingredients together in a dropper bottle and shake gently to combine. To use, apply to babys skin after bath using only a tiny bit. For a 10 pound infant, 6 to 8 drops is sufficient for arms and legs as only a light layer is necessary for baby skin. Use more for toddlers and larger babies. If fresh oils are used to make this product, the shelf life will be somewhere in the neighborhood of 6 months. It will last longer if kept refrigerated during any extended periods of non-use. If the product begins to smell badly, the oils have become rancid and the product should be discarded ...
Mix all ingredients together in a dropper bottle and shake gently to combine. To use, apply to babys skin after bath using only a tiny bit. For a 10 pound infant, 6 to 8 drops is sufficient for arms and legs as only a light layer is necessary for baby skin. Use more for toddlers and larger babies. If fresh oils are used to make this product, the shelf life will be somewhere in the neighborhood of 6 months. It will last longer if kept refrigerated during any extended periods of non-use. If the product begins to smell badly, the oils have become rancid and the product should be discarded ...
THE INFORMATION IN THIS MSDS WAS OBTAINED FROM CURRENT REPUTABLE SOURCES. HOWEVER THE DATA IS PROVIDED WITHOUT ANY WARRANTY, EXPRESSEDOR IMPLIED, REGARDING ITS CORRECTNESS OR ACCURACY. IT IS USERS RESPONSIBILITY BOTH TO DETERMINE SAFE CONDITIONS FOR USE OF THIS PRODUCT AND TO ASSUME LIABILITY FOR LOSS, INJURY, DAMAGE OR EXPENSE RESULTING FROM IMPORPER USE OF THIS PRODUCT. ...
reference: Structure of acid beta-glucosidase with pharmacological chaperone provides insight into Gaucher disease., Lieberman RL, Wustman BA, Huertas P, Powe AC Jr, Pine CW, Khanna R, Schlossmacher MG, Ringe D, Petsko GA, Nat Chem Biol. 2007 Feb;3(2):101-107. Epub 2006 Dec 24. PMID: 17187079 ...
We also started working on some of the constructs needed to engineer our bacterial strains, namely: the bacterial construct A0, composed of a TraR-regulated promoter (P-TraR) followed by a beta-glucosidase (BBa_K392008), an E.coli ribosome binding site (RBS, BBa_J15001) and a double terminator (BBa_B0015); the bacterial construct B1, identical to A0 but under the transcriptional control of a LasR-regulated promoter (P-LasR, BBa_R0079); the bacterial construct B2, consisting of a constitutive promoter (BBa_J23119), an RBS (BBa_B0034), a LasR activator (BBa_C0179) and a terminator; and the bacterial construct B3, made of P-LasR, an RBS, the TraI gene and a terminator. ...
bsr:I33_4084 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) beta-glucosidase (A) MSSNAKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPYDESMTSLNLYHN GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLSFYDDLFDELLKHH IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL HAPFTGGGLVFEEGENKRNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY QKPLFIVENGLGAVDKVEDDGTIQDDYRINYLRDHLIEVREAIADGVELIGYTSWGPIDL VSASTAEMKKRYGFIYVDRDNEGNGTLNRIKKKSFIWYQQVIATNGESI ...
APRICON FARMAS HEALTH adalah kapsul biji aprikot yang mengandungi vitamin B17 yang paling tinggi di dunia. Dalam terapi metabolic, apabila vitamin B17 bertemu dengan sel-sel kanser, enzim Beta-Glucosidase yang hanya terdapat pada sel-sel kanser akan menguraikan elemen-elemen yang terdapat dalam vitamin B17. Seterusnya elemen-elemen yang terdapat di dalam vitamin B17 yang telah terurai akan bertindak membunuh sel-sel kanser. ...
A rich, creamy formula thats perfect for all of your facial cleansing needs. Sweet almond oil and oat extract balance skin and replenish as it cleanses skin to leave it soft, smooth, and supple. Clean your skin of pollution, dirt, and makeup with this a
1. Sweet Almond Oil for the body: a source of vitamins A and E, it improves skin suppleness and accelerates its renewal. Its infinite softness makes it an ally for all skin types, soothing the most sensitive to the driest ...
Todays Deals: Save 10% on Linha Seve Natura - Refil Oleo Corporal Amendoas Doces com Enxague 200 Ml - (Natura Seve Collection - Refill Sweet Almonds Body...
Some enzymes in this group hydrolyze alpha-L-arabinosides; some animal enzymes also hydrolyze beta-D-fucosides and beta-D-glucosides (cf. EC 3.2.1.108 ...
Looking for online definition of Acid beta-glucosidase deficiency in the Medical Dictionary? Acid beta-glucosidase deficiency explanation free. What is Acid beta-glucosidase deficiency? Meaning of Acid beta-glucosidase deficiency medical term. What does Acid beta-glucosidase deficiency mean?
Sweet Almond Carrier Oil - Oil Sweet Almond carrier oil is nourishing, softening and revitalizing all skin types. Sweet Almond Oil is avaliable cold pressed from just aromatherapys Pure Carrier oils range
BAISHENG - China glucono-delta-lactone crystal manufacturers and suppliers, also providing customized service. Welcome to import discount glucono-delta-lactone crystal made in China here and check the quotation with us.
An autosomal recessive disorder caused by a deficiency of Acid beta-Glucosidase (Glucosylceramidase) leading to intralysosomal accumulation of glycosylceramide mainly in Cells of the Mononuclear Phagocyte System. The characteristic Gaucher Cells, glycosphingolipid-filled Histiocytes, displace normal Cells in Bone Marrow and visceral organs causing skeletal deterioration, hepatosplenomegaly, and organ dysfunction. There are several subtypes based on the presence and severity of neurological involvement ...
Prunus Amygdalus Dulcis Oil, better known as Sweet Almond Oil, is derived from the fruits of the almond tree. Prunus Amygdalus Dulcis, also known as the Almond Tree, has been cultivated for thousands of years in India and in the Middle East. People have revered it for skin care and for culinary reasons throughout the ages. The use of almonds in skin care and beauty can date all the way back to the ancient Hindus. The ancient Hindu civilization used to make a paste from crushed almonds and then use it as a natural cleanser for the body.. Prunus Amygdalus Dulcis might fall in the same family as cherry, plum and peach trees, but it doesnt offer a fleshy fruit. As a deciduous tree, the Prunus Amygdalus Dulcis is famous for its almonds, fruits that have an exterior hull, a seed in the center and an interior shell. Apart from skin care, almonds are used in cookies, candies and breads as well.. Prunus Amygdalus Dulcis Oil is pressed from the nut kernels of the Sweet Almond Tree. This oil is a ...
Save 35% Now Foods - Sweet Almond Oil 8 Fluid Ounces Sweet Almond Oil 100% Pure Moisturizing Oil Nourishing, Promotes Healthy-Looking Skin* USDA Organic Non-GMO Project Verified Hexane Free Condition: For skin in need of clean and natural nourishment, as a moisturizer or for massage. Solution: Certified Organic Almond Oil is a natural oil thats perfect for nourishing and reviving any skin type. Almond Oil is easily absorbed and wont clog pores, promoting clear, soft, healthy-looking skin. This natural skin-nourishing oil is ideal for the entire body. Almond Oil is a natural oil derived from pressed almonds. Vegetable-derived oils date back to Biblical times, when they were mixed with fragrant herbs to create traditional ointments.
Sweet almond carrier oil contains glucosides, minerals and vitamins A, B1, B2, B6 and E. Being rich in protein sweet almond carrier oil is useful for dry, itchy skin, and for cooling overheated skin. The oil is cold-pressed and refined.
Glucono-Delta-Lactone(GDL) - Browse fuzing.com to find Glucono-Delta-Lactone(GDL) sellers, suppliers, wholesalers, companies, manufacturers, exporters, factories.
Sweet Almond Seeds (Prunus amygdalus) Price for Package of 300 seeds. The almond (Prunus dulcis, syn. Prunus amygdalus) is a species of tree native
We have high quality and highly effective glucono-delta-lactone, gluconic acid 50% solution, sodium gluconate made in China for sale. All of our products are sold at a discount. Please be free to place an order and the customized orders are also welcome.
Translated from Latin, Prunus Amygdalus Dulcis means sweet almond oil and is one of the most frequently used carrier oils and most adaptable body oils for beauty products and massage. Cultivated thousands of years ago, sweet almond oil is extracted from ripe seed kernels that have been dried and crushed through a cold pressing process. Today almonds can be used in anything from exfoliants (using the nut or the kernel as a mechanical exfoliant), used as an emulsifying agent to bind oil and water or as a skin-conditioning product to help soften and hydrate. Pure sweet almond oil contains countless nutrients including calcium, magnesium, phosphorous, and vitamin E. These essential vitamins nurture the skin on the outside and when applied topically, promote softer, more nourished skin.. ...
Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Nature 387:75-78.9169867 ...
Vitamin B17 is harmless to healthy tissue for a very simple reason. Each molecule of B17 contains one unit of cyanide, one unit of benzaldehyde and two of glucose (sugar) tightly locked together. In order for the cyanide to become dangerous it is necessary to first unlock the molecule to release it. This can only be performed by an enzyme called beta-glucosidase, which is present all over the human body in minute quantities. However, beta-glucosidase is present in vast quantities (up to 100 times as high) at only one place: the site of a malignant cancer tumour. Thus, the cyanide is unlocked only at the cancer site with drastic results, which become utterly devastating to the cancer cells because the benzaldehyde unit unlocks at the same time ...
Tytu : Rola w glowodan w we wczesnych reakcjach metabolicznych kie kuj cych nasion ubinu pora onych przez Fusarium oxysporum f.sp. lupini ...
EXO1 (Exoglucanase isoenzyme EXO1) antibodies, Anti-EXO1 (Exoglucanase isoenzyme EXO1) antibody, AS08 322Family 3 β-D-glucan glucohydrolases are widely distributed in higher plants. The enzymes catalyse the hydrolytic removal of β-D-glucosyl re
Sweet Almond Oil (Prunis Amygdalus Dulcis)- cold pressed, unrefined, sourced from the almond nut in Australia. Sweet almond oil is rich in vitamins E and A, monosaturated fatty acids, proteins, potassium and zinc. It is a mild, hypoallergenic oil that can be used safely for all ages. It is full of antioxidants to reduc
Gently nourishing. New! Naturally derived ingredients tear free. A gently bubble bath formulated to help leave skin feeling nourished with our unique moisture blend containing jojoba and almond oils. Dermatologist tested. Hypoallergenic. Gentle for babies. Made Without: SLS/Sles; dyes; parabens; phthalates; synthetic fragrance; formaldehyde donors. Our honest purpose to empower people to live happy, healthy lives. honest.com/purpose. Join us at honest.com Please recycle HDPE. Not tested on animals & no animal by products. Made in the USA with US and imported materials ...
Gaucher Disease Gaucher s disease is inherited lipid storage diseases in which the harmful fatty substances (glucocerebroside) start to accumulate excessively in your spleen, liver, lungs, and brain, etc. Cause of insufficient activity of the lysosomal enzyme acid beta-glucosidase. A deadly inherited non-curable disease. This build-up fatty substances interfere with the organs and prevents them … Read more Gaucher Disease - Symptoms, Types And Treatment ...
4IPL: Structural insights into the substrate specificity of a 6-phospho-&[beta]-glucosidase BglA-2 from Streptococcus pneumoniae TIGR4
Beta-glucosidase is a glucosidase enzyme that acts upon β1->4 bonds linking two glucose or glucose-substituted molecules (i.e., the disaccharide cellobiose). It is one o
LalBrew Köln® is ideal for brewing traditional Kölsch-style beers and other neutral ales. The neutral character of this strain accentuates delicate hop aromas while imparting subtle fruity esters. Through expression of a beta-glucosidase enzyme LalBrew® Köln can promote hop biotransformation and accentuate hop flavor and aroma. Colder fermentations will be more neutral in character, while warmer fermentations will have more fruit-forward ester profile.
November 1, 2008 , Article Almond oil is a popular carrier oil because it is non-greasy, spreads easily, and is great for nourishing the skin. Essential oils can be mixed with it because of its light nature. Often called sweet almond oil, it contains strong concentrations of vitamin E.. Keywords: almond oil Secret Ingredient ...
Smooth and soften skin with the intense exfoliating Sea Salt Body Scrub. This salty treatment transforms into a creamy, low foaming lather so you can cleanse while buffing away dead skin cells. Sea Salt helps detoxify while Almond Meal and Walnut Shell naturally exfoliate to reveal softer, more radiant skin. A delicious end of she Butter, Sweet Almond and Jojoba Oils helps soften skin while Honey soothes and moisturizes.. ...
Organic Pistachios Oil. Organic Ground Pistachio. Organic Sweet Almond Oil. Organic Ground Almonds. Illite (French Green Clay). ...
Common Soap Making Ingredients& Saponification ValuesALMOND OIL SWEET:Saponification value of sweet almond oil - 192.3Almond oil has excellent penetrating properties and is beneficial to all skin types. It is particularly good for dry, sensitive skin and can help relieve redness, itchiness, and swelling.>> Wh
The crust is shortbread crumbs and ground almonds, which are complemented by a sweet almond liqueur-flavored mascarpone filling. The crowning touch: an Amaretto and cherry glaze that lightly coats a generous pile of fresh cherries.
As an aside, I suck at coming up with names for products. Part of that is that I dont think its helpful for you, my lovely reader, to see names like sweet almond & aloe lotion and think thats the only way to make that lotion. The part is that although Im a writer, Im not much for flowery language and description. So its easier for me to come up with names like basic lotion with humectants or toner for dry/sensitive skin. Im trying to be more flowery and pretty Pinterest-like, so youll see slightly more descriptive names in the future, but Ill always make it clear that you dont have to use named ingredients if you dont have to do so ...
We have created a synergistic complex of active substances to effectively tone the whole body. Collagen, sweet almond oil and shea butter make your skin more supple. The algae extract activates fat tissue burning, while ginkgo biloba stimulates blood circulation inducing the lipolysis process. The serums ingredients help to slow down adipogenesis - the process of creation of fat cells, and lipogenesis, i.e. the process of fat accumulation in the cells. Using Colway Slimming Serum together with healthy diet is a simple step to achieve the figure you have always dreamt of ...
STUFF sweet almond oil: for more on it, see more on that multi-purpose oil ShiKai borage dry skin remedy original unscented lotion: previously mentioned in ersatz (3): moisturiser plus balm for lips and eyes (Dr Bronner unscented) and sunscreen (BurnOut Eco-Sensitive SPF 30; Elemental Herbs SPF 30 sunstick for lips & eyes). METHOD 1. Wash…
Soap Ma Bergamote - This large soap with its rounded edges is adorned with a classical design inspired by cameo brooches: the head of a young athlete. Together with its Ma Bergamote (My Bergamot) eau de parfum, the soaps formula is enriched with sweet almond oil and Aloe vera. The…
Die Winglet Community bietet ein unabhängiges CME-zertifiziertes Videofortbildungsangebot im Bereich Orthopädie & Unfallchirurgie. Die Online-Plattform bringt Ärzte, Wissenschaftler, Physiotherapeuten, medizinische Fach- und Pflegekräfte sowie Vertreter aus der Industrie auf effiziente Weise zusammen und ermöglicht einen strukturierten und qualitätsgesicherten interdisziplinären Austausch innerhalb des Fachgebiets.
"Entrez Gene: GBAP glucosidase, beta; acid, pseudogene". Beutler E, West C, Gelbart T (1992). "Polymorphisms in the human ... Glucosidase, beta; acid, pseudogene, also known as GBAP, is a human gene. GRCh38: Ensembl release 89: ENSG00000160766 - Ensembl ...
... beta-glucosidase (EC 3.2.1.21); beta-galactosidase (EC 3.2.1.23); 6-phospho-beta-galactosidase (EC 3.2.1.85); 6-phospho-beta- ... glucosidase (EC 3.2.1.86); lactase-phlorizin hydrolase (EC 3.2.1.62), lactase (EC 3.2.1.108); beta-mannosidase (EC 3.2.1.25); ... myrosinase (EC 3.2.1.147). 6-phospho-beta-galactosidase InterPro: IPR005928 GBA3; KL; KLB; LCT; LCTL; GH1 in CAZypedia ...
... produces beta-glucosidase. Parte, A.C. "Dyella". LPSN. "Dyella koreensis". www.uniprot.org. Parker, Charles ... nov., a beta-glucosidase-producing bacterium". International Journal of Systematic and Evolutionary Microbiology. 55 (Pt 4): ...
... beta-glucosidase (EC 3.2.1.21); beta-xylosidase (EC 3.2.1.37); N-acetyl beta-glucosaminidase (EC 3.2.1.52); glucan beta-1,3- ... Varghese JN, Hrmova M, Fincher GB (February 1999). "Three-dimensional structure of a barley beta-D-glucan exohydrolase, a ... glucosidase (EC 3.2.1.58); cellodextrinase (EC 3.2.1.74); exo-1,3-1,4-glucanase (EC 3.2.1). These enzymes are two-domain ...
nov., a beta-glucosidase-producing bacterium in the family Sphingomonadaceae in the alpha-4 subgroup of the Proteobacteria". ... nov., a beta-glucosidase-producing bacterium in the family Sphingomonadaceae in the alpha-4 subgroup of the Proteobacteria". ... Sphingomonas soli produces beta-glucosidase. LPSN lpsn.dsmz.de Straininfo of Sphingomonas soli UniProt Deutsche Sammlung von ...
"Entrez Gene: GBA glucosidase, beta; acid (includes glucosylceramidase)". Deegan PB, Cox TM (2012). "Imiglucerase in the ... acid β-glucosidase (bile acid), also EC 3.2.1.45 GBA3: acid β-glucosidase (cytosolic), EC 3.2.1.21 ENSG00000177628 GRCh38: ... Lieberman RL (2011). "A Guided Tour of the Structural Biology of Gaucher Disease: Acid-β-Glucosidase and Saposin C". Enzyme ... β-Glucocerebrosidase (also called acid β-glucosidase, D-glucosyl-N-acylsphingosine glucohydrolase, or GCase) is an enzyme with ...
nov., a beta-glucosidase-producing bacterium". Int J Syst Evol Microbiol. 59 (Pt 9): 2191-4. doi:10.1099/ijs.0.008300-0. PMID ... Castellaniella ginsengisoli is a Gram-negative, oxidase- and catalase-positive, rod-shaped, motile, beta-glucosidase-producing ...
Weber JP, Fink AL (October 1980). "Temperature-dependent change in the rate-limiting step of beta-glucosidase catalysis". The ... Glycoside hydrolysis by lysozyme and beta-glucosidase". Biochemistry. 8 (10): 4214-21. doi:10.1021/bi00838a045. PMID 5388150. ... Glycoside hydrolysis by lysozyme and beta-glucosidase". Biochemistry. 8 (10): 4214-21. doi:10.1021/bi00838a045. PMID 5388150. ... Lysozyme is a glycoside hydrolase that catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl- ...
6-phospho-beta-glucosidase (EC 3.2.1.86); 6-phospho-alpha-glucosidase (EC 3.2.1.122); alpha-galactosidase (EC 3.2.1.22). 6- ... phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity. GH4 in CAZypedia ... dependent 6-phospho-alpha-glucosidase. Assignment to family 4 of the glycosylhydrolase superfamily". The Journal of Biological ...
y[ _]9 Glycoside hydrolase family 17 CAZY GH_17 comprises enzymes with several known activities; endo-1,3-beta-glucosidase (EC ...
Beta glucosidase activity is regulated via circadian rhythms. Fluorescence studies have shown that the binding sites of leaf ... which is inactivated by hydrolysis of the glycosidic bond via beta glucosidase. In Lespedeza cuneata the leaf opening factor, ...
as the fungus produces a potent beta-glucosidase. trans-Piceid is the glucoside formed with trans-resveratrol, while cis-piceid ... "Purification and characterization of piceid-β-d-glucosidase from Aspergillus oryzae". Process Biochemistry. 42: 83-88. doi: ...
Cytosolic beta-glucosidase, also known as cytosolic beta-glucosidase-like protein 1, is a beta-glucosidase (EC 3.2.1.21) enzyme ... Cytosolic beta-glucosidase is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside ... 2010). "The cytosolic beta-glucosidase GBA3 does not influence type 1 Gaucher disease manifestation". Blood Cells Mol. Dis. 46 ... Beutler E, Beutler L, West C (2004). "Mutations in the gene encoding cytosolic beta-glucosidase in Gaucher disease". J. Lab. ...
"Trifolium repens mRNA for non-cyanogenic beta-glucosidase - Nucleotide - NCBI". Ncbi.nlm.nih.gov. Retrieved 2019-06-29. ...
... phloridzin beta-glucosidase, lactase-phlorizin hydrolase, and phloridzin glucosidase. Leese HJ, Semenza G (1973). "On the ... Malathi P, Crane RK (1969). "Phlorizin hydrolase: a beta-glucosidase of hamster intestinal brush border membrane". Biochim. ... Other names in common use include phlorizin hydrolase, phloretin-glucosidase, glycosyl ceramide glycosylhydrolase, ...
"Screening of carbon sources for beta-glucosidase production by Aspergillus saccharolyticus". International Biodeterioration & ...
Chinchetru MA, Cabezas JA, Calvo P (1989). "Purification and characterization of a broad specificity beta-glucosidase from ... beta-xylosidase, exo-1,4-beta-xylosidase, beta-D-xylopyranosidase, exo-1,4-xylosidase, exo-1,4-beta-D-xylosidase, 1,4-beta-D- ... Xylan+1,4-beta-xylosidase at the US National Library of Medicine Medical Subject Headings (MeSH) Biology portal. ... This enzyme catalyses the following chemical reaction Hydrolysis of (1->4)-beta-D-xylans, to remove successive D-xylose ...
nov., with Beta-Glucosidase Activity Isolated from Soil of a Ginseng Field". Current Microbiology. 74 (12): 1417-1424. doi: ...
... is a potent irreversible inhibitor of beta-glucosidases. It is a cyclitol mimic of beta-glucose with an epoxide ... Gloster, T. M., Madsen, R. and Davies, G. J. (2007) 'Structural basis for cyclophellitol inhibition of a β-glucosidase', ... 1990) 'Production, isolation and structure determination of a novel β-glucosidase Inhibitor, cyclophellitol, from phellinus sp ...
... may refer to: Gelatinase biosynthesis-activating pheromone, a bacterial peptide Glucosidase, beta; acid, pseudogene, a ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ...
Li, Dan (May 2013). "Characterization and application of an acidophilic and thermostable beta-glucosidase from Thermofilum ...
"Cuckoo fungus mimics termite eggs by producing the cellulose-digesting enzyme beta-glucosidase". Current Biology. 19 (1): 30-6 ...
Different mutations in the GBA (beta-glucosidase) gene determine the remaining activity of the enzyme. In type I, there is some ... Numerous different mutations occur; sequencing of the beta-glucosidase gene is sometimes necessary to confirm the diagnosis. ... also known as beta-glucosidase, EC 3.2.1.45, PDB: 1OGS​) on the first chromosome (1q22). The enzyme is a 55.6-kilodalton, 497- ... the origins of the Ashkenazi Jewish N370S and 84GG acid beta-glucosidase mutations". American Journal of Human Genetics. 66 (6 ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". Int. J. Syst. Evol. Microbiol. 56 (Pt 11 ... Paraburkholderia ginsengisoli has the ability to produce β-glucosidase. Sawana A, Adeolu M, Gupta RS. (2014). "Molecular ...
... , or beta-D-glucosidase (EC 3.2.1.21), is an enzyme found in many plants including cassava and the butter bean. In ... "Purification and properties of beta-D-glucosidase (linamarase) from the butter bean, Phaseolus lunatus". Last accessed 13 ...
These enzymes include amygdalin beta-glucosidase, prunasin beta-glucosidase and mandelonitrile lyase. In contrast, although the ...
These lipids are then hydrolyzed by beta-glucosidases and beta-galactosidases to regenerate ceramide. Similarly, sphingomyelin ...
Production of beta-glucosidases is well known in members of the genus Aspergillus; however, only a few species can produce ... Beta-glucosidases produced by A. unguis are characteristically highly glucose-tolerant. For this reason, the fungus has been ... "Highly glucose tolerant β-glucosidase from Aspergillus unguis: NII 08123 for enhanced hydrolysis of biomass". Journal of ...
The enzyme vicianin beta-glucosidase uses (R)-vicianin and water to produce mandelonitrile and vicianose. The fruits of ...
In competitive inhibition, an inhibitor that resembles the normal substrate binds to the enzyme, usually at the active site, and prevents the substrate from binding.[8] At any given moment, the enzyme may be bound to the inhibitor, the substrate, or neither, but it cannot bind both at the same time. During competitive inhibition, the inhibitor and substrate compete for the active site. The active site is a region on an enzyme which a particular protein or substrate can bind to. The active site will only allow one of the two complexes to bind to the site therefore either allowing for a reaction to occur or yielding it. In competitive inhibition the inhibitor resembles the substrate therefore taking its place and binding to the active site of an enzyme. Increasing the substrate concentration would diminish the "competition" for the substrate to properly bind to the active site and allow a reaction to occur.[3] When the substrate is of higher concentration than that of the competitive inhibitor, it ...
These enzymes include amygdalin beta-glucosidase, prunasin beta-glucosidase and mandelonitrile lyase.[22] In contrast, although ...
Jul 1994). "The design of potential antidiabetic drugs: experimental investigation of a number of beta-D-glucose analogue ... α1-6 glucosidase enzyme is required to break the remaining (single glucose) α1-6 residue that remains in the new linear chain. ...
... , also called α-1,4-glucosidase[5] and acid maltase,[6] is an enzyme (EC 3.2.1.20) that helps to break ... alpha-1,4-glucosidase activity. • alpha-glucosidase activity. Cellular component. • membrane. • lysosomal membrane. • lysosomal ... maltose alpha-glucosidase activity. • catalytic activity. • hydrolase activity. • carbohydrate binding. • isomaltase. • ... This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. ...
... aryl-beta-glucosidase, beta-D-glucosidase, beta-glucoside glucohydrolase, arbutinase, amygdalinase, p-nitrophenyl beta- ... Beta-glucosidase catalyzes the hydrolysis of the glycosidic bonds to terminal non-reducing residues in beta-D-glucosides and ... Vicianin beta-glucosidase. References[edit]. *^ PDB: 3AHX​; Jeng WY, Wang NC, Lin MH, Lin CT, Liaw YC, Chang WJ, Liu CI, Liang ... glucosidase, primeverosidase, amygdalase, linamarase, salicilinase, and beta-1,6-glucosidase. Cellulose is a polymer composed ...
Separation and characterization of cellulases and beta-glucosidases". The Biochemical Journal. 177 (1): 9-19. doi:10.1042/ ... beta-1,4-glucanase, beta-1,4-endoglucan hydrolase, endoglucanase D, 1,4-(1,3,1,4)-beta-D-glucan 4-glucanohydrolase), ... Cellobiases (EC 3.2.1.21) or beta-glucosidases hydrolyse the exocellulase product into individual monosaccharides. ... and a beta-glucosidase (76,000 daltons).[14] Numerous "signature" sequences known as dockerins and cohesins have been ...
Additionally, some strains of the bacterium have beta-glucosidase enzymes that can break down monoglucosides which are aroma ...
"Comparison of a molecular dynamics model with the X-ray structure of the N370S acid-beta-glucosidase mutant that causes Gaucher ... Ding, F; JM Borreguero; SV Buldyrey; HE Stanley; NV Dokholyan (2003). "Mechanism for the alpha-helix to beta-hairpin transition ...
... is first hydrolyzed to cellobiose by cellulase and then cellobiose is further hydrolyzed to glucose by beta-glucosidase. ...
EC 3.2.1.48 is sucrose alpha-glucosidase. Physiology[edit]. Sucrose intolerance (also known as congenital sucrase-isomaltase ... Glucosidases. *Cellulase. *Alpha-glucosidase *Acid. *Neutral AB. *Neutral C. *Beta-glucosidase *cytosolic ...
Amygdalin beta-glucosidase is an enzyme that uses (R)-amygdalin and H2O to produce (R)-prunasin and D-glucose. ... Prunasin beta-glucosidase is an enzyme that uses (R)-prunasin and H2O to produce D-glucose and mandelonitrile. ...
... distribution of cellulases and properties of endo-beta-1,4-glucanase.. Zoological Science. 1997, 14 (1): 83-93. PMID 9200983. ... Cuckoo fungus mimics termite eggs by producing the cellulose-digesting enzyme β-glucosidase. Current Biology. 2009, 19 (1): 30- ...
Thus glucosidases catalyze the hydrolysis of glucosides and xylanases catalyze the cleavage of the xylose based homopolymer ... One of the important occurrences of glycoside hydrolases in bacteria is the enzyme beta-galactosidase (LacZ), which is involved ...
Effects of iridoids on lipoxygenase and hyaluronidase activities and their activation by beta-glucosidase in the presence of ... West, B.J.. Hepatotoxicity from interferon-beta, not Noni juice.. „Digestion". 74, s. 47-48, 2006. PMID: 17068398. ... Walther, EU; Hohlfeld, R. Multiple sclerosis: side effects of interferon beta therapy and their management.. „Neurology". 53 (8 ... Była ona leczona interferonem-beta, przy którym potwierdzony jest fakt występowania efektów ubocznych, w tym hepatotoksyczności ...
The diagnosis of the adult type of Gaucher's disease and its carrier state by demonstration of deficiency of beta-glucosidase ... Studies on human beta-D-N-acetylhexosaminidases. III. Biochemical genetics of Tay-Sachs and Sandhoff's diseases. J Biol Chem ... Chemical chaperones increase the cellular activity of N370S b-glucosidase: A therapeutic strategy for Gaucher's disease. Proc ...
The COX-2 enzyme was discovered in 1988 by Daniel Simmons, a Brigham Young University researcher.[23] The mouse COX-2 gene was cloned by UCLA scientist Dr. Harvey Herschman, a finding published in 1991.[24]. The basic research leading to the discovery of COX-2 inhibitors has been the subject of at least two lawsuits. Brigham Young University has sued Pfizer, alleging breach of contract from relations BYU had with the company at the time of Dr. Simmons's work.[25][26] A settlement was reached in April 2012 in which Pfizer agreed to pay $450 million.[27][28] The other litigation is based on United States Pat. No. 6,048,850[29] owned by University of Rochester, which claimed a method to treat pain without causing gastro-intestinal distress by selectively inhibiting COX-2. When the patent issued, the university sued Searle (later Pfizer) in a case called, University of Rochester v. G.D. Searle & Co., 358 F.3d 916 (Fed. Cir. 2004). The court ruled in favor of Searle in 2004, holding in essence that ...
Beta blockers (e.g., alprenolol, carteolol, cyanopindolol, iodocyanopindolol, isamoltane, oxprenolol, penbutolol, pindobind, ... agonist bromocriptine inhibits glucose-stimulated insulin secretion by direct activation of the α2-adrenergic receptors in beta ...
... a lineage of iso-maltose glucosidases and a lineage that further split into maltose glucosidases and iso-maltose glucosidases. ... beta/alpha)8-barrels: functional promiscuity produced by single substitutions in the enolase superfamily". Biochemistry. 42 (28 ... In light of the large number of paralogous fungal α-glucosidase genes with a number of specific maltose-like (maltose, turanose ... Antithetically, the ancestor before the latter split had a more pronounced isomaltose-like glucosidase activity.[4] ...
A 2017 population-based, matched-cohort study of 93,197 men aged 66 years and older with BPH found that finasteride and dutasteride were associated with a significantly increased risk of depression (HR, 1.94; 95% CI, 1.73-2.16) and self-harm (HR, 1.88; 95% CI, 1.34-2.64) during the first 18 months of treatment, but were not associated with an increased risk of suicide (HR, 0.88; 95% CI, 0.53-1.45).[31][32][33][21] After the initial 18 months of therapy, the risk of self-harm was no longer heightened, whereas the elevation in risk of depression lessened but remained marginally increased (HR, 1.22; 95% CI, 1.08-1.37).[31][32][21] The absolute increase in the rate of depression was 247 per 100,000 patient-years and of self-harm was 17 per 100,000 patient-years.[21][34] As such, on the basis of these findings, it has been stated that cases of depression in patients that are attributable to 5-ARIs will be encountered on occasion, while cases of self-harm attributable to 5-ARIs will be encountered ...
Two important sugar crops predominate: sugarcane (Saccharum spp.) and sugar beets (Beta vulgaris), in which sugar can account ...
Dworkin, Martin; Falkow, Stanley (2006). The Prokaryotes: Proteobacteria: alpha and beta subclasses. Springer. p. 169. ISBN ... β-glucosidase, β-xylosidase, or polygalacturonase, which Saccharomyces yeast may not produce.[68] ...
The affinity of RI for ribonucleases is among the highest for any protein-protein interaction; the dissociation constant of the RI-RNase A complex is in the femtomolar (fM) range under physiological conditions while that for the RI-angiogenin complex is less than 1 fM. Despite this high affinity, RI is able to bind a wide variety of RNases A despite their relatively low sequence identity. Both biochemical studies and crystallographic structures of RI-RNase A complexes suggest that the interaction is governed largely by electrostatic interactions, but also involves substantial buried surface area.[3][4] RI's affinity for ribonucleases is important, since many ribonucleases have cytotoxic and cytostatic effects that correlate well with ability to bind RI.[5] Mammalian RIs are unable to bind certain pancreatic ribonuclease family members from other species. In particular, amphibian RNases, such ranpirnase and amphinase from the Northern leopard frog, escape mammalian RI and have been noted to have ...
Beyond being a catalyst in the rate-limiting step in testosterone reduction, 5α-reductase isoforms I and II reduce progesterone to 5α-dihydroprogesterone (5α-DHP) and deoxycorticosterone to dihydrodeoxycorticosterone (DHDOC). In vitro and animal models suggest subsequent 3α-reduction of DHT, 5α-DHP and DHDOC lead to neurosteroid metabolites with effect on cerebral function. These neurosteroids, which include allopregnanolone, tetrahydrodeoxycorticosterone (THDOC), and 3α-androstanediol, act as potent positive allosteric modulators of GABAA receptors, and have antidepressant, anxiolytic, prosexual, and anticonvulsant effects.[33] 5α-Dihydrocortisol is present in the aqueous humor of the eye, is synthesized in the lens, and might help make the aqueous humor itself.[34] 5α-Dihydroaldosterone is a potent antinatriuretic agent, although different from aldosterone. Its formation in the kidney is enhanced by restriction of dietary salt, suggesting it may help retain sodium.[35] 5α-DHP is a ...
Vicianinska beta-glukozidaza (EC 3.2.1.119, vicijaninska hidrolaza) je enzim sa sistematskim imenom (R)-vicijanin beta-D- ... Преузето из „https://sr.wikipedia.org/w/index.php?title=Vicianinska_beta-glukozidaza&oldid=15686363" ...
Chiba S (august 1997). "Molecular mechanism in alpha-glucosidase and glucoamylase". Biosci. Biotechnol. Biochem. 61 (8): 1233-9 ... Monomerni protein sadrži centraln domen u kojem je osam paralelnih beta-lanaca okružeo sa osam paralelnih alfa niti. Unutar ove ... Yamamoto E, Makino Y, Omichi K (maj 2007). "Active site mapping of amylo-alpha-1,6-glucosidase in porcine liver glycogen ... Gillard BK, White RC, Zingaro RA, Nelson TE (septembar 1980). "Amylo-1,6-glucosidase/4-alpha-glucanotransferase. Reaction of ...
"Protein prenylation in glucose-induced insulin secretion from the pancreatic islet beta cell: a perspective". Journal of ...
When used in the central nervous system to alleviate neurological symptoms, such as rivastigmine in Alzheimer's disease, all cholinesterase inhibitors require doses to be increased gradually over several weeks, and this is usually referred to as the titration phase. Many other types drug treatments may require a titration or stepping up phase. This strategy is used to build tolerance to adverse events or to reach a desired clinical effect.[12] This also prevents accidental overdose and is therefore recommended when initiating treatment with drugs that are extremely potent and/or toxic (drugs with a low therapeutic index). ...
Glucosidases. *Cellulase. *Alpha-glucosidase *Acid. *Neutral AB. *Neutral C. *Beta-glucosidase *cytosolic ...
... steryl-beta-glucosidase activity, cholesterol allpha-glucosyltransferase activity ...
In response to a report of precancerous changes in the pancreases of rats and organ donors treated with the DPP-4 inhibitor sitagliptin,[21][22] the United States FDA and the European Medicines Agency each undertook independent reviews of all clinical and preclinical data related to the possible association of DPP-4 inhibitors with pancreatic cancer. In a joint letter to the New England Journal of Medicine, the agencies stated that they had not yet reached a final conclusion regarding a possible causative relationship.[23]. A 2014 meta-analysis found no evidence for increased pancreatic cancer risk in people treated with DPP-4 inhibitors, but owing to the modest amount of data available, was not able to completely exclude possible risk.[24]. ...
... aryl-beta-glucosidase, beta-D-glucosidase, beta-glucoside glucohydrolase, arbutinase, amygdalinase, p-nitrophenyl beta- ... glucosidase, primeverosidase, amygdalase, linamarase, salicilinase, and beta-1,6-glucosidase. Amygdalin beta-glucosidase ... a related enzyme Prunasin beta-glucosidase Vicianin beta-glucosidase PDB: 3AHX​; Jeng WY, Wang NC, Lin MH, Lin CT, Liaw YC, ... Beta-glucosidase is an enzyme that catalyzes the hydrolysis of the glycosidic bonds to terminal non-reducing residues in beta-D ...
In enzymology, a prunasin beta-glucosidase (EC 3.2.1.118) is an enzyme that catalyzes the chemical reaction (R)-prunasin + H2O ... The systematic name of this enzyme class is prunasin beta-D-glucohydrolase. This enzyme is also called prunasin hydrolase. ...
beta-glucosidase [Xanthomonas gardneri] beta-glucosidase [Xanthomonas gardneri]. gi,1120833987,gnl,PRJNA344031,BI317 0,gb, ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
6-phospho-beta-glucosidase [Escherichia coli W]. * This record was replaced or removed. The sequence YP_006173076 is 100% ...
Hydrolysis of terminal, non-reducing beta-D-glucosyl residues with release of beta-D-glucose. UniProt ...
Polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and ... The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase, or beta-glucosidase ... Polypeptides having beta-glucosidase activity and polynucleotides encoding same. Title: Polypeptides having beta-glucosidase ... The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta- ...
Crystal structure of beta-glucosidase A from Bacillus polymyxa: insights into the catalytic activity in family 1 glycosyl ...
Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide. ... "Substrate (aglycone) specificity of human cytosolic beta-glucosidase.". Berrin J.-G., Czjzek M., Kroon P.A., McLauchlan W.R., ... "Substrate (aglycone) specificity of human cytosolic beta-glucosidase.". Berrin J.-G., Czjzek M., Kroon P.A., McLauchlan W.R., ... "Substrate (aglycone) specificity of human cytosolic beta-glucosidase.". Berrin J.-G., Czjzek M., Kroon P.A., McLauchlan W.R., ...
Shop a large selection of MP Biomedicals beta-Glucosidase from Sweet Almonds products and learn more about MP Biomedicals beta- ... beta-Glucosidase. For Use With (Application). Potential applications in pharmaceutical, cosmetic and detergent industries, ...
... methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. Is also able to hydrolyze phospho-N,N-diacetylchitobiose ... Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, ... 6-phospho-beta-glucosidaseAdd BLAST. 449. Proteomic databases. PaxDb, a database of protein abundance averages across all three ... 6-phospho-beta-glucosidase activity Source: EcoCyc ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a direct assay for the ...
Acid beta-Glucosidase Deficiencies. An autosomal recessive disorder caused by a deficiency of Acid beta-Glucosidase ( ...
Similar Discussions: Immobilization of Beta-glucosidase with glutaraldehyde * Vitamin A and Beta Carotene (Replies: 1) ... I want to immobilize beta-glucosidase (on Sepabeads with an amine group). The problem I have is I dont have a strong chemical/ ... Can the Beta carbons of ketones act as nucleophiles? And one more question. (Replies: 3) ... Barium Borate- beta BBO crystals (what am I looking at?) (Replies: 3) ...
View Human Cytosolic beta-Glucosidase/GBA3 Antibody (AF5969) datasheet. Validated in IP, WB ... Cytosolic beta-Glucosidase; Cytosolic beta-glucosidase-like protein 1; EC 3.2.1.21; GBA3; GLUC; glucosidase, beta, acid 3 ( ... There are three beta-glucosidases (GBA) in human genome. GBA1 endodes a lysosomal membrane protein that cleaves the beta- ... GBA2 encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides. GBA3 is a cytosolic beta- ...
IC50 values are 1 and 100 μM for β-glucosidase and α-glucosidase respectively). Upregulates CD1d expression by THP-1 cells… ... Selective, irreversible β-glucosidase inhibitor (IC50 values are 1 and 100 μM for β-glucosidase and α-glucosidase respectively ...
An efficient beta-glucosidase facilitates hydrolysis at specified process conditions, and key points to consider in this ... In this review, we discuss the important role beta-glucosidases play in complex biomass hydrolysis and how they create a ... Among the cellulose degrading enzymes, beta-glucosidases are essential for efficient hydrolysis of cellulosic biomass as they ... alternatives to the currently available enzyme preparations either by improving known or screening for new beta-glucosidases. ...
Crystal structures of complexes of N-butyl- and N-nonyl-deoxynojirimycin bound to acid beta-glucosidase: insights into the ... ACID-BETA-GLUCOSIDASE WITH N-BUTYL-DEOXYNOJIRIMYCIN (2v3d). (see also Treatment of Gaucher disease) ... Crystal structures of complexes of N-butyl- and N-nonyl-deoxynojirimycin bound to acid beta-glucosidase: insights into the ... Gaucher disease is caused by mutations in the gene encoding acid beta-glucosidase (GlcCerase), resulting in glucosylceramide ( ...
furostanol glycoside 26-O-beta-glucosidase: from Costus speciosus rhizomes; specifically cleaves the C-26-bound glucose moiety ... Glucosidases: 578*Cellulases: 33*beta-Glucosidase: 195*furostanol glycoside 26-O-beta-glucosidase ... furostanol glycoside 26-O-beta-glucosidase. Subscribe to New Research on furostanol glycoside 26-O-beta-glucosidase ...
A digestive beta-glucosidase from the silkworm, Bombyx mori: cDNA cloning, expression and enzymatic characterization. Download ... A digestive beta-glucosidase cDNA was cloned from the silkworm, Bombyx mori. The B. mori beta-glucosidase cDNA contains an open ... VL - 141 IS - 4 N2 - A digestive beta-glucosidase cDNA was cloned from the silkworm, Bombyx mori. The B. mori beta-glucosidase ... mori beta-glucosidase to be a single gene. Northern blot analysis of B. mori beta-glucosidase gene confirmed larval midgut- ...
Competitive Inhibition constant on almonds beta Glucosidase; LI=Limited inhibition. ...
A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was purified to homogeneity after cultivation on a cellulose and ... A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was purified to homogeneity after cultivation on a cellulose and ... Characterization and kinetic analysis of a thermostable GH3 beta-glucosidase from Penicillium brasilianum. Krogh, Kristian B. R ... article{bf417611-2d38-438f-96a9-4ab1a291f9a9, abstract = {A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was ...
The CPT codes provided are based on AMA guidelines and are for informational purposes only. CPT coding is the sole responsibility of the billing party. Please direct any questions regarding coding to the payer being billed ...
Compared with free beta-glucosidase, the immobilized enzyme exhibited: (i) a similar pH optimum but more activity at lower pH ... beta-Glucosidase of Aspergillus phoenicis QM 329 was immobilized on chitosan, using the bifunctional agent glutaraldehyde. The ... Compared with free beta-glucosidase, the immobilized enzyme exhibited: (i) a similar pH optimum but more activity at lower pH ... beta-Glucosidase of Aspergillus phoenicis QM 329 was immobilized on chitosan, using the bifunctional agent glutaraldehyde. The ...
beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1. Rodjana OPASSIRI, Yanling HUA, ... beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1 ... beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1 ... beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1 ...
The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.
For specimen collection and processing instructions, refer to the Genetics Laboratory Test Directory for Beta-Glucosidase at: ...
The E358S mutant of Agrobacterium sp beta-glucosidase is a greatly improved glycosynthase. ... The E358S mutant of Agrobacterium sp beta-glucosidase is a greatly improved glycosynthase. ... The E358S mutant of Agrobacterium sp beta-glucosidase is a greatly improved glycosynthase ... beta-glucosidase (Abg) by mutating the nucleophile glutamate to alanine (E358A), synthesizes oligosaccharides in yields ...
Effect of differently post-treated dewatered sewage sludge on beta-glucosidase activity, microbial biomass carbon, basal ... Effect of differently post-treated dewatered sewage sludge on beta-glucosidase activity, microbial biomass carbon, basal ... "Effect of differently post-treated dewatered sewage sludge on beta-glucosidase activity, microbial biomass carbon, basal ...
  • Tiessen, Axel 2011-06-22 00:00:00 The hydrolysis of beta-d-glucosidic bonds which is required for the liberation of many physiologically important compounds is catalyzed by the enzyme beta-glucosidase (BGLU, EC 3.2.1.21). (deepdyve.com)
  • and (iv) β-glucosidase (EC 3.2.1.21, BGL). (frontiersin.org)
  • A beta-glucosidase (EC 3.2.1.21) was purified to homogeneity from cell-free extracts of an extremely thermophilic anaerobic bacterium. (waikato.ac.nz)
  • Cellobiases (EC 3.2.1.21) or beta-glucosidases hydrolyse the exocellulase product into individual monosaccharides. (wikipedia.org)
  • Beta-glucosidase catalyzes the hydrolysis of the glycosidic bonds to terminal non-reducing residues in beta-D-glucosides and oligosaccharides, with release of glucose. (wikipedia.org)
  • Beta-glucosidase is also capable of hydrolysis on small oligomers that are produced by other enzymes without the assistance of an intermediate enzyme. (wikipedia.org)
  • Hydrolysis of terminal, non-reducing beta-D-glucosyl residues with release of beta-D-glucose. (rcsb.org)
  • GBA2 encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides. (rndsystems.com)
  • Among the cellulose degrading enzymes, beta-glucosidases are essential for efficient hydrolysis of cellulosic biomass as they relieve the inhibition of the cellobiohydrolases and endoglucanases by reducing cellobiose accumulation. (mdpi.com)
  • In this review, we discuss the important role beta-glucosidases play in complex biomass hydrolysis and how they create a bottleneck in industrial use of lignocellulosic materials. (mdpi.com)
  • An efficient beta-glucosidase facilitates hydrolysis at specified process conditions, and key points to consider in this respect are hydrolysis rate, inhibitors, and stability. (mdpi.com)
  • Almond beta-glucosidase was used to catalyze the transglycosylation of p-nitrophenyl-beta-D-glucoside to alkyl glucosides, with hydrolysis to glucose as a side reaction. (lu.se)
  • The recombinant Beta -glucosidase catalyses the hydrolysis of cellobiose and salicin. (ccsenet.org)
  • the hydrolysis of glycosidic terpenes by Ap-beta-gl was studied, and its ability to efficiently release free terpenols was demonstrated by gas chromatography/mass spectrometry. (unifesp.br)
  • A new β-glucosidase enzyme which is tolerant to glucose and cellobiose, and which is effective for the hydrolysis of cellobiose to glucose, is disclosed. (google.com)
  • Within such scope, the present work aimed to evaluate the feasibility of entrapping beta-glucosidase in either sol gel or in Lentikats supports for application in cellobiose hydrolysis, and to perform the characterization of the resulting bioconversion systems. (unicamp.br)
  • Lentikats-entrapped glucosidase was used in 19 consecutive batch runs for cellobiose hydrolysis, without noticeable decrease in product yield. (unicamp.br)
  • The specific reaction involved is the hydrolysis of the 1,4-beta-D- glycosidic linkages in cellulose, hemicellulose , lichenin , and cereal beta-D-glucans . (wikipedia.org)
  • An autosomal recessive disorder caused by a deficiency of Acid beta-Glucosidase ( Glucosylceramidase ) leading to intralysosomal accumulation of glycosylceramide mainly in Cells of the Mononuclear Phagocyte System . (online-medical-dictionary.org)
  • Gaucher disease is caused by mutations in the gene encoding acid beta-glucosidase (GlcCerase), resulting in glucosylceramide (GlcCer) accumulation. (proteopedia.org)
  • Crystal structures of complexes of N-butyl- and N-nonyl-deoxynojirimycin bound to acid beta-glucosidase: insights into the mechanism of chemical chaperone action in Gaucher disease. (proteopedia.org)
  • of the native human acid β-glucosidase, expressed in cultured plant cells (pGlcCerase, 2v3f ) on those of N-butyl-deoxynojirimycin/pGlcCerase ( 2v3d ), N-nonyl-deoxynojirimycin/pGlcCerase ( 2v3e ), and isofagomine/deglycosylated Cerezyme (IFG/DG-Cerezyme, 2nsx ) reveals significant structural identity, neither of these ligands causes structural changes upon binding to the enzyme. (proteopedia.org)
  • The B. mori beta-glucosidase cDNA contains an open reading frame of 1473 bp encoding 491 amino acid residues. (unboundmedicine.com)
  • The B. mori beta-glucosidase possesses the amino acid residues involved in catalysis and substrate binding conserved in glycosyl hydrolase family 1. (unboundmedicine.com)
  • Global Markets Direct's, 'Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) - Pipeline Review, H1 2016', provides in depth analysis on Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) targeted pipeline therapeutics. (reportsnreports.com)
  • The report provides comprehensive information on the Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45), targeted therapeutics, complete with analysis by indications, stage of development, mechanism of action (MoA), route of administration (RoA) and molecule type. (reportsnreports.com)
  • Additionally, the report provides an overview of key players involved in Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) targeted therapeutics development and features dormant and discontinued projects. (reportsnreports.com)
  • For more information, see Newborn Screening Act Sheet Gaucher Disease: Decreased Acid Beta-Glucosidase in Special Instructions. (testcatalog.org)
  • Gaucher disease is an autosomal recessive lysosomal storage disorder caused by reduced or absent acid beta-glucosidase (glucocerebrosidase) enzyme activity. (testcatalog.org)
  • Significantly reduced or absent enzyme activity of acid beta-glucosidase is diagnostic. (testcatalog.org)
  • Gaucher disease (GD) is an autosomal recessive lysosomal storage disorder caused by mutations in the glucosidase, beta, acid (GBA) gene that encodes the lysosomal enzyme glucosylceramidase (GCase). (pnas.org)
  • The first GCase-deficient mouse was created by insertion of the neomycin resistance gene into glucosidase, beta, acid (gba) exons 9 and 10 ( 17 ). (pnas.org)
  • The present invention provides a novel β-glucosidase nucleic acid sequence, designated bgl6, and the corresponding BGL6 amino acid sequence. (justia.com)
  • The present invention relates to isolated bgl6 nucleic acid sequences which encode polypeptides having beta-glucosidase activity. (justia.com)
  • In the case of the Christmas Island red crab beta glucosidase not only produces glucose, but also removes cellobiose. (wikipedia.org)
  • In enzymology, a prunasin beta-glucosidase (EC 3.2.1.118) is an enzyme that catalyzes the chemical reaction (R)-prunasin + H2O ⇌ {\displaystyle \rightleftharpoons } D-glucose + mandelonitrile Thus, the two substrates of this enzyme are (R)-prunasin and H2O, whereas its two products are D-glucose and mandelonitrile. (wikipedia.org)
  • beta-Glucosidases are involved in the last step of the degradation of cellulosic biomass and hydrolyse the beta-glycosidic linkage between two adjacent molecules in dimers and oligomers of glucose. (diva-portal.org)
  • D-glucono-δ-Lactone + H2O2This enzyme is used for enzymatic determination of glucose, and for amylase-activity assay when coupled with α-glucosidase (AGH-201, AGH- 211, if maltooligosaccharide or modified starch is used as a. (sorachim.com)
  • β-glucosidases (BGLs) hydrolyze cello-oligosaccharides to glucose and play a crucial role in the enzymatic saccharification of cellulosic biomass. (frontiersin.org)
  • Inhibition of the beta-glucosidase by substrates and glucose is negligible. (waikato.ac.nz)
  • This β-glucosidase may be used in conjunction with cellulolytic enzymes for the treatment of cellulosic materials to convert cellulose to glucose. (google.com)
  • This invention relates to a β-glucosidase effective for hydrolyzing cellobiose to glucose, which has a high tolerance to glucose and cellobiose. (google.com)
  • Beta-glucocerebrosidase is a housekeeping enzyme that helps break down a large molecule called glucocerebroside into a sugar (glucose) and a simpler fat molecule (ceramide). (medlineplus.gov)
  • In this specific case, the glucose produced inhibits the action of beta-glucosidase. (eurekalert.org)
  • To increase saccharification efficiency, the beta-glucosidase has to be highly glucose tolerant. (eurekalert.org)
  • The formation of extracellular endo-1,4-beta-glucanases was induced by cellobiose and repressed by glucose. (helmholtz-hzi.de)
  • beta-Glucosidase activity was inhibited noncompetitively by glucose. (helmholtz-hzi.de)
  • Cellulases break down the cellulose molecule into monosaccharides ("simple sugars") such as beta- glucose , or shorter polysaccharides and oligosaccharides . (wikipedia.org)
  • Under specific conditions, may alternatively catalyze the reverse reaction, transferring glucose from cholesteryl-beta-D-glucoside to ceramide (PubMed:26724485). (genecards.org)
  • Finally, may also hydrolyze cholesteryl-beta-D-glucoside to produce D-glucose and cholesterol (PubMed:24211208, PubMed:26724485). (genecards.org)
  • They hydrolyze terminal (1,4)alpha-glucosidic linkages and (1,6)beta-glucosidic linkages, liberating alpha-glucose and beta-glucose. (genecards.org)
  • Among the cellulolytic enzyme complex, β-glucosidase plays a key role and is the most critical that catalyze the final step in cellulose and hemicellulose into glucose [ 7 ]. (omicsonline.org)
  • Thus, β-glucosidases allow the cellulolytic enzymes to function more efficiently by producing glucose from cellobiose and reducing cellobiose inhibition [ 9 ]. (omicsonline.org)
  • instead, three-dimensional structural overlaps with other enzymes of known function suggested that SPy1599 contains a phosphate-binding pocket in the active site and has possible 6-phospho-beta-glycosidase activity. (ubc.ca)
  • Of these enzymes, β-glucosidase activity plays a relevant role in the transformation of the phenolic glycosides present in the olive fruit, generating different secoiridoid derivatives. (frontiersin.org)
  • The main goal of the present study was to characterize olive fruit β-glucosidase genes and enzymes responsible for the phenolic composition of virgin olive oil. (frontiersin.org)
  • Bacillus licheniformis was grown in minimal nutrient medium containing 1% (w/v) of distillers dried grain with soluble (DDGS), palm kernel meal (PKM), wheat bran (WB) or copra meal (CM), and the enzyme activity of endoglucanase, β-glucosidase, xylanase and reducing sugars was measured to investigate a possibility of using cost-effective agricultural residues in producing cellulolytic and hemicellulolytic enzymes. (ajas.info)
  • In the arsenal of necessary enzymes acting synergistically, beta-glucosidases are crucially important for their role in the last step of the cellulose saccharification cascade. (eurekalert.org)
  • beta-Glucosidases represent an important group of enzymes due to their pivotal role in various biotechnological processes. (unicamp.br)
  • Glycosylases are a group of enzymes that includes glucosidases, mannosidases and heparanases. (genecards.org)
  • Cellulase is a family of at least 3 groups of enzymes, endo-(1, 4)-β-Dglucanase, exo-(1,4)-β-D-glucanase and β-glucosidases. (omicsonline.org)
  • In the case of beta-glucosidase, two carboxylate residues of glucosides, cellobiose, cellotriose, cellotetraose are involved at the active site. (wikipedia.org)
  • Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. (uniprot.org)
  • The B. mori beta-glucosidase cDNA was expressed as a 57-kDa polypeptide in baculovirus-infected insect Sf9 cells, and the recombinant beta-glucosidase was active on cellobiose and lactose, but not active on salicin, indicating that the B. mori beta-glucosidase possesses the characteristics of the Class 2 enzyme. (unboundmedicine.com)
  • The BGL had significant lower affinity for cellobiose compared with the artificial substrate para-nitrophenyl-beta-d-glucopyranoside (pNP-Glc) and further, pronounced substrate inhibition using pNP-Glc. (lu.se)
  • Lineweaver-Burk plots for p-nitrophenyl beta-glucoside, o-nitrophenyl beta-glucoside and cellobiose substrates are biphasic concave-downwards. (waikato.ac.nz)
  • Abeta- glucosidase gene bglB from Bacillus polymyxa 1.794 was cloned into the recombinant E. coli P81 and beta-glucosidase was expressed to give a new recombinant strain E. coli P81 (pUC19-bglB) with dual functions of cellobiose degradation and ethanol production . (bvsalud.org)
  • The exoglucanase/xylanase Cex from Cellulomonas fimi hydrolyzes beta-1,4-glycosidic bonds with net retention of anomeric configuration, releasing the disaccharides beta-cellobiose or beta-xylobiose. (nih.gov)
  • In the presence of sodium azide a new product, beta-cellobiosyl azide, is formed with these mutants whereas only cellobiose is formed with wild-type enzyme or the Glu127Asp mutant under similar conditions. (nih.gov)
  • GBA (Glucosylceramidase Beta) is a Protein Coding gene. (genecards.org)
  • The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase, or beta-glucosidase activity and isolated polynucleotides encoding polypeptides. (osti.gov)
  • Production of cellulase and beta-glucosidase activity during growth of the actinomycete Micromonospora chalcae on cellulose-containing media. (ulster.ac.uk)
  • Cellulase activity reached a maximum after 8 days and the beta-glucosidase activity was maximal within 16 to 18 days. (ulster.ac.uk)
  • Fingerprint Dive into the research topics of 'Production of cellulase and beta-glucosidase activity during growth of the actinomycete Micromonospora chalcae on cellulose-containing media. (ulster.ac.uk)
  • The bglu1 cDNA for a β-glucosidase cloned from rice ( Oryza sativa L.) seedlings was expressed as a soluble and active protein in Escherichia coli and designated BGlu1. (biochemj.org)
  • To be able to produce large amounts of enzyme, the beta-glucosidase coding gene from these isolates is cloned and transferred to bacteria that can grow fast and are easily controlled for their growth, such as Escherichia coli. (unair.ac.id)
  • The enzyme activity of the purified recombinant beta-glucosidase expressed in baculovirus-infected insect cells was approximately 665 U per microg of recombinant B. mori beta-glucosidase. (unboundmedicine.com)
  • The purified recombinant B. mori beta-glucosidase showed the highest activity at 35 degrees C and pH 6.0, and were stable at 50 degrees C at least for 10 min. (unboundmedicine.com)
  • Treatment of recombinant virus-infected Sf9 cells with tunicamycin, a specific inhibitor of N-glycosylation, revealed that the recombinant B. mori beta-glucosidase is N-glycosylated, but the carbohydrate moieties are not essential for enzyme activity. (unboundmedicine.com)
  • High purity recombinant β-Glucosidase ( Phanerochaete chrysosporium ) for use in research, biochemical enzyme assays and in vitro diagnostic analysis. (megazyme.com)
  • To achieve that, we have isolated an olive β-glucosidase gene from cultivar Picual ( OepGLU ), expressed in Nicotiana benthamiana leaves and purified its corresponding recombinant enzyme. (frontiersin.org)
  • Western blot analysis showed that recombinant OepGLU protein is detected by an antibody raised against the purified native olive mesocarp β-glucosidase enzyme, and exhibits a deduced molecular mass of 65.0 kDa. (frontiersin.org)
  • PDF] Immobilization of Aspergillus beta-glucosidase on chitosan. (semanticscholar.org)
  • beta-Glucosidase of Aspergillus phoenicis QM 329 was immobilized on chitosan, using the bifunctional agent glutaraldehyde. (semanticscholar.org)
  • A 2526 bp gene encoding Aspergillus niger Beta-glucosidase was chemically synthesized for its heterologous expression in methylotrophic yeast Pichia pastoris , using methanol as inducer. (ccsenet.org)
  • The GBA gene provides instructions for making an enzyme called beta-glucocerebrosidase. (medlineplus.gov)
  • It gets broken down by beta-glucocerebrosidase when cells die, and the components are reused as new cells are formed. (medlineplus.gov)
  • Most of the GBA gene mutations responsible for Gaucher disease change single protein building blocks (amino acids) in beta-glucocerebrosidase, altering the structure of the enzyme and preventing it from working normally. (medlineplus.gov)
  • Mutations in the GBA gene greatly reduce or eliminate the activity of beta-glucocerebrosidase in cells. (medlineplus.gov)
  • These mutations result in the production of an altered beta-glucocerebrosidase enzyme. (medlineplus.gov)
  • The systematic name of this enzyme class is prunasin beta-D-glucohydrolase. (wikipedia.org)
  • Also known as Periplasmic beta-glucosidase (Beta-D-glucoside glucohydrolase) (Cellobiase) (Gentiobiase). (mybiosource.com)
  • Cellulose is a polymer composed of beta-1,4-linked glucosyl residues. (wikipedia.org)
  • The most significant oligosaccharide beta-glucosidase reacts with is cellulose. (wikipedia.org)
  • During the digestive process of the bonnethead shark, the acidic stomach weakens the cell walls of the seagrass and allows for beta-glucosidase to enter the cell and digest the cellulose. (wikipedia.org)
  • A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was purified to homogeneity after cultivation on a cellulose and xylan rich medium. (lu.se)
  • The formation and location of endo-1,4-beta-glucanases and beta-glucosidases were studied in cultures of Cellulomonas uda grown on microcrystalline cellulose, carboxymethyl cellulose, printed newspaper, and some mono- or disaccharides. (helmholtz-hzi.de)
  • Some characteristics such as the optimal pH for and the thermostability of the endoglucanases and beta-glucosidases and the end products of cellulose degradation were determined. (helmholtz-hzi.de)
  • redefine GBA2 activity as the beta-glucosidase that is sensitive to inhibition by N-butyldeoxygalactonojirimycin. (antikoerper-online.de)
  • However, humans do require beta-glucosidase, Lysosomal β-glucosidase, as it plays an important role in the degradation of glycosphingolipids. (wikipedia.org)
  • GBA1 endodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glucosylceramide. (rndsystems.com)
  • Below are the list of possible Lysosomal beta glucosidase products. (mybiosource.com)
  • This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. (genecards.org)
  • Functional expression of human liver cytosolic beta-glucosidase in Pichia pastoris. (uniprot.org)
  • Detects human Cytosolic beta ‑Glucosidase/GBA3 in direct ELISAs and Western blots. (rndsystems.com)
  • Detection of Human Cytosolic beta ‑Glucosidase/GBA3 by Western Blot Western blot shows lysates of human kidney (cortex) tissue. (rndsystems.com)
  • PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human Cytosolic beta ‑Glucosidase/GBA3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5969) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016 ). (rndsystems.com)
  • A specific band was detected for Cytosolic beta ‑Glucosidase/GBA3 at approximately XXX kDa (as indicated). (rndsystems.com)
  • GBA3 is a cytosolic beta-glucosidase and is predominantly expressed in liver. (rndsystems.com)
  • These data indicate that cytosolic beta-glucosidase is a hepatocyte-specific enzyme, and support the hypothesis that cytosolic beta-glucosidase in the liver functions to hydrolyze small glucosides absorbed by the intestine. (wikigenes.org)
  • The enzyme is purified by anion-exchange chromatography, the molecular mass and isoelectric point of purified beta-glucosidase are measured by sodium dodecylsulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and isoelectric focusing and the stability and kinetic parameters of the enzyme assessed by spectrophotometry. (semanticscholar.org)
  • We have isolated a heat-stable, low molecular weight activator peptide(s) from monkey parotid gland that specifically activated human salivary beta-D-glucosidase. (ias.ac.in)
  • Cys) of the retaining beta-glucosidase from Agrobacterium sp. (ubc.ca)
  • We analyzed the activities of CBE-sensitive β-glucosidase (GBA1) and AMP-DNM-sensitive β-glucosidase (GBA2) in total cell lysates and PM of human fibroblast cell lines from control (normal) subjects and from patients with GD clinical types 1, 2, and 3. (biomedsearch.com)
  • See the reference protein sequence for MULTISPECIES: beta-glucosidase (WP_074056525.1). (nih.gov)
  • Crystallographic studies of ReCel3A revealed a highly N-glycosylated three-domain dimeric protein, as has been observed previously for glycoside hydrolase family 3 beta-glucosidases. (diva-portal.org)
  • Analysis of the exocellular activity of Candida molischiana 35M5N grown on different carbon sources revealed that the biosynthesis of beta-glucosidase is derepressed in this yeast strain. (pasteur.fr)
  • in this work, the production of a beta-glucosidase by an Aureobasidium pullulans strain (Ap-beta-gl) isolated from grape ecosystems was evaluated. (unifesp.br)
  • The β- glucosidases activity of these three potential cellulolytic bacteria was performed by measuring the release of PNP using pNPG as a substrate and interestingly D4 strain was resulted with β-glucosidases negative where B1 strain was found to have efficient for β-glucosidases activity. (omicsonline.org)
  • However, recent studies of the shark's hindgut has found that it has a high activity level of beta glucosidase. (wikipedia.org)
  • Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide. (uniprot.org)
  • One Unit of β-glucosidase activity is defined as the amount of enzyme required to release one µmole of of p -nitrophenol ( p NP) per minute from p -nitrophenyl-β-D-glucopyranoside (5 mM) in sodium acetate buffer (100 mM), pH 5.0 at 40 o C. (megazyme.com)
  • Highly fluorescent β-glucosidase probe for monitoring β-glucosidase activity where 1st order kinetics are desired. (antibody-antibodies.com)
  • The enzyme is active against a wide range of aryl beta-glycosides and beta-linked disaccharides, with beta-galactosidase activity only slightly less than beta-glucosidase activity, and significant beta-xylosidase activity. (waikato.ac.nz)
  • Subsequent kinetic analysis indeed showed that SPy1599 has 6-phospho-beta-glucosidase (EC 3.2.1.86) activity. (ubc.ca)
  • The extracellular beta-glucosidaseactivity was 84.78 mU/mL broth and the extracellular cellobiase activity of E. coli P81 (pUC19-bglB) was 32.32 mU/mL broth. (bvsalud.org)
  • Distinguished from most of the beta-glucosidases derived from fungi , which display the highest activities under acidic conditions, rBgl1B exhibited relatively higher activity and stability at pH between 7.0 and 9.0. (bvsalud.org)
  • beta-Glucosidase activity was isolated and had a Km of 0.25mM for the substrate p-nitrophenyl-beta-D-glucoside. (ulster.ac.uk)
  • In this study, cellulolytic bacteria with potential β-glucosidases activity were isolated and screened from biogas plant effluent and dairy effluent near Jahangirnagar University campus. (omicsonline.org)
  • Cellulases ( endoglucanases ), cellobiosidases ( exoglucanases ), and beta-glucosidases are required by organisms (some fungi , bacteria ) that can consume it. (wikipedia.org)
  • Microbial beta-glucosidases have been used for the enhancement of wine aroma. (unifesp.br)
  • This gene encodes the beta-subunit of glucosidase II, an N-linked glycan-processing enzyme in the endoplasmic reticulum. (nih.gov)
  • Beta-glucosidases, Cellulases (endoglucanases), cellobiosidases (exoglucanases) are required by a number of organisms to consume it. (wikipedia.org)
  • In this study, it is shown that substituting the beta-glucosidase from H. jecorina (HjCel3A) with the beta-glucosidase Cel3A from the thermophilic fungus Rasamsonia emersonii (ReCel3A) in enzyme mixtures results in increased efficiency in the saccharification of lignocellulosic materials. (diva-portal.org)
  • The production of beta-glucosidase by the ligninolytic fungus Pleurotus ostreatus has been studied in different culture media containing agro-industrial wastes. (semanticscholar.org)
  • In this study, a β-glucosidase coding gene (bgl) of the zygomycete fungus Rhizomucor miehei has been cloned and characterized. (usda.gov)
  • The objective of this study was thus to investigate production profiles of endoglucanase, β-glucosidase, xylanase, and reducing sugars grown on mineral minimum nutrient media containing different agricultural residues. (ajas.info)
  • The hydrolytic step was catalysed by a double residue (N221S, P342L) mutant of the thermostable beta-glucosidase (TnBgl1A), isolated from the thermophile Thermotoga neapolitana and cloned and produced in E. coli. (lu.se)
  • GBA3 efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiological beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides. (rndsystems.com)
  • Liquid chromatographic and electrophoretic characterisation of extracellular beta-glucosidase of Pleurotus ostreatus grown in organic waste. (semanticscholar.org)
  • Endo-1,4-Glucanases were found to be extracellular, but a very small amount of cell-bound endo-1,4-beta-glucanase was considered to be the basal endoglucanase level of the cells. (helmholtz-hzi.de)
  • The B. mori beta-glucosidase mRNA expression in larval midgut was detectable only during feeding period, whereas its expression was downregulated during starvation. (unboundmedicine.com)
  • An isolated gene from Neosartorya fischeri NRRL181 encoding a β-glucosidase (BGL) was cloned, and its nucleotide sequence was determined. (dtu.dk)
  • A digestive beta-glucosidase cDNA was cloned from the silkworm, Bombyx mori. (unboundmedicine.com)
  • Purification and properties of a stable beta-glucosidase from an extremely thermophilic anaerobic bacterium. (waikato.ac.nz)