beta-Glucosidase: An exocellulase with specificity for a variety of beta-D-glycoside substrates. It catalyzes the hydrolysis of terminal non-reducing residues in beta-D-glucosides with release of GLUCOSE.Oligo-1,6-Glucosidase: An enzyme that catalyzes the endohydrolysis of 1,6-alpha-glucosidic linkages in isomaltose and dextrins produced from starch and glycogen by ALPHA-AMYLASES. EC 3.2.1.10.alpha-Glucosidases: Enzymes that catalyze the exohydrolysis of 1,4-alpha-glucosidic linkages with release of alpha-glucose. Deficiency of alpha-1,4-glucosidase may cause GLYCOGEN STORAGE DISEASE TYPE II.Glucosidases: Enzymes that hydrolyze O-glucosyl-compounds. (Enzyme Nomenclature, 1992) EC 3.2.1.-.1-Deoxynojirimycin: An alpha-glucosidase inhibitor with antiviral action. Derivatives of deoxynojirimycin may have anti-HIV activity.IndolizinesGlycogen Debranching Enzyme System: 1,4-alpha-D-Glucan-1,4-alpha-D-glucan 4-alpha-D-glucosyltransferase/dextrin 6 alpha-D-glucanohydrolase. An enzyme system having both 4-alpha-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33) activities. As a transferase it transfers a segment of a 1,4-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or another 1,4-alpha-D-glucan. As a glucosidase it catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-1,6-glucosidase activity is deficient in glycogen storage disease type III.Oligosaccharides: Carbohydrates consisting of between two (DISACCHARIDES) and ten MONOSACCHARIDES connected by either an alpha- or beta-glycosidic link. They are found throughout nature in both the free and bound form.Interleukin-1beta: An interleukin-1 subtype that is synthesized as an inactive membrane-bound pro-protein. Proteolytic processing of the precursor form by CASPASE 1 results in release of the active form of interleukin-1beta from the membrane.Mannosidases: Glycoside hydrolases that catalyze the hydrolysis of alpha or beta linked MANNOSE.Imino Pyranoses: Six-carbon pyranose sugars in which the OXYGEN is replaced by a NITROGEN atom.Rauwolfia: A plant genus of the APOCYNACEAE or dogbane family. Alkaloids from plants in this genus have been used as tranquilizers and antihypertensive agents. RESERPINE is derived from R. serpentina.beta 2-Microglobulin: An 11-kDa protein associated with the outer membrane of many cells including lymphocytes. It is the small subunit of the MHC class I molecule. Association with beta 2-microglobulin is generally required for the transport of class I heavy chains from the endoplasmic reticulum to the cell surface. Beta 2-microglobulin is present in small amounts in serum, csf, and urine of normal people, and to a much greater degree in the urine and plasma of patients with tubular proteinemia, renal failure, or kidney transplants.GlucosamineCalnexin: A lectin found in ENDOPLASMIC RETICULUM membranes that binds to specific N-linked OLIGOSACCHARIDES found on newly synthesized proteins. It may play role in PROTEIN FOLDING or retention and degradation of misfolded proteins in the endoplasmic reticulum.Endoplasmic Reticulum: A system of cisternae in the CYTOPLASM of many cells. In places the endoplasmic reticulum is continuous with the plasma membrane (CELL MEMBRANE) or outer membrane of the nuclear envelope. If the outer surfaces of the endoplasmic reticulum membranes are coated with ribosomes, the endoplasmic reticulum is said to be rough-surfaced (ENDOPLASMIC RETICULUM, ROUGH); otherwise it is said to be smooth-surfaced (ENDOPLASMIC RETICULUM, SMOOTH). (King & Stansfield, A Dictionary of Genetics, 4th ed)Swainsonine: An indolizidine alkaloid from the plant Swainsona canescens that is a potent alpha-mannosidase inhibitor. Swainsonine also exhibits antimetastatic, antiproliferative, and immunomodulatory activity.PolysaccharidesCarbohydrate Metabolism, Inborn ErrorsGlycoside HydrolasesIsomaltose: A disaccharide consisting of two glucose units in an alpha (1-6) glycosidic linkage.Glycosylation: The chemical or biochemical addition of carbohydrate or glycosyl groups to other chemicals, especially peptides or proteins. Glycosyl transferases are used in this biochemical reaction.Carbohydrate Sequence: The sequence of carbohydrates within POLYSACCHARIDES; GLYCOPROTEINS; and GLYCOLIPIDS.Receptors, Adrenergic, beta: One of two major pharmacologically defined classes of adrenergic receptors. The beta adrenergic receptors play an important role in regulating CARDIAC MUSCLE contraction, SMOOTH MUSCLE relaxation, and GLYCOGENOLYSIS.Integrin beta3: An integrin beta subunit of approximately 85-kDa in size which has been found in INTEGRIN ALPHAIIB-containing and INTEGRIN ALPHAV-containing heterodimers. Integrin beta3 occurs as three alternatively spliced isoforms, designated beta3A-C.Glycoproteins: Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Acarbose: An inhibitor of ALPHA-GLUCOSIDASES that retards the digestion and absorption of DIETARY CARBOHYDRATES in the SMALL INTESTINE.Hexosaminidases: Enzymes that catalyze the hydrolysis of N-acylhexosamine residues in N-acylhexosamides. Hexosaminidases also act on GLUCOSIDES; GALACTOSIDES; and several OLIGOSACCHARIDES.Glycogen Storage Disease Type II: An autosomal recessively inherited glycogen storage disease caused by GLUCAN 1,4-ALPHA-GLUCOSIDASE deficiency. Large amounts of GLYCOGEN accumulate in the LYSOSOMES of skeletal muscle (MUSCLE, SKELETAL); HEART; LIVER; SPINAL CORD; and BRAIN. Three forms have been described: infantile, childhood, and adult. The infantile form is fatal in infancy and presents with hypotonia and a hypertrophic cardiomyopathy (CARDIOMYOPATHY, HYPERTROPHIC). The childhood form usually presents in the second year of life with proximal weakness and respiratory symptoms. The adult form consists of a slowly progressive proximal myopathy. (From Muscle Nerve 1995;3:S61-9; Menkes, Textbook of Child Neurology, 5th ed, pp73-4)Trisaccharides: Oligosaccharides containing three monosaccharide units linked by glycosidic bonds.Nipah Virus: A species of HENIPAVIRUS, closely related to HENDRA VIRUS, which emerged in Peninsular Malaysia in 1998. It causes a severe febrile VIRAL ENCEPHALITIS in humans and also encephalitis and RESPIRATORY TRACT INFECTIONS in pigs. Fruit bats (PTEROPUS) are the natural host.Escherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.Cellobiose: A disaccharide consisting of two glucose units in beta (1-4) glycosidic linkage. Obtained from the partial hydrolysis of cellulose.Escherichia coli Proteins: Proteins obtained from ESCHERICHIA COLI.ArbutinPhenylacetates: Derivatives of phenylacetic acid. Included under this heading are a variety of acid forms, salts, esters, and amides that contain the benzeneacetic acid structure. Note that this class of compounds should not be confused with derivatives of phenyl acetate, which contain the PHENOL ester of ACETIC ACID.Disaccharides: Oligosaccharides containing two monosaccharide units linked by a glycosidic bond.GlucosidesDictionaries, MedicalGlucosylceramidase: A glycosidase that hydrolyzes a glucosylceramide to yield free ceramide plus glucose. Deficiency of this enzyme leads to abnormally high concentrations of glucosylceramide in the brain in GAUCHER DISEASE. EC 3.2.1.45.Gaucher Disease: An autosomal recessive disorder caused by a deficiency of acid beta-glucosidase (GLUCOSYLCERAMIDASE) leading to intralysosomal accumulation of glycosylceramide mainly in cells of the MONONUCLEAR PHAGOCYTE SYSTEM. The characteristic Gaucher cells, glycosphingolipid-filled HISTIOCYTES, displace normal cells in BONE MARROW and visceral organs causing skeletal deterioration, hepatosplenomegaly, and organ dysfunction. There are several subtypes based on the presence and severity of neurological involvement.Saposins: A group of four homologous sphingolipid activator proteins that are formed from proteolytic cleavage of a common protein precursor molecule referred to as prosaposin.Dictionaries as Topic: Lists of words, usually in alphabetical order, giving information about form, pronunciation, etymology, grammar, and meaning.Lignin: The most abundant natural aromatic organic polymer found in all vascular plants. Lignin together with cellulose and hemicellulose are the major cell wall components of the fibers of all wood and grass species. Lignin is composed of coniferyl, p-coumaryl, and sinapyl alcohols in varying ratios in different plant species. (From Merck Index, 11th ed)Biofuels: Hydrocarbon-rich byproducts from the non-fossilized BIOMASS that are combusted to generate energy as opposed to fossilized hydrocarbon deposits (FOSSIL FUELS).Cellulases: A family of glycosidases that hydrolyse crystalline CELLULOSE into soluble sugar molecules. Within this family there are a variety of enzyme subtypes with differing substrate specificities that must work together to bring about complete cellulose hydrolysis. They are found in structures called CELLULOSOMES.Cellulose: A polysaccharide with glucose units linked as in CELLOBIOSE. It is the chief constituent of plant fibers, cotton being the purest natural form of the substance. As a raw material, it forms the basis for many derivatives used in chromatography, ion exchange materials, explosives manufacturing, and pharmaceutical preparations.Hydrolysis: The process of cleaving a chemical compound by the addition of a molecule of water.Cellulase: An endocellulase with specificity for the hydrolysis of 1,4-beta-glucosidic linkages in CELLULOSE, lichenin, and cereal beta-glucans.Spirostans: Cholestane derivatives containing a fused lactone ring at the 16,17-position and a spiroglycosidic linkage at C-22. Members include sarsaponin, DIOSGENIN and yamogenin.Costus: A plant genus of the family Costaceae (sometimes classified in Zingiberaceae), order Zingiberales, subclass Zingiberidae, class Liliopsida (monocotyledons). It is a source of SAPONINS and furostanol glycosides.Tribulus: A plant genus of the family ZYGOPHYLLACEAE. Members contain steroidal saponins. Ingestion by grazing animals causes PHOTOSENSITIVITY DISORDERS called geeldikkop (yellow thick head) in South Africa.Rhizome: Root-like underground horizontal stem of plants that produces shoots above and roots below. Distinguished from true roots which don't have buds and nodes. Similar to true roots in being underground and thickened by storage deposits.Glycosides: Any compound that contains a constituent sugar, in which the hydroxyl group attached to the first carbon is substituted by an alcoholic, phenolic, or other group. They are named specifically for the sugar contained, such as glucoside (glucose), pentoside (pentose), fructoside (fructose), etc. Upon hydrolysis, a sugar and nonsugar component (aglycone) are formed. (From Dorland, 28th ed; From Miall's Dictionary of Chemistry, 5th ed)Polygonatum: A plant genus of the family LILIACEAE. Members contain benzoquinones, steroidal saponin, and ribosome-inactivating proteins.Cardiac Glycosides: Cyclopentanophenanthrenes with a 5- or 6-membered lactone ring attached at the 17-position and SUGARS attached at the 3-position. Plants they come from have long been used in congestive heart failure. They increase the force of cardiac contraction without significantly affecting other parameters, but are very toxic at larger doses. Their mechanism of action usually involves inhibition of the NA(+)-K(+)-EXCHANGING ATPASE and they are often used in cell biological studies for that purpose.

The DNA binding site of the Dof protein NtBBF1 is essential for tissue-specific and auxin-regulated expression of the rolB oncogene in plants. (1/814)

The Dof proteins are a large family of plant transcription factors that share a single highly conserved zinc finger. The tobacco Dof protein NtBBF1 was identified by its ability to bind to regulatory domain B in the promoter of the rolB oncogene. In this study, we show that the ACT T TA target sequence of NtBBF1 in domain B is necessary for tissue-specific expression of rolB. beta-Glucuronidase (GUS) activity of tobacco plants containing a rolB promoter-GUS fusion with a mutated NtBBF1 target sequence within domain B is almost completely suppressed in apical meristems and is severely abated in the vascular system. The ACT T TA motif is shown here also to be one of the cis-regulatory elements involved in auxin induction of rolB. The pattern of NtBBF1 expression in plants is remarkably similar to that of rolB, except in mesophyll cells of mature leaves, in which only NtBBF1 expression could be detected. Ectopic expression of rolB in mesophyll cells was achieved by particle gun delivery if the NtBBF1 binding sequence was intact. These data provide evidence that in the plant, a Dof protein DNA binding sequence acts as a transcriptional regulatory motif, and they point to NtBBF1 as the protein involved in mediating tissue-specific and auxin-inducible expression of rolB.  (+info)

Stochastic and nonstochastic post-transcriptional silencing of chitinase and beta-1,3-glucanase genes involves increased RNA turnover-possible role for ribosome-independent RNA degradation. (2/814)

Stochastic and nonstochastic post-transcriptional gene silencing (PTGS) in Nicotiana sylvestris plants carrying tobacco class I chitinase (CHN) and beta-1,3-glucanase transgenes differs in incidence, stability, and pattern of expression. Measurements with inhibitors of RNA synthesis (cordycepin, actinomycin D, and alpha-amanitin) showed that both forms of PTGS are associated with increased sequence-specific degradation of transcripts, suggesting that increased RNA turnover may be a general feature of PTGS. The protein synthesis inhibitors cycloheximide and verrucarin A did not inhibit degradation of CHN RNA targeted for PTGS, confirming that PTGS-related RNA degradation does not depend on ongoing protein synthesis. Because verrucarin A, unlike cycloheximide, dissociates mRNA from ribosomes, our results also suggest that ribosome-associated RNA degradation pathways may not be involved in CHN PTGS.  (+info)

Molecular cloning and expression of the novel fungal beta-glucosidase genes from Humicola grisea and Trichoderma reesei. (3/814)

A novel fungal beta-glucosidase gene (bgl4) and its homologue (bgl2) were cloned from the cellulolytic fungi Humicola grisea and Trichoderma reesei, respectively. The deduced amino acid sequences of H. grisea BGL4 and T. reesei BGL2 comprise 476 and 466 amino acids, respectively, and share 73.1% identity. These beta-glucosidases show significant homology to plant beta-glucosidases belonging to the beta-glucosidase A (BGA) family. Both genes were expressed in Aspergillus oryzae, and the recombinant beta-glucosidases were purified. Recombinant H. grisea BGL4 is a thermostable enzyme compared with recombinant T. reesei BGL2. In addition to beta-glucosidase activity, recombinant H. grisea BGL4 showed a significant level of beta-galactosidase activity, while recombinant T. reesei BGL2 showed weak beta-galactosidase activity. Cellulose saccharification by Trichoderma cellulases was improved by the addition of recombinant H. grisea BGL4.  (+info)

Properties of beta-glucosidase in cultured skin fibroblasts from controls and patients with Gaucher disease. (4/814)

Membrane-bound beta-glucosidase from cultured skin fibroblasts can be solubilized in an active form by treatment of membrane preparations with a mixture of Triton X-100 and sodium taurocholate. Several properties of the solubilized enzyme have been studied in fibroblasts from normal, healthy individuals and from 14 patients with different clinical forms of Gaucher disease. The patients studied were classified as follows: group 1 consisted of 10 chronic patients, all (with one exception) of Ashkenazi Jewish origin; group 2 consisted of three black American patients with severe visceral symptoms, manifest from early childhood, but with no apparent neurological involvement; and group 3 consisted of a single white patient with the classical infantile form of the disease. Specific beta-glucosidase activity ranged from 6.6% to 16.5% mean control value in group 1 patients and from 4.1% to 5.8% in groups 2 and 3. When compared with the enzyme from control fibroblasts, the enzyme from chronic Gaucher patients (group 1) was more rapidly inactivated at 50 degrees C, had an altered pH curve, was less effectively inhibited by deoxycorticosterone-beta-glucoside, and was more effectively inhibited by deoxycorticosterone. The enzyme from patients in groups 2 and 3 was qualitatively indistinguishable from the control enzyme in terms of these parameters. No differences in Km (4-methylumbelliferyl-beta-glucoside) or sedimentation coefficient were found between the beta-glucosidases from control and Gaucher cells. The results demonstrate that cells from Ashkenazi Jewish patients with the chronic form of Gaucher disease contain a structurally altered form of beta-glucosidase. This enzyme differs both from normal beta-glucosidase and from the residual enzyme in patients of different ethnic origin and with clinically more severe forms of the disease.  (+info)

Growth of Azospirillum irakense KBC1 on the aryl beta-glucoside salicin requires either salA or salB. (5/814)

The rhizosphere nitrogen-fixing bacterium Azospirillum irakense KBC1 is able to grow on pectin and beta-glucosides such as cellobiose, arbutin, and salicin. Two adjacent genes, salA and salB, conferring beta-glucosidase activity to Escherichia coli, have been identified in a cosmid library of A. irakense DNA. The SalA and SalB enzymes preferentially hydrolyzed aryl beta-glucosides. A Delta(salA-salB) A. irakense mutant was not able to grow on salicin but could still utilize arbutin, cellobiose, and glucose for growth. This mutant could be complemented by either salA or salB, suggesting functional redundancy of these genes in salicin utilization. In contrast to this functional homology, the SalA and SalB proteins, members of family 3 of the glycosyl hydrolases, show a low degree of amino acid similarity. Unlike SalA, the SalB protein exhibits an atypical truncated C-terminal region. We propose that SalA and SalB are representatives of the AB and AB' subfamilies, respectively, in glycosyl hydrolase family 3. This is the first genetic implication of this beta-glucosidase family in the utilization of beta-glucosides for microbial growth.  (+info)

Yeast VSM1 encodes a v-SNARE binding protein that may act as a negative regulator of constitutive exocytosis. (6/814)

We have screened for proteins that interact with v-SNAREs of the late secretory pathway in the yeast Saccharomyces cerevisiae. A novel protein, designated Vsm1, binds tightly to the Snc2 v-SNARE in the two-hybrid system and can be coimmunoprecipitated with Snc1 or Snc2 from solubilized yeast cell extracts. Disruption of the VSM1 gene results in an increase of proteins secreted into the medium but does not affect the processing or secretion of invertase. In contrast, VSM1 overexpression in cells which bear a temperature-sensitive mutation in the Sec9 t-SNARE (sec9-4 cells) results in the accumulation of non-invertase-containing low-density secretory vesicles, inhibits cell growth and the secretion of proteins into the medium, and blocks rescue of the temperature-sensitive phenotype by SNC1 overexpression. Yet, VSM1 overexpression does not affect yeast bearing a sec9-7 allele which, in contrast to sec9-4, encodes a t-SNARE protein capable of forming a stable SNARE complex in vitro at restrictive temperatures. On the basis of these results, we propose that Vsm1 is a novel v-SNARE-interacting protein that appears to act as negative regulator of constitutive exocytosis. Moreover, this regulation appears specific to one of two parallel exocytic paths which are operant in yeast cells.  (+info)

Cellobiose transport by mixed ruminal bacteria from a Cow. (7/814)

The transport of cellobiose in mixed ruminal bacteria harvested from a holstein cow fed an Italian ryegrass hay was determined in the presence of nojirimycin-1-sulfate, which almost inhibited cellobiase activity. The kinetic parameters of cellobiose uptake were 14 microM for the Km and 10 nmol/min/mg of protein for the Vmax. Extracellular and cell-associated cellobiases were detected in the rumen, with both showing higher Vmax values and lower affinities than those determined for cellobiose transport. The proportion of cellobiose that was directly transported before it was extracellularly degraded into glucose increased as the cellobiose concentration decreased, reaching more than 20% at the actually observed levels of cellobiose in the rumen, which were less than 0.02 mM. The inhibitor experiment showed that cellobiose was incorporated into the cells mainly by the phosphoenolpyruvate phosphotransferase system and partially by an ATP-dependent and proton-motive-force-independent active transport system. This finding was also supported by determinations of phosphoenolpyruvate phosphotransferase-dependent NADH oxidation with cellobiose and the effects of artificial potentials on cellobiose transport. Cellobiose uptake was sensitive to a decrease in pH (especially below 6.0), and it was weakly but significantly inhibited in the presence of glucose.  (+info)

Transcriptional regulation in the hyperthermophilic archaeon Pyrococcus furiosus: coordinated expression of divergently oriented genes in response to beta-linked glucose polymers. (8/814)

The genetic organization, expression, and regulation of the celB locus of the hyperthermophilic archaeon Pyrococcus furiosus were analyzed. This locus includes the celB gene, which codes for an intracellular beta-glucosidase, and a divergently orientated gene cluster, adhA-adhB-lamA, which codes for two alcohol dehydrogenases and an extracellular beta-1,3-endoglucanase that is transcribed as a polycistronic messenger (the lamA operon). During growth of P. furiosus on either the beta-1,4-linked glucose dimer cellobiose or the beta-1,3-linked glucose polymer laminarin, the activities of both beta-glucosidase and endoglucanase were increased at least fivefold compared with levels during growth on maltose or pyruvate. Northern blot analysis revealed an enhanced transcription of both the celB gene and the lamA operon in the presence of these glucose-containing substrates. The in vivo and in vitro transcription initiation sites of both the celB gene and the lamA operon were identified 25 nucleotides downstream of conserved TATA box motifs. A number of repeating sequences have been recognized in the celB-adhA intergenic region, some of which might be part of a transcriptional regulator-binding site.  (+info)

BioAssay record AID 593427 submitted by ChEMBL: Inhibition of sweet almond beta-glucosidase after 10 mins using 4-nitrophenylbeta-D-glucopyranoside as a substrate by Lineweaver-Burk and double reciprocal analysis.
Shop Lysosomal beta glucosidase ELISA Kit, Recombinant Protein and Lysosomal beta glucosidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
Heritage Products Sweet Almond Oil (8 fl Oz)-Enjoy Heritage Products Sweet Almond Oil - 8 fl oz every day at these amazing prices! Heritage Products Sweet Almond Oil Description: Skin Lotion Massage Oil Cosmetic ....Learn More At Kalyx.com.
... - Oil Sweet Almond carrier oil is nourishing, softening and revitalizing all skin types. Sweet Almond Oil is avaliable cold pressed from just aromatherapys Pure Carrier oils range
Aroma Beads | Fragrance Oil | Potpourri Sweet Almond Oil 16 oz. Bottle [16OZSWAO] - Sweet Almond Oil 16 oz. Bottle (Great for use as a carrier oil) Sweet Almond oil is a skin nutrient used to beautify the skin and treat injuries. It is also known to condition and soften your skin, offering excellent penetrating properties. Skin will appreciate the rich minerals, vitamins and proteins
Shop Glucan endo-1,6-beta-glucosidase ELISA Kit, Recombinant Protein and Glucan endo-1,6-beta-glucosidase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
BioAssay record AID 220893 submitted by ChEMBL: Competitive Inhibition constant on almonds beta Glucosidase; LI=Limited inhibition.
WITH RICE BRAN WATER& POMEGRANATE EXTRACT SWISSE SWEET ALMOND GENTLE CREAMCLEANSER gently yet effectively cleanses the skin,removing impurities while leaving the skin feeling softand balanced. Enriched with Sweet Almond Oil to nourishthe skin, Witch Hazel Water to soothe the skin and Rice Bran Water to improve skin hydration. Suitable For: Normal or dry skin types Size: 125mL
In patients with connective tissue disease it is common for collagen and elastin to become injured by inflammation. It blocks the nerve impulses that cause your facial muscles to contract and form lines. Can You Use Sweet Almond Oil For Dark Circles Affordable Regimen Care throughout its history it has been used as a cartilage support product. Encontre Botox Capilar - Produtos de Cabelo no Mercado Livre Brasil. skin aging thinning You should consult with a health care professional how to rejuvenate my face naturally really covering before starting any diet Can You Use Sweet Almond Oil For Dark Circles Affordable Regimen Care exercise or supplementation program before taking any medication or Having said this TMJ is not one of those disorders of which the FDA has approved. Student Self Governance. do collagen filler creams work 2016 do collagen filler creams work 2016 The Pellev treatment is virtually painless and generally quite pleasurable Anti Aging Cream For Face - Best Moisturizing Cream ...
beta-Glucosidases represent an important group of enzymes due to their pivotal role in various biotechnological processes. One of the most prominent is biomass degradation for the production of fuel ethanol from cellulosic agricultural residues and wastes, where the use of immobilized biocatalysts may prove advantageous. Within such scope, the present work aimed to evaluate the feasibility of entrapping beta-glucosidase in either sol gel or in Lentikats supports for application in cellobiose hydrolysis, and to perform the characterization of the resulting bioconversion systems. The activity and stability of the immobilized biocatalyst over given ranges of temperature and pH values were assessed, as well as kinetic data, and compared to the free form, and the operational stability was evaluated. Immobilization increased the thermal stability of the enzyme, with a 10 degrees C shift to an optimal temperature in the case of sol gel support. Mass transfer hindrances as a result of immobilization ...
3GNR: Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with covalently bound 2-deoxy-2-fluoroglucoside to the catalytic nucleophile E396
Biology lecturer of Faculty of Science and Technology, Universitas Airlangga (FST UNAIR) used beta-glucosidase enzyme producing microorganisms in Indonesia for ginseng active compound biotransformation
Sweet almond oil, made from pressed almonds, is an odorless, pale-yellow liquid with a nutty taste. Its similar to olive oil in composition and can be used as a substitute. Its not, however, to be confused with bitter almond oil, which has a pungent flavor and is typically used as a flavoring agent.
Sweet Almond Oil is rich in vitamin E, essential fatty acids and other minerals that support the body. It is great carrier oil or can be used unaided.
Koa & Sweet Almond Soothing Herbal Cleansing Stick by Hempz is a two-in-one skin care formula that exfoliates and cleanses. Rich lather gently cleanses skin leaving it feeling refreshed and clean. Fine walnut shell gently exfoliates skin leaving it soft and smooth.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Vitilevure 58W3 contributes an overall well-balanced mouthfeel with floral and fruity aromas. Allows for the release of bound terpenes in aromatic varieties due to the beta-glucosidase activity. This enhances classic varietal characteristics.
Mix all ingredients together in a dropper bottle and shake gently to combine. To use, apply to babys skin after bath using only a tiny bit. For a 10 pound infant, 6 to 8 drops is sufficient for arms and legs as only a light layer is necessary for baby skin. Use more for toddlers and larger babies. If fresh oils are used to make this product, the shelf life will be somewhere in the neighborhood of 6 months. It will last longer if kept refrigerated during any extended periods of non-use. If the product begins to smell badly, the oils have become rancid and the product should be discarded ...
Mix all ingredients together in a dropper bottle and shake gently to combine. To use, apply to babys skin after bath using only a tiny bit. For a 10 pound infant, 6 to 8 drops is sufficient for arms and legs as only a light layer is necessary for baby skin. Use more for toddlers and larger babies. If fresh oils are used to make this product, the shelf life will be somewhere in the neighborhood of 6 months. It will last longer if kept refrigerated during any extended periods of non-use. If the product begins to smell badly, the oils have become rancid and the product should be discarded ...
reference: Structure of acid beta-glucosidase with pharmacological chaperone provides insight into Gaucher disease., Lieberman RL, Wustman BA, Huertas P, Powe AC Jr, Pine CW, Khanna R, Schlossmacher MG, Ringe D, Petsko GA, Nat Chem Biol. 2007 Feb;3(2):101-107. Epub 2006 Dec 24. PMID: 17187079 ...
We also started working on some of the constructs needed to engineer our bacterial strains, namely: the bacterial construct A0, composed of a TraR-regulated promoter (P-TraR) followed by a beta-glucosidase (BBa_K392008), an E.coli ribosome binding site (RBS, BBa_J15001) and a double terminator (BBa_B0015); the bacterial construct B1, identical to A0 but under the transcriptional control of a LasR-regulated promoter (P-LasR, BBa_R0079); the bacterial construct B2, consisting of a constitutive promoter (BBa_J23119), an RBS (BBa_B0034), a LasR activator (BBa_C0179) and a terminator; and the bacterial construct B3, made of P-LasR, an RBS, the TraI gene and a terminator. ...
bsr:I33_4084 K01223 6-phospho-beta-glucosidase [EC:3.2.1.86] , (GenBank) beta-glucosidase (A) MSSNAKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPYDESMTSLNLYHN GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLSFYDDLFDELLKHH IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL HAPFTGGGLVFEEGENKRNAMYQAAHHQFVASALAVKAGHEIIPDSKIGCMIAATTTYPM TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY QKPLFIVENGLGAVDKVEDDGTIQDDYRINYLRDHLIEVREAIADGVELIGYTSWGPIDL VSASTAEMKKRYGFIYVDRDNEGNGTLNRIKKKSFIWYQQVIATNGESI ...
APRICON FARMAS HEALTH adalah kapsul biji aprikot yang mengandungi vitamin B17 yang paling tinggi di dunia. Dalam terapi metabolic, apabila vitamin B17 bertemu dengan sel-sel kanser, enzim Beta-Glucosidase yang hanya terdapat pada sel-sel kanser akan menguraikan elemen-elemen yang terdapat dalam vitamin B17. Seterusnya elemen-elemen yang terdapat di dalam vitamin B17 yang telah terurai akan bertindak membunuh sel-sel kanser. ...
1. Sweet Almond Oil for the body: a source of vitamins A and E, it improves skin suppleness and accelerates its renewal. Its infinite softness makes it an ally for all skin types, soothing the most sensitive to the driest ...
Todays Deals: Save 10% on Linha Seve Natura - Refil Oleo Corporal Amendoas Doces com Enxague 200 Ml - (Natura Seve Collection - Refill Sweet Almonds Body...
Looking for online definition of Acid beta-glucosidase deficiency in the Medical Dictionary? Acid beta-glucosidase deficiency explanation free. What is Acid beta-glucosidase deficiency? Meaning of Acid beta-glucosidase deficiency medical term. What does Acid beta-glucosidase deficiency mean?
Sweet Almond Carrier Oil - Oil Sweet Almond carrier oil is nourishing, softening and revitalizing all skin types. Sweet Almond Oil is avaliable cold pressed from just aromatherapys Pure Carrier oils range
An autosomal recessive disorder caused by a deficiency of Acid beta-Glucosidase (Glucosylceramidase) leading to intralysosomal accumulation of glycosylceramide mainly in Cells of the Mononuclear Phagocyte System. The characteristic Gaucher Cells, glycosphingolipid-filled Histiocytes, displace normal Cells in Bone Marrow and visceral organs causing skeletal deterioration, hepatosplenomegaly, and organ dysfunction. There are several subtypes based on the presence and severity of neurological involvement ...
Prunus Amygdalus Dulcis Oil, better known as Sweet Almond Oil, is derived from the fruits of the almond tree. Prunus Amygdalus Dulcis, also known as the Almond Tree, has been cultivated for thousands of years in India and in the Middle East. People have revered it for skin care and for culinary reasons throughout the ages. The use of almonds in skin care and beauty can date all the way back to the ancient Hindus. The ancient Hindu civilization used to make a paste from crushed almonds and then use it as a natural cleanser for the body.. Prunus Amygdalus Dulcis might fall in the same family as cherry, plum and peach trees, but it doesnt offer a fleshy fruit. As a deciduous tree, the Prunus Amygdalus Dulcis is famous for its almonds, fruits that have an exterior hull, a seed in the center and an interior shell. Apart from skin care, almonds are used in cookies, candies and breads as well.. Prunus Amygdalus Dulcis Oil is pressed from the nut kernels of the Sweet Almond Tree. This oil is a ...
Save 35% Now Foods - Sweet Almond Oil 8 Fluid Ounces Sweet Almond Oil 100% Pure Moisturizing Oil Nourishing, Promotes Healthy-Looking Skin* USDA Organic Non-GMO Project Verified Hexane Free Condition: For skin in need of clean and natural nourishment, as a moisturizer or for massage. Solution: Certified Organic Almond Oil is a natural oil thats perfect for nourishing and reviving any skin type. Almond Oil is easily absorbed and wont clog pores, promoting clear, soft, healthy-looking skin. This natural skin-nourishing oil is ideal for the entire body. Almond Oil is a natural oil derived from pressed almonds. Vegetable-derived oils date back to Biblical times, when they were mixed with fragrant herbs to create traditional ointments.
Sweet almond carrier oil contains glucosides, minerals and vitamins A, B1, B2, B6 and E. Being rich in protein sweet almond carrier oil is useful for dry, itchy skin, and for cooling overheated skin. The oil is cold-pressed and refined.
... - Browse fuzing.com to find Glucono-Delta-Lactone(GDL) sellers, suppliers, wholesalers, companies, manufacturers, exporters, factories.
... Price for Package of 300 seeds. The almond (Prunus dulcis, syn. Prunus amygdalus) is a species of tree native
We have high quality and highly effective glucono-delta-lactone, gluconic acid 50% solution, sodium gluconate made in China for sale. All of our products are sold at a discount. Please be free to place an order and the customized orders are also welcome.
Translated from Latin, Prunus Amygdalus Dulcis means sweet almond oil and is one of the most frequently used carrier oils and most adaptable body oils for beauty products and massage. Cultivated thousands of years ago, sweet almond oil is extracted from ripe seed kernels that have been dried and crushed through a cold pressing process. Today almonds can be used in anything from exfoliants (using the nut or the kernel as a mechanical exfoliant), used as an emulsifying agent to bind oil and water or as a skin-conditioning product to help soften and hydrate. Pure sweet almond oil contains countless nutrients including calcium, magnesium, phosphorous, and vitamin E. These essential vitamins nurture the skin on the outside and when applied topically, promote softer, more nourished skin.. ...
Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867 ...
Vitamin B17 is harmless to healthy tissue for a very simple reason. Each molecule of B17 contains one unit of cyanide, one unit of benzaldehyde and two of glucose (sugar) tightly locked together. In order for the cyanide to become dangerous it is necessary to first unlock the molecule to release it. This can only be performed by an enzyme called beta-glucosidase, which is present all over the human body in minute quantities. However, beta-glucosidase is present in vast quantities (up to 100 times as high) at only one place: the site of a malignant cancer tumour. Thus, the cyanide is unlocked only at the cancer site with drastic results, which become utterly devastating to the cancer cells because the benzaldehyde unit unlocks at the same time ...
Tytu : Rola w glowodan w we wczesnych reakcjach metabolicznych kie kuj cych nasion ubinu pora onych przez Fusarium oxysporum f.sp. lupini ...
EXO1 (Exoglucanase isoenzyme EXO1) antibodies, Anti-EXO1 (Exoglucanase isoenzyme EXO1) antibody, AS08 322Family 3 β-D-glucan glucohydrolases are widely distributed in higher plants. The enzymes catalyse the hydrolytic removal of β-D-glucosyl re
4IPL: Structural insights into the substrate specificity of a 6-phospho-&[beta]-glucosidase BglA-2 from Streptococcus pneumoniae TIGR4
Beta-glucosidase is a glucosidase enzyme that acts upon β1->4 bonds linking two glucose or glucose-substituted molecules (i.e., the disaccharide cellobiose). It is one o
November 1, 2008 , Article Almond oil is a popular carrier oil because it is non-greasy, spreads easily, and is great for nourishing the skin. Essential oils can be mixed with it because of its light nature. Often called sweet almond oil, it contains strong concentrations of vitamin E.. Keywords: almond oil Secret Ingredient ...
Organic Pistachios Oil. Organic Ground Pistachio. Organic Sweet Almond Oil. Organic Ground Almonds. Illite (French Green Clay). ...
As an aside, I suck at coming up with names for products. Part of that is that I dont think its helpful for you, my lovely reader, to see names like "sweet almond & aloe lotion" and think thats the only way to make that lotion. The part is that although Im a writer, Im not much for flowery language and description. So its easier for me to come up with names like "basic lotion with humectants" or "toner for dry/sensitive skin". Im trying to be more flowery and pretty Pinterest-like, so youll see slightly more descriptive names in the future, but Ill always make it clear that you dont have to use named ingredients if you dont have to do so ...
We have created a synergistic complex of active substances to effectively tone the whole body. Collagen, sweet almond oil and shea butter make your skin more supple. The algae extract activates fat tissue burning, while ginkgo biloba stimulates blood circulation inducing the lipolysis process. The serums ingredients help to slow down adipogenesis - the process of creation of fat cells, and lipogenesis, i.e. the process of fat accumulation in the cells. Using Colway Slimming Serum together with healthy diet is a simple step to achieve the figure you have always dreamt of ...
STUFF sweet almond oil: for more on it, see more on that multi-purpose oil ShiKai borage dry skin remedy original unscented lotion: previously mentioned in ersatz (3): moisturiser plus balm for lips and eyes (Dr Bronner unscented) and sunscreen (BurnOut Eco-Sensitive SPF 30; Elemental Herbs SPF 30 sunstick for lips & eyes). METHOD 1. Wash…
Die Winglet Community bietet ein unabhängiges CME-zertifiziertes Videofortbildungsangebot im Bereich Orthopädie & Unfallchirurgie. Die Online-Plattform bringt Ärzte, Wissenschaftler, Physiotherapeuten, medizinische Fach- und Pflegekräfte sowie Vertreter aus der Industrie auf effiziente Weise zusammen und ermöglicht einen strukturierten und qualitätsgesicherten interdisziplinären Austausch innerhalb des Fachgebiets.
The nucleotide sequence of the celY gene coding for the thermostable exo-1,4-β-glucanase Avicelase II of Clostridium stercorarium was determined. The gene consists of an ORF of 2742 bp which encodes a preprotein of 914 amino acids with a molecular mass of 103 kDa. The signal-peptide cleavage site was identified by comparison with the N-terminal amino acid sequence of Avicelase II purified from C. stercorarium. The celY gene is located in close vicinity to the celZ gene coding for the endo-1,4-β-glucanase Avicelase I. The CelY-encoding sequence was isolated from genomic DNA of C. stercorarium with the PCR technique. The recombinant enzyme produced in Escherichia coli as a LacZ'-CelY fusion protein could be purified using a simple two-step procedure. The properties of CelY proved to be consistent with those of Avicelase II purified from C. stercorarium. Sequence comparison revealed that CelY consists of an N-terminal catalytic domain flanked by a domain of 95 amino acids with unknown function
Profitable biomass conversion processes are highly dependent on the use of efficient enzymes for lignocellulose degradation. Among the cellulose degrading enzymes, beta-glucosidases are essential for efficient hydrolysis of cellulosic biomass as they relieve the inhibition of the cellobiohydrolases and endoglucanases by reducing cellobiose accumulation. In this review, we discuss the important role beta-glucosidases play in complex biomass hydrolysis and how they create a bottleneck in industrial use of lignocellulosic materials. An efficient beta-glucosidase facilitates hydrolysis at specified process conditions, and key points to consider in this respect are hydrolysis rate, inhibitors, and stability. Product inhibition impairing yields, thermal inactivation of enzymes, and the high cost of enzyme production are the main obstacles to commercial cellulose hydrolysis. Therefore, this sets the stage in the search for better alternatives to the currently available enzyme preparations either by improving
The bglu1 cDNA for a β-glucosidase cloned from rice (Oryza sativa L.) seedlings was expressed as a soluble and active protein in Escherichia coli and designated BGlu1. This enzyme hydrolysed β-1,4-linked oligosaccharides with increasing catalytic efficiency (kcat/Km) values as the DP (degree of polymerization) increased from 2 to 6. In contrast, hydrolysis of β-1,3-linked oligosaccharides decreased from DP 2 to 3, and polymers with a DP greater than 3 were not hydrolysed. The enzyme also hydrolysed p-nitrophenyl β-d-glycosides and some natural glucosides but with lower catalytic efficiency than β-linked oligosaccharides. Pyridoxine 5´-O-β-d-glucoside was the most efficiently hydrolysed natural glycoside tested. BGlu1 also had high transglucosylation activity towards pyridoxine, producing pyridoxine 5´-O-β-d-glucopyranoside in the presence of the glucose donor p-nitrophenyl β-d-glucoside.. ...
LOccitane Sweet Almond Shea Butter Liquid Soap: Over 3 independent user reviews summarized in the dooyoo conclusion ✓ Compare 1 shopping deals starting at 15.44£ (16.12.2017)!
Quercetin 3-O-beta-D-glucosyl-(1-,2)-beta-D-glucoside; Baimaside; QUOSP; Quercetin 3-beta-D-sophoroside; Quercetin-3-O-sophoroside; C12667 ...
HEADER HYDROLASE 23-OCT-09 3KE0 TITLE CRYSTAL STRUCTURE OF N370S GLUCOCEREBROSIDASE AT ACIDIC PH. COMPND MOL_ID: 1; COMPND 2 MOLECULE: GLUCOSYLCERAMIDASE; COMPND 3 CHAIN: A, B; COMPND 4 SYNONYM: BETA-GLUCOCEREBROSIDASE, ACID BETA-GLUCOSIDASE, D-GLUCOSYL- COMPND 5 N-ACYLSPHINGOSINE GLUCOHYDROLASE, ALGLUCERASE, IMIGLUCERASE; COMPND 6 EC: 3.2.1.45; COMPND 7 ENGINEERED: YES; COMPND 8 MUTATION: YES SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: HOMO SAPIENS; SOURCE 3 ORGANISM_COMMON: HUMAN; SOURCE 4 ORGANISM_TAXID: 9606; SOURCE 5 GENE: GBA, GC, GLUC; SOURCE 6 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA; SOURCE 7 EXPRESSION_SYSTEM_TAXID: 7108 KEYWDS TIM BARREL, ALTERNATIVE INITIATION, DISEASE MUTATION, DISULFIDE BOND, KEYWDS 2 GAUCHER DISEASE, GLYCOPROTEIN, GLYCOSIDASE, HYDROLASE, ICHTHYOSIS, KEYWDS 3 LIPID METABOLISM, LYSOSOME, MEMBRANE, SPHINGOLIPID METABOLISM EXPDTA X-RAY DIFFRACTION AUTHOR R.R.WEI,S.BOUCHER,C.Q.PAN,T.EDMUNDS REVDAT 1 27-OCT-10 3KE0 0 JRNL AUTH ...
Gaucher disease (GD) is the most common lysosomal storage disorder in humans. It is an autosomal recessive, multisystem disease arising from a deficiency of glucocerebrosidase or beta-glucosidase activity, resulting in the accumulation of a glyco...
Beyond providing Skin Deep® as an educational tool for consumers, EWG offers its EWG VERIFIED™ mark as a quick and easily identifiable way of conveying personal care products that meet EWGs strict health criteria. Before a company can use EWG VERIFIEDTM on such products, the company must show that it fully discloses the products ingredients on their labels or packaging, they do not contain EWG ingredients of concern, and are made with good manufacturing practices, among other criteria. Note that EWG receives licensing fees from all EWG VERIFIED member companies that help to support the important work we do. Learn more , Legal Disclaimer ...
Beyond providing Skin Deep® as an educational tool for consumers, EWG offers its EWG VERIFIED™ mark as a quick and easily identifiable way of conveying personal care products that meet EWGs strict health criteria. Before a company can use EWG VERIFIEDTM on such products, the company must show that it fully discloses the products ingredients on their labels or packaging, they do not contain EWG ingredients of concern, and are made with good manufacturing practices, among other criteria. Note that EWG receives licensing fees from all EWG VERIFIED member companies that help to support the important work we do. Learn more , Legal Disclaimer ...
Vitamin B12 - Cobalamin is essential for production of blood cells in bone marrow, nerve sheets and proteins. Sources are fish, organ meats, dairy and eggs. This is the only B vitamin that cant be found in plant based foods, so vegans should use a good supplement.. Vitamin B17- is a natural cyanide-containing compound that gives up its cyanide content only in the presence of a particular enzyme group called beta glucosidase. Miraculously, this enzyme group is found almost exclusively in cancer tissue, which results in the cancers failure to survive the cyanide. There are no known harmful side effects of B17, and the cyanide in B17 does not affect non-cancerous cells. Sources of B17 are apricot seeds (dont eat more than 10 kernels daily), cranberry, buckwheat and almond.. If you are vegeterian or vegan and you worry that you wont get enough vitamin B-complex from the food you eat, use Vitamin B-Complex supplement.. ...
Laetrile appears to work because the nutrient is actually composed of four separate molecules: two of glucose Replica Belts hermes www.calabipartners.com, one of benzaldyhide and one of cyanide. The latter two chemicals are toxic, but are bound up in a non bioavailable form. Cancer cells contain an enzyme that healthy cells do not, known as beta glucosidase. Hight Quality Replica Belts Until the injury homesite, Meeks, who transferred to Dr Phillips from Boone, was masterful at running the Panthers offense. He moved the ball with both his arm and his legs. He threw two first half touchdown passes a 36 yarder to Proctor Roderick and a 24 yarder to Deionte Gaines. Hight Quality Replica Belts replica belts Forty years ago, a small panel of editors compiled a book entitled "From This Place". Published by Ivan Jesperson, its mission was to showcase a selection of writing by women in Newfoundland and Labrador. There were selections of "life sketches," poems and short stories. replica belts replica ...
Beta-glucosidase is a glucosidase enzyme that acts upon β1->4 bonds linking two glucose or glucose-substituted molecules (i.e., the disaccharide cellobiose). It is one o
Enzyme Technology Laboratory offers enzyme assays to determine activities of key industrial enzymes: cellulase, xylanase, amylase, protease, beta-glucanase, phytase, invertase, beta-glucosidase, pectinase, lipase, and mannanase. Activity of target enzymes is analysed using standard assay methods (IUPAC or other accepted standard methods) under defined optimal working conditions.. With our long-term scientific expertise on research and service in enzyme technology, the highest level of accuracy and reliability are ensured for rapid screening and quantification for multiple enzymes with multiple samples, aiming for your satisfaction.. Samples for enzyme analysis can be provided as liquid or power enzyme samples or as commercial products e.g. animal feed. Enzyme assays from microorganism and assay under non-standard conditions are also available on request. The result is usually sent to the customers within 2 weeks after receiving the samples.. Activity assay for individual ...
Definition: Carbamoyl phosphate synthetase I deficiency is an autosomal recessive inborn error of metabolism of the urea cycle which causes hyperammonemia. Two forms of carbamoyl phosphate synthetase deficiency are recognized: a lethal neonatal type and a less severe, delayed-onset type ...
In the present study, we have shown the antitumoral effect generated by the lis/lin/GO treatment. The linamarase/linamarin system induces cell death in a proportional manner to the linamarin concentration, destroying the entire cell culture in ∼96 to 120 hours. Cyanide mainly inhibits oxidative phosphorylation, the most important cellular source of energy. However, several studies had reported that the mitochondrial function is impaired in tumor cells, resulting in an elevated rate of glycolysis (30-32), which would circumvent the described therapy. In this context, we tried to combine lis/lin system with subtoxic amounts of the glycolysis inhibitor 3-bromo-pyruvate and we did not find any improvement of the therapy (data not shown). We have nevertheless investigated a combination that increases the system aggressiveness by combining a cyanide-inducing process with a nontoxic amount of GO that accelerates death by 48 hours. In the conditions we have used, GO advances cell death without causing ...
Dry hands happen. Thats why this super rich, all-natural hand cream has sweet almond oil and vitamin E to hydrate and shield your hard-working skin. And to ...
An excellent non-foaming cleanser and exfoliator that is ideal for sensitive skin includes date seed powder, sweet almond seed meal, and pumpkin enzymes to smooth rough patches, and neem extract to heal and repair damaged skin., Sundari Neem and Date Seed Body Exfoliator - Body Care
hour care PHYRIS CELL LIFT promises a tightening and firming instant effect thanks to the modern sweet almond lift complex. And thanks to its special formulation, it is also highly suitable for sensitive skin.. An essence from the buds of the wild apple stimulates the cell regeneration and thus improves the skins own protection. The oil of the marula fruit is rich in Vitamin C, which strengthens the skins immune system and stimulates collagen synthesis. For a smooth skin with harmonious radiance.. Home treatment of PHYRIS CELL LIFT:. Apply a hazelnut ...
These gorgeousnatural lipstickscontains organic jojoba, protective quince seed, sweet almond oil and candella and carnauba waxes. The superbotanical
Achieve a natural pop of buildable colour with the nutrient enriched Lip and Cheek Cream. Details The silky-soft formula seamlessly blends into lips and cheeks, imparting a subtle touch of irresistible rosy red colour. Infused with Sweet Almond Oil and Vitamin E, it beautifully hydrates and protects the skin, ensuring
From NUORI, a Vital Facial Cream formulated with hyaluronic acid, known for its powerful hydrating action, the cream restores the skins natural moisture levels. Featuring botanical squalane, jojoba oil and sweet almond oil. Apply daily to face and neck a
With Sweet Almond Oil and Vitamin E, INIKAs Certified Organic Lip and Cheek Cream blends easily into all skin types. Shop today!
In this work a population balance based kinetic model for the action of exoglucanase has been developed. A new mechanism for hydrolysis of cellulose by exoglucanase is proposed in which a bond breakage is a function of position in the chain as well as the susceptibility to enzymatic attack. Having developed the model for the action of endoglucanase in part I of this work, here a mechanistic model ...
Zym information about active ingredients, pharmaceutical forms and doses by Biosans Lifecare, Zym indications, usages and related health products lists
Affiliation:東邦大学,薬学部,教授, Research Field:Chemical pharmacy,Chemical pharmacy, Keywords:イノシトール,シクロフェリトール,ライブラリー,3-エピシクロフェリトール,Cyclophellitol,グルコース,Organolead Reagent,結晶多形,キラリティー,糖鎖, # of Research Projects:12, # of Research Products:26
Prunasin is a cyanogenic glycoside related to amygdalin. Chemically, it is the glucoside of (R)-mandelonitrile. Prunasin is found in species in the genus Prunus such as Prunus japonica or P. maximowiczii and in bitter almonds. It is also found in leaves and stems of Olinia ventosa, O. radiata, O. emarginata and O. rochetiana and in Acacia greggii. It is also found in dandelion coffee, a coffee substitute. Sambunigrin, a diastereomer of prunasin derived from (S)-mandelonitrile instead of it the (R)-isomer, has been isolated from leaves of the elder tree (Sambucus nigra) Prunasin is hydrolyzed to produce hydrogen cyanide. Plants containing prunasin may therefore be toxic to animals, particularly ruminants. Prunasin beta-glucosidase is an enzyme that uses (R)-prunasin and H2O to produce D-glucose and mandelonitrile. Amygdalin beta-glucosidase is an enzyme that uses (R)-amygdalin and H2O to produce (R)-prunasin and D-glucose. Sanchez-Perez, R.; Belmonte, F. S.; Borch, J.; Dicenta, F.; Møller, B. ...
Alpha-glucosidase (EC 3.2.1.20, maltase, glucoinvertase, glucosidosucrase, maltase-glucoamylase, alpha-glucopyranosidase, glucosidoinvertase, alpha-D-glucosidase, alpha-glucoside hydrolase, alpha-1,4-glucosidase, alpha-D-glucoside glucohydrolase) is a glucosidase located in the brush border of the small intestine that acts upon α(1→4) bonds. This is in contrast to beta-glucosidase. Alpha-glucosidase breaks down starch and disaccharides to glucose. Maltase, a similar enzyme that cleaves maltose, is nearly functionally equivalent. Other glucosidases include: Cellulase Beta-glucosidase Debranching enzyme Alpha-glucosidase hydrolyzes terminal non-reducing (1→4)-linked alpha-glucose residues to release a single alpha-glucose molecule. Alpha-glucosidase is a carbohydrate-hydrolase that releases alpha-glucose as opposed to beta-glucose. Beta-glucose residues can be released by glucoamylase, a functionally similar enzyme. The substrate selectivity of alpha-glucosidase is due to subsite affinities ...
Potential of Trichoderma harzianum, Pseudomonas syringae and Pseudomonas chlororaphis for the control of rot in post harvest yams was investigated. Treatments comprising two pathogenic fungi, each paired with three biological antagonists were set up. Degree of rot was evaluated by calculation of percentage reduction by the antagonists. Pathogenicity test showed that Botryodiplodia theobromae and Fusarium solani induced rot in healthy yam tubers after fourteen days of inoculation, B. theobromae being the more virulent with 85.5% rot. Reduction of rot ranged from 53.5 - 84.5% in B. theobromae when paired with the biological antagonists and in F. solani, the rot reduction ranged from 59.6 - 87.1%. Generally, T. harzianum was the most effective in controlling B. theobromae and F. solani. The use of these three biological antagonists, recommends their use in the control of rot in post harvest yam tubers.
See on Scoop.it - Virology and Bioinformatics from Virology.caThe flagellotropic phage 7-7-1 infects motile cells of Agrobacterium sp H13-3 by attaching to and traveling along the rotating flagellar filament to the secondary receptor at the base, where it injects its DNA into the host cell. This is an interesting paper, because it describes a…
Activity tests of enzymes are often applied for determining their concentration. In the easiest case, just one product concentration is measured after a given time. This often leads to nonlinear dependences of the apparent activity with enzyme protein concentration. A general solution of this problem consists in using the balance equation of the assay system, which commonly represents a batch reactor. Here, the balance equation of the batch for a general Michaelis Menten-type reaction kinetics is used as the calibration function. The correlation of the apparent activity and enzyme concentration was established by capturing the enzyme by means of metal chelate interaction owing to a hexahistidine tag attached to the beta-glucanase ...
I have always been told that almonds are a delicious healthy snack. However, what a lot of Americans dont know is that their are actually 2 different types of almonds, and while sweet almonds are indeed a delicious snack, its cousin bitter almonds has a different story.
Sugar Scrub Gently exfoliate your skin with our sugar scrub. Sugar is the perfect natural ingredient to remove dead cells. Our formula, enriched with coconut and sweet almond oils, will leave your skin smooth, silky and perfectly hydrated.Inspired by dark
Miss Jessies has whipped up something wonderful for you and your curls. Handcrafted with love and enriched by Mother Natures natural nectar - honey! The honey is the natural ingredient that locks in moisture and adds natural hold. Inspired by our grandmothers attention to detail, we blended Miss Jessies Honey Curls™ to a perfect consistency to be spreadably smooth for maximum coverage without any greasy build up. Miss Jessies took extra time to create this new sweet almond oil enriched styling emulsion that provides conditioning, hold, moisture, and all day shiny softness. So, glide Miss Jessies Honey Curls™ all over your hair and let your curls soak up the sweet feel of natural and curly perfection. ...
Transform your shower experience with this hydrating shower oil. Leave skin soft and cared for by sweet almond oil and indian rose ingredients. Shop now!
to make a bite, make this paste, easy to apply: mix 2 to 3 measures of bicarbonate, 1 measure of water or sweet almond oil. Rub the stitched part. For stinging insects or ticks with heads under the skin, consult a pharmacist or doctor. Prevent sprinkling bicarbonate on animal carpets and cushions (1 to 2 tablespoons / m2) to discourage mites, fleas and ticks.For sunburn or superficial burns, make the same recipe on a compress, to apply on the skin, for a soothing effect. ...
Ingredients:Purified water, isostearic acid, sweet almond oil, isopropyl myristate, polysorbate 80, cetyl esters, lecithin, progesterone, mixed tocopherols, jojoba oil, DL-Phenylalanine (DLPA), carbomer 940, triethanolamine, quarterniDirections:Apply 1/4 tsp. (about the size of a thumbnail) to desired areas 2-3 times daily.
Ingredients:Purified water, isostearic acid, sweet almond oil, isopropyl myristate, polysorbate 80, cetyl esters, lecithin, progesterone, mixed tocopherols, jojoba oil, DL-Phenylalanine (DLPA), carbomer 940, triethanolamine, quarterniDirections:Apply 1/4 tsp. (about the size of a thumbnail) to desired areas 2-3 times daily.
Caressing, sheathing, exquisite. Radiant Florentine Iris merges with oils of Sweet Almond, Argan and Macadamia Nut. On the skin, they are like a silky whisp
... - Ask a question about ReNu MultiPlus Rewetting Drops, start a discussion about ReNu MultiPlus Rewetting Drops, share y
Opti-Free PureMoist Rewetting Drops at Walgreens. Get free shipping at $35 and view promotions and reviews for Opti-Free PureMoist Rewetting Drops
glycosidase Definition, glycosidase Best Plays of glycosidase in Scrabble® and Words With Friends, Length tables of words in glycosidase, Word growth of glycosidase, Sequences of glycosidase
Clinical Trials - clinicaltrials.gov This study plans to analyze the molecular and clinical mechanisms of the relationship between the GBA mutations and Parkins...
View Gba/Gba Tg(Mx1-cre)1Cgn/0 involves: 129S1/Sv * 129X1/SvJ * C57BL/6 * CBA: phenotypes, images, diseases, and references.
Two new phenolic glucosides, 1-O-benzyl-6-O-E-caffeoyl-beta-d-glucopyranoside and 1-O-(7S,8R)-guaiacylglycerol-(6-O-E-caffeoyl)-beta-d-glucopyranoside, were ...
食品、饮料与营养保健品 (Glycosidase) | 食品、饮料与营养保健品 一站式进行配方,数据表,物质安全数据表搜索,产品特性和样品申请 -- 免费使用
Gentaur molecular products has all kinds of products like :search , SibEm \ Bgl I \ E025 for more molecular products just contact us
Price: US$ 5,400.00. It is estimated that the output of GDL will increase but will not increase a lot. The reasons are listed below.. Firstly, the production cost of GDL will increase, so the price of GDL may keep at a high level, which will in turn restrict the application of GDL. Secondly, the demand for GDL from food industry will increase stably. On one hand, the application field of GDL is still very limited in China by 2012. And it is believed that this situation will not change fast in the coming years because many downstream industries are unfamiliar with GDL at present. On the other hand, as domestic bean curd industry, the largest user of GDL in China, is relatively mature, both the output of bean curd and the market share of lactone bean curd will increase slowly in the coming years.. More information can be found in the report "Production and Market of Glucono-delta-lactone in China" by Guangzhou CCM Information Science & Technology.. To order the report or ask for sample pages ...
Extraction of control human spleen glucocerebrosidase with sodium cholate and butan-l-ol reversibly inactivates the enzyme in terms of its ability to hydrolyse the water-soluble substrate 4-methylumbelliferyl beta-D-glucopyranoside (MUGlc). The acidic brain lipid galactocerebroside 3-sulphate (sulphatide) reconstitutes beta-glucosidase activity in a strongly concentration-dependent manner. In this study we show that sulphatide exhibits three critical micellar concentrations (CMCs): CMC1, 3.72 microM; CMC2, 22.6 microM; CMC3, 60.7 microM. We designate the aggregates formed at these CMCs as primary, secondary and tertiary micelles respectively. From the results of kinetic studies performed at various sulphatide concentrations (0.012-248 microM), we found that sulphatide monomers (less than 3 microM) decreased the Km (for MUGlc) of control glucocerebrosidase from 11 to 4.6 mM, and lowered the Vmax. 2-fold. However, secondary and tertiary micelles were required for expression of high control ...
Nair sensitive hair removal cream is specially formulated for people with sensitive skin and is gentle enough to use anywhere on the body - legs, bikini area, underarms and face. Enriched with sweet almond oil and baby oil, Nair moisturises the skin to leave it totally touchable.,ul,,li,75g,/li,,li,Hair removal cream,/li,,li,Gentle on skin,/li,,li,With moisturising sweet almond oil,/li,,li,Ingredients: Water, Mineral Oil, Calcium Thioglycolate, Cetearyl Alcohol, Calcium Hydroxide, Ceteareth-20, Sodium Hydroxide, Sweet Almond Oil, Fragrance, Iron Oxides.,/li,,li,Warning: For external use only. Avoid contact with eyes. In the unlikely event of irritation, please discontinue use. If necessary, consult your healthcare practitioner.,/li,,/ul,Disclaimer: All efforts have been made to ensure that the ingredient list for this product is correct, complete and up-to-date. ...
affecting the enzyme acid beta-glucosidase (a.k.a. lysosomal glucocerebrosidase, glucosylceramidase, D-glucosyl-N-acylsphingosine glucohydrolase). This enzyme catalyses the breakdown of glucosylceramide, a component of the cell membranes of WBC and RBC. When a macrophage phagocytoses the WBC and RBC that are due for destruction, glucosylceramide accumulates in the macrophage and cannot be eliminated. Glucosylceramide can also accumulate in the brain due to the rapid turnover of complex lipids during brain development and myelin sheath formation.. There are three types of GD, types I, II and III, of which type I is the most common and the least debilitating form. Unlike the other two, type I is non-neuropathic. Symptoms and signs are noted early in life or in early adulthood and includes hepatosplenomegaly, frequent infections, anemia, leukopenia and thrombocytopenia, osteoporosis and arthralgias, yellowish-brown skin pigmentation, and frequent ecchymoses and mucosal bleeding. The bleeding ...
Healthy cells contain rhodanese, and enzyme thats not found in cancer cells. Cancer cells have beta-glucosidase. Rhodanese has the ability to neutralize benzaldehyde and hydrogen cyanide in B17. It turns these into a useful compounds, and the body can use it.. Beta-glucosidase releases benzaldehyde and cyanide from laetrile, and targets cancer cells.. Laetrile also helps the body synthesize more vitamin B12. Statistics shows that many Americans lack this vitamin. When combined with high doses of vitamin C, the nutrients create a huge synergistic power. Plant-based diet is suggested by nutritionists, and your body will get enough vitamins and minerals. Laetrile needs the help of many nutrients to work efficiently. Multi-vitamin supplements will "soothe" the deficiencies.. Laetrile therapy. Laetrile is efficient, but it shouldnt be considered as a primary cancer treatment.. The right doses can do wonders, and laetrile deserves more attention. Its contained in the seeds/kernels of apricot, plum, ...
How To Use Almond Milk. As mentioned before almond milk is easy to make. It should be used in its raw (unroasted) unsweetened state before used on your hair. It can be soaked overnight in just enough water to cover it and then blended until smooth and then strained. This milk can be used in your shampoos, conditioner and deep conditioner. Massage the milk preparation gently into your scalp and leave in hair for an hour or more to maximize the effects of the almond.. Note: When making almond milk be careful that you use sweet almonds (most eating and roasting varieties on the market are sweet almonds). Bitter almonds combined with water releases cyanide.. ...
Safflower oil, for the pan. Place the almonds and 2 1/2 tablespoons of the sugar in a food processor. Run until the almonds are finely ground-almost like flour.. Transfer the ground almonds to a bowl and add the egg yolks, almond milk, orange zest, juice, and vanilla. Stir well to combine. Sprinkle the flour on top and fold it in.. Place the egg whites, salt, and cream of tarter in another mixing bowl. Using an electric mixer, beat until the egg whites on high until foamy. Slowly add the remaining tablespoon sugar and continue to beat until soft peaks form.. Gently scoop the egg whites into the bowl with the rest of the batter and fold them in, being careful not to deflate the egg whites.. Coarsely chop about half the pint of raspberries and fold them into the batter.. Heat a cast-iron skillet or other heavy pan over medium heat for about 5 minutes. Brush lightly with oil. Drip a small amount of batter onto the surface to test-it should not spread much and should be firm and golden brown on the ...
Cytophaga hutchinsonii can rapidly digest crystalline cellulose without free cellulases or cellulosomes. Its cell-contact cellulose degradation mechanism is unknown. In this study, the four β-glucosidase (bgl) genes in C. hutchinsonii were singly and multiply deleted, and the functions of these β-glucosidases in cellobiose and cellulose degradation were investigated. We found that the constitutively expressed BglB played a key role in cellobiose utilization, while BglA which was induced by cellobiose could partially make up for the deletion of bglB. The double deletion mutant ΔbglA/bglB lost the ability to digest cellobiose and could not thrive in cellulose medium, indicating that β-glucosidases were important for cellulose degradation. When cultured in cellulose medium, a small amount of glucose accumulated in the medium in the initial stage of growth for the wild type, while almost no glucose accumulated for ΔbglA/bglB. When supplemented with a small amount of glucose, ΔbglA/bglB started to
A novel type of model substrates, i.e. immobilized p-aminophenyl-β-D-cellooligosaccharides, was developed and used in the study of exocellulases. The two major cellobiohydrolases from Trichoderma reesei, CBH I and CBH II were used as representative enzymes. p-Aminophenyl derivatives of cellobiose (PAPG₂), cellotriose (PAPG₃), and cellotetraose (PAPG₄) were synthesized from the reaction of p-nitrophenol and peracetylated glycosyl bromide of the corresponding cellooligosaccharides under the phase-transfer catalyzed conditions, followed by deacetylation and catalytic hydrogenation. p-Aminophenyl cellooligosaccharides were then tethered via their amino functional groups to N-hydroxy succinimide-activated agarose. The ability of CBH I and CBH II to associate with and catalyze the hydrolysis of reducing end tethered cellooligosaccharides was tested. CBH I catalyzed the hydrolysis of free PAPG₂ but CBH II did not. Both CBH I and CBH II reversibly bound, but did not hydrolyze, immobilized ...
Lysosomes are intracellular organelles that contain hydrolytic enzymes to degrade a variety of macromolecules. Lysosomal storage disorders are a diverse group of inherited diseases where macromolecules accumulate due to defects in their transport mechanisms across the lysosomal membrane or due to defective lysosomal enzyme function. Accumulation of these macromolecules in the lysosomes leads to cell damage and, eventually, organ dysfunction. More than 40 lysosomal storage disorders have been described with a wide phenotypic spectrum.. Gaucher disease is an autosomal recessive lysosomal storage disorder caused by a deficiency of acid beta-glucosidase (glucocerebrosidase: GBA) resulting in increased storage of glucocerebroside (D-glucosylceramide). The deposition of glucocerebroside in macrophages of the reticuloendothelial system (Gaucher cells) causes organ dysfunction and organomegaly. Gaucher cells, found in the spleen, bone marrow, lung, lymph nodes, and liver, are characteristic of the ...
Other names: A. rhizogenes, ATCC 11325, Agrobacterium biovar 2, Agrobacterium genomic group 10, Agrobacterium genomic species 10, Agrobacterium genomosp. 10, Agrobacterium rhizogenes, Agrobacterium rhizogenes (RI plasmid PRI1724), Agrobacterium rhizogenes (RI plasmid PRI8196), Agrobacterium rhizogenes (RI plasmid PRIA4B), CFBP 5520, CIP 104328, DSM 30148, ICMP 5794, IFO 13257, JCM 20919, LMG 150, NBRC 13257, NCPPB 2991, Rhizobium rhizogenes, Rhizobium sp. LMG 9509 ...
Glucosidase, beta; acid, pseudogene, also known as GBAP, is a human gene. GRCh38: Ensembl release 89: ENSG00000160766 - Ensembl ... May 2017 "Human PubMed Reference:". "Entrez Gene: GBAP glucosidase, beta; acid, pseudogene". Beutler E, West C, Gelbart T (1992 ...
... beta-glucosidase (EC 3.2.1.21); beta-galactosidase (EC 3.2.1.23); 6-phospho-beta-galactosidase (EC 3.2.1.85); 6-phospho-beta- ... glucosidase (EC 3.2.1.86); lactase-phlorizin hydrolase (EC 3.2.1.62), lactase (EC 3.2.1.108); beta-mannosidase (EC 3.2.1.25); ... myrosinase (EC 3.2.1.147). 6-phospho-beta-galactosidase InterPro: IPR005928 GBA3; KL; KLB; LCT; LCTL; GH1 in CAZypedia ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ... Nocardioides humi produces beta-glucosidase. Parte, A.C. "Nocardioides". www.bacterio.net. "Nocardioides humi Taxon Passport - ...
... beta-glucosidase (EC 3.2.1.21); beta-xylosidase (EC 3.2.1.37); N-acetyl beta-glucosaminidase (EC 3.2.1.52); glucan beta-1,3- ... Varghese JN, Fincher GB, Hrmova M (1999). "Three-dimensional structure of a barley beta-D-glucan exohydrolase, a family 3 ... glucosidase (EC 3.2.1.58); cellodextrinase (EC 3.2.1.74); exo-1,3-1,4-glucanase (EC 3.2.1). These enzymes are two-domain ...
nov., a beta-glucosidase-producing bacterium in the family Sphingomonadaceae in the alpha-4 subgroup of the Proteobacteria". ... nov., a beta-glucosidase-producing bacterium in the family Sphingomonadaceae in the alpha-4 subgroup of the Proteobacteria". ... Sphingomonas soli produces beta-glucosidase. LPSN bacterio.net Straininfo of Sphingomonas soli UniProt Deutsche Sammlung von ...
GBA glucosidase, beta; acid (includes glucosylceramidase)". "PDGene". Alzheimer Research Forum. 12 November 2008. Archived from ... acid β-glucosidase (bile acid), also EC 3.2.1.45 GBA3: acid β-glucosidase (cytosolic), EC 3.2.1.21 ENSG00000177628 GRCh38: ... Proteopedia Acid-beta-glucosidase Molecular and Cellular Biology portal. ... β-Glucocerebrosidase (also called acid β-glucosidase, D-glucosyl-N-acylsphingosine glucohydrolase, or GCase) is an enzyme with ...
... produces beta-glucosidase. List of Aspergillus species "Aspergillus saccharolyticus". www.mycobank. ... Sørensen, Annette (1 November 2010). "A new highly efficient beta-glucosidase from the novel species, Aspergillus ... "Screening of carbon sources for beta-glucosidase production by Aspergillus saccharolyticus". International Biodeterioration & ...
nov., a beta-glucosidase-producing bacterium". Int J Syst Evol Microbiol. 59: 2191-4. doi:10.1099/ijs.0.008300-0. PMID 19605728 ... Castellaniella ginsengisoli is a Gram-negative, oxidase- and catalase-positive, rod-shaped, motile, beta-glucosidase-producing ...
Weber JP, Fink AL (October 1980). "Temperature-dependent change in the rate-limiting step of beta-glucosidase catalysis". The ... Glycoside hydrolysis by lysozyme and beta-glucosidase". Biochemistry. 8 (10): 4214-21. doi:10.1021/bi00838a045. PMID 5388150. ... Glycoside hydrolysis by lysozyme and beta-glucosidase". Biochemistry. 8 (10): 4214-21. doi:10.1021/bi00838a045. PMID 5388150. ... Lysozyme is a glycoside hydrolase that catalyzes the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl- ...
6-phospho-beta-glucosidase (EC 3.2.1.86); 6-phospho-alpha-glucosidase (EC 3.2.1.122); alpha-galactosidase (EC 3.2.1.22). 6- ... phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity. GH4 in CAZypedia ... dependent 6-phospho-alpha-glucosidase. Assignment to family 4 of the glycosylhydrolase superfamily". J. Biol. Chem. 273 (42): ...
... CAZY GH_17 comprises enzymes with several known activities; endo-1,3-beta-glucosidase (EC 3.2. ...
Beta glucosidase activity is regulated via circadian rhythms. Fluorescence studies have shown that the binding sites of leaf ... which is inactivated by hydrolysis of the glycosidic bond via beta glucosidase. In Lespedeza cuneata G. Don the leaf opening ...
"Entrez Gene: GBA2 glucosidase, beta (bile acid) 2". Land A, Braakman I (2001). "Folding of the human immunodeficiency virus ... This gene encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous ... Matern H, Heinemann H, Legler G, Matern S (1997). "Purification and characterization of a microsomal bile acid beta-glucosidase ... 2007). "Identification of the non-lysosomal glucosylceramidase as beta-glucosidase 2". J. Biol. Chem. 282 (2): 1305-12. doi: ...
GBA: glucosidase, beta; acid (includes glucosylceramidase) (gene for Gaucher disease). *GBAP1: glucosylceramidase beta ...
Cytosolic beta-glucosidase, also known as cytosolic beta-glucosidase-like protein 1, is a beta-glucosidase (EC 3.2.1.21) enzyme ... Cytosolic beta-glucosidase is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside ... 2010). "The cytosolic beta-glucosidase GBA3 does not influence type 1 Gaucher disease manifestation". Blood Cells Mol. Dis. 46 ... Beutler E, Beutler L, West C (2004). "Mutations in the gene encoding cytosolic beta-glucosidase in Gaucher disease". J. Lab. ...
... phloridzin beta-glucosidase, lactase-phlorizin hydrolase, and phloridzin glucosidase. Leese HJ, Semenza G (1973). "On the ... Malathi P, Crane RK (1969). "Phlorizin hydrolase: a beta-glucosidase of hamster intestinal brush border membrane". Biochim. ... Other names in common use include phlorizin hydrolase, phloretin-glucosidase, glycosyl ceramide glycosylhydrolase, ...
Separation and characterization of cellulases and beta-glucosidases". Biochem J. 177 (1): 9-19. doi:10.1042/bj1770009. PMC ... beta-1,4-glucanase, beta-1,4-endoglucan hydrolase, endoglucanase D, 1,4-(1,3,1,4)-beta-D-glucan 4-glucanohydrolase), ... Cellobiases (EC 3.2.1.21) or beta-glucosidases hydrolyse the exocellulase product into individual monosaccharides. Oxidative ... and a beta-glucosidase (76,000 daltons). Numerous "signature" sequences known as dockerins and cohesins have been identified in ...
These enzymes include amygdalin beta-glucosidase, prunasin beta-glucosidase and mandelonitrile lyase. In contrast, although the ...
... may refer to: Gelatinase biosynthesis-activating pheromone, a bacterial peptide Glucosidase, beta; acid, pseudogene, a ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ...
Li, Dan (May 2013). "Characterization and application of an acidophilic and thermostable beta-glucosidase from Thermofilum ...
"Cuckoo fungus mimics termite eggs by producing the cellulose-digesting enzyme beta-glucosidase". Current Biology. 19 (1): 30-6 ...
Different mutations in the GBA (beta-glucosidase) gene determine the remaining activity of the enzyme. In type I, there is some ... 2000). "Gaucher disease: the origins of the Ashkenazi Jewish N370S and 84GG acid beta-glucosidase mutations". Am. J. Hum. Genet ... Numerous different mutations occur; sequencing of the beta-glucosidase gene is sometimes necessary to confirm the diagnosis. ... also known as beta-glucosidase, EC 3.2.1.45, PDB: 1OGS​) on the first chromosome (1q22). The enzyme is a 55.6-kilodalton, 497- ...
nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". Int. J. Syst. Evol. Microbiol. 56 (Pt 11 ... nov., a beta-glucosidase-producing bacterium isolated from soil of a ginseng field". International Journal of Systematic and ... Burkholderia ginsengisoli has the ability to produce β-glucosidase. "Genus Burkholderia". List of Prokaryotic Names with ...
... , or beta-D-glucosidase (EC 3.2.1.21), is an enzyme found in many plants including cassava and the butter bean. In ... "Purification and properties of beta-D-glucosidase (linamarase) from the butter bean, Phaseolus lunatus". Last accessed 13 ...
These lipids are then hydrolyzed by beta-glucosidases and beta-galactosidases to regenerate ceramide. Similarly, sphingomyelin ...
In competitive inhibition, an inhibitor that resembles the normal substrate binds to the enzyme, usually at the active site, and prevents the substrate from binding.[8] At any given moment, the enzyme may be bound to the inhibitor, the substrate, or neither, but it cannot bind both at the same time. During competitive inhibition, the inhibitor and substrate compete for the active site. The active site is a region on an enzyme which a particular protein or substrate can bind to. The active site will only allow one of the two complexes to bind to the site therefore either allowing for a reaction to occur or yielding it. In competitive inhibition the inhibitor resembles the substrate therefore taking its place and binding to the active site of an enzyme. Increasing the substrate concentration would diminish the "competition" for the substrate to properly bind to the active site and allow a reaction to occur.[3] When the substrate is of higher concentration than that of the competitive inhibitor, it ...
Production of beta-glucosidases is well known in members of the genus Aspergillus, however only few species can produce glucose ... Beta-glucosidases produced by A. unguis are characteristically highly glucose-tolerant. For this reason, the fungus has been ... "Highly glucose tolerant β-glucosidase from Aspergillus unguis: NII 08123 for enhanced hydrolysis of biomass". Journal of ...
... aryl-beta-glucosidase, beta-D-glucosidase, beta-glucoside glucohydrolase, arbutinase, amygdalinase, p-nitrophenyl beta- ... Beta-glucosidase catalyzes the hydrolysis of the glycosidic bonds to terminal non-reducing residues in beta-D-glucosides and ... Vicianin beta-glucosidase. References[edit]. *^ PDB: 3AHX​; Jeng WY, Wang NC, Lin MH, Lin CT, Liaw YC, Chang WJ, Liu CI, Liang ... glucosidase, primeverosidase, amygdalase, linamarase, salicilinase, and beta-1,6-glucosidase. Cellulose is a polymer composed ...
beta-glucosidase [Xanthomonas gardneri] beta-glucosidase [Xanthomonas gardneri]. gi,1120833987,gnl,PRJNA344031,BI317 0,gb, ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
6-phospho-beta-glucosidase [Escherichia coli W]. * This record was replaced or removed. The sequence YP_006173076 is 100% ...
In enzymology, a prunasin beta-glucosidase (EC 3.2.1.118) is an enzyme that catalyzes the chemical reaction (R)-prunasin + H2O ... The systematic name of this enzyme class is prunasin beta-D-glucohydrolase. This enzyme is also called prunasin hydrolase. ...
Hydrolysis of terminal, non-reducing beta-D-glucosyl residues with release of beta-D-glucose. UniProt ...
Polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and ... The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase, or beta-glucosidase ... Polypeptides having beta-glucosidase activity and polynucleotides encoding same. Title: Polypeptides having beta-glucosidase ... The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta- ...
Crystal structure of beta-glucosidase A from Bacillus polymyxa: insights into the catalytic activity in family 1 glycosyl ...
Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide. ... "Substrate (aglycone) specificity of human cytosolic beta-glucosidase.". Berrin J.-G., Czjzek M., Kroon P.A., McLauchlan W.R., ... "Substrate (aglycone) specificity of human cytosolic beta-glucosidase.". Berrin J.-G., Czjzek M., Kroon P.A., McLauchlan W.R., ... "Substrate (aglycone) specificity of human cytosolic beta-glucosidase.". Berrin J.-G., Czjzek M., Kroon P.A., McLauchlan W.R., ...
... methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. Is also able to hydrolyze phospho-N,N-diacetylchitobiose ... Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, ... 6-phospho-beta-glucosidaseAdd BLAST. 449. Proteomic databases. PaxDb, a database of protein abundance averages across all three ... 6-phospho-beta-glucosidase activity Source: EcoCyc ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a direct assay for the ...
Acid beta-Glucosidase Deficiencies. An autosomal recessive disorder caused by a deficiency of Acid beta-Glucosidase ( ...
Similar Discussions: Immobilization of Beta-glucosidase with glutaraldehyde * Vitamin A and Beta Carotene (Replies: 1) ... I want to immobilize beta-glucosidase (on Sepabeads with an amine group). The problem I have is I dont have a strong chemical/ ... Can the Beta carbons of ketones act as nucleophiles? And one more question. (Replies: 3) ... Barium Borate- beta BBO crystals (what am I looking at?) (Replies: 3) ...
View Human Cytosolic beta-Glucosidase/GBA3 Antibody (AF5969) datasheet. Validated in IP, WB ... Cytosolic beta-Glucosidase; Cytosolic beta-glucosidase-like protein 1; EC 3.2.1.21; GBA3; GLUC; glucosidase, beta, acid 3 ( ... There are three beta-glucosidases (GBA) in human genome. GBA1 endodes a lysosomal membrane protein that cleaves the beta- ... GBA2 encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides. GBA3 is a cytosolic beta- ...
An efficient beta-glucosidase facilitates hydrolysis at specified process conditions, and key points to consider in this ... In this review, we discuss the important role beta-glucosidases play in complex biomass hydrolysis and how they create a ... Among the cellulose degrading enzymes, beta-glucosidases are essential for efficient hydrolysis of cellulosic biomass as they ... alternatives to the currently available enzyme preparations either by improving known or screening for new beta-glucosidases. ...
furostanol glycoside 26-O-beta-glucosidase: from Costus speciosus rhizomes; specifically cleaves the C-26-bound glucose moiety ... Glucosidases: 578*Cellulases: 33*beta-Glucosidase: 195*furostanol glycoside 26-O-beta-glucosidase ... furostanol glycoside 26-O-beta-glucosidase. Subscribe to New Research on furostanol glycoside 26-O-beta-glucosidase ...
Competitive Inhibition constant on almonds beta Glucosidase; LI=Limited inhibition. ...
A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was purified to homogeneity after cultivation on a cellulose and ... A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was purified to homogeneity after cultivation on a cellulose and ... Characterization and kinetic analysis of a thermostable GH3 beta-glucosidase from Penicillium brasilianum. Krogh, Kristian B. R ... article{bf417611-2d38-438f-96a9-4ab1a291f9a9, abstract = {A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was ...
The CPT codes provided are based on AMA guidelines and are for informational purposes only. CPT coding is the sole responsibility of the billing party. Please direct any questions regarding coding to the payer being billed ...
Compared with free beta-glucosidase, the immobilized enzyme exhibited: (i) a similar pH optimum but more activity at lower pH ... beta-Glucosidase of Aspergillus phoenicis QM 329 was immobilized on chitosan, using the bifunctional agent glutaraldehyde. The ... Compared with free beta-glucosidase, the immobilized enzyme exhibited: (i) a similar pH optimum but more activity at lower pH ... beta-Glucosidase of Aspergillus phoenicis QM 329 was immobilized on chitosan, using the bifunctional agent glutaraldehyde. The ...
beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1. Rodjana OPASSIRI, Yanling HUA, ... beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1 ... beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1 ... beta-Glucosidase, exo-beta-glucanase and pyridoxine transglucosylase activities of rice BGlu1 ...
The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.
For specimen collection and processing instructions, refer to the Genetics Laboratory Test Directory for Beta-Glucosidase at: ...
The E358S mutant of Agrobacterium sp beta-glucosidase is a greatly improved glycosynthase. ... The E358S mutant of Agrobacterium sp beta-glucosidase is a greatly improved glycosynthase. ... The E358S mutant of Agrobacterium sp beta-glucosidase is a greatly improved glycosynthase ... beta-glucosidase (Abg) by mutating the nucleophile glutamate to alanine (E358A), synthesizes oligosaccharides in yields ...
Effect of differently post-treated dewatered sewage sludge on beta-glucosidase activity, microbial biomass carbon, basal ... Effect of differently post-treated dewatered sewage sludge on beta-glucosidase activity, microbial biomass carbon, basal ... "Effect of differently post-treated dewatered sewage sludge on beta-glucosidase activity, microbial biomass carbon, basal ...
Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) - Pipeline Review, H1 2016 ... Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) - Drug ... Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) - ... Glucosylceramidase (Acid Beta-Glucosidase or Alglucerase or D-Glucosyl-N-Acylsphingosine Glucohydrolase or EC 3.2.1.45) - ...
  • redefine GBA2 activity as the beta-glucosidase that is sensitive to inhibition by N-butyldeoxygalactonojirimycin. (antikoerper-online.de)
  • We analyzed the activities of CBE-sensitive β-glucosidase (GBA1) and AMP-DNM-sensitive β-glucosidase (GBA2) in total cell lysates and PM of human fibroblast cell lines from control (normal) subjects and from patients with GD clinical types 1, 2, and 3. (biomedsearch.com)
  • The beta-glucosidase GBA2 degrades glucosylceramide (GlcCer) outside the lysosomes. (asbmb.org)
  • As reported in a study published in Press in The Journal of Biological Chemistry , group from the Center of Advanced European Studies and Research (caesar) in Bonn, Germany, has shown now that the activity of a second β-glucosidase, GBA2, is also affected in Gaucher disease patients and might, thereby, regulate Gaucher disease progression. (asbmb.org)
  • Hydrolyzes a wide variety of P-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, gentiobiose-6P, methyl-beta-glucoside-6P and p-nitrophenyl-beta-D-glucopyranoside-6P. (uniprot.org)
  • The BGL had significant lower affinity for cellobiose compared with the artificial substrate para-nitrophenyl-beta-d-glucopyranoside (pNP-Glc) and further, pronounced substrate inhibition using pNP-Glc. (lu.se)
  • article{bf417611-2d38-438f-96a9-4ab1a291f9a9, abstract = {A GH3 beta-glucosidase (BGL) from Penicillium brasilianum was purified to homogeneity after cultivation on a cellulose and xylan rich medium. (lu.se)
  • Cellulases ( endoglucanases ), cellobiosidases ( exoglucanases ), and beta-glucosidases are required by organisms (some fungi , bacteria ) that can consume it. (wikipedia.org)
  • The objective of this study was thus to investigate production profiles of endoglucanase, β-glucosidase, xylanase, and reducing sugars grown on mineral minimum nutrient media containing different agricultural residues. (ajas.info)
  • Biology lecturer of Faculty of Science and Technology, Universitas Airlangga (FST UNAIR) used beta-glucosidase enzyme producing microorganisms in Indonesia for ginseng active compound biotransformation. (unair.ac.id)
  • The research first stage is screening, where isolated microorganisms are observed whether they are able to produce the enzyme beta-glucosidase. (unair.ac.id)
  • From this research, Gerry hoped to find a strong isolate of beta-glucosidase producing microorganisms from Indonesia to be used in the conversion of active ginseng compounds. (unair.ac.id)
  • Some glycosides, which are detected in water extracts from medicinal plants, have been reported to be degraded into their aglycones by incubating with some microorganisms producing β-glucosidase. (frontiersin.org)
  • In this study, it is shown that substituting the beta-glucosidase from H. jecorina (HjCel3A) with the beta-glucosidase Cel3A from the thermophilic fungus Rasamsonia emersonii (ReCel3A) in enzyme mixtures results in increased efficiency in the saccharification of lignocellulosic materials. (diva-portal.org)
  • The production of beta-glucosidase by the ligninolytic fungus Pleurotus ostreatus has been studied in different culture media containing agro-industrial wastes. (semanticscholar.org)
  • The chemical composition of U.S.-patented Laetrile (mandelonitrile-beta-glucuronide), a semisynthetic derivative of amygdalin, is different from the laetrile/amygdalin produced in Mexico (mandelonitrile beta-D-gentiobioside), which is made from crushed apricot pits. (cancer.gov)