Balaenoptera: A genus of WHALES in the family Balaenopteridae, consisting of five species: Blue Whale, Bryde's Whale, FIN WHALE, Sei Whale, and MINKE WHALE. They are distinguished by a relatively slender body, a compressed tail stock, and a pointed snout.Minke Whale: The species Balaenoptera acutorostrata, in the family Balaenopteridae. It is the smallest of the WHALES in the family and though mainly oceanic, is often found in coastal waters including bays and estuaries.Whales: Large marine mammals of the order CETACEA. In the past, they were commercially valued for whale oil, for their flesh as human food and in ANIMAL FEED and FERTILIZERS, and for baleen. Today, there is a moratorium on most commercial whaling, as all species are either listed as endangered or threatened.Fin Whale: The species Balaenoptera physalus, in the family Balaenopteridae, characterized by a large, strongly curved, dorsal fin. It is the second largest of the WHALES, highly migratory, but rarely seen near the shore.Cetacea: An order of wholly aquatic MAMMALS occurring in all the OCEANS and adjoining seas of the world, as well as in certain river systems. They feed generally on FISHES, cephalopods, and crustaceans. Most are gregarious and most have a relatively long period of parental care and maturation. Included are DOLPHINS; PORPOISES; and WHALES. (From Walker's Mammals of the World, 5th ed, pp969-70)San FranciscoBays: An area of water mostly surrounded by land, usually smaller than a gulf, and affording access to the sea.Copyright: It is a form of protection provided by law. In the United States this protection is granted to authors of original works of authorship, including literary, dramatic, musical, artistic, and certain other intellectual works. This protection is available to both published and unpublished works. (from Circular of the United States Copyright Office, 6/30/2008)Computer Security: Protective measures against unauthorized access to or interference with computer operating systems, telecommunications, or data structures, especially the modification, deletion, destruction, or release of data in computers. It includes methods of forestalling interference by computer viruses or so-called computer hackers aiming to compromise stored data.Incubators: Insulated enclosures in which temperature, humidity, and other environmental conditions can be regulated at levels optimal for growth, hatching, reproduction, or metabolic reactions.Humpback Whale: The species Megaptera novaeangliae, in the family Balaenopteridae, characterized by its huge flippers and the arching of their back when diving. They are also known for their breaching and singing.Azores: A group of nine islands and several islets belonging to Portugal in the north Atlantic Ocean off the coast of Portugal. The islands are named after the acores, the Portuguese for goshawks, living there in abundance. (Webster's New Geographical Dictionary, 1988, p102 & Room, Brewer's Dictionary of Names, 1992, p42)Animal Fins: Membranous appendage of fish and other aquatic organisms used for locomotion or balance.IcelandEuphausiacea: An order of pelagic, shrimplike CRUSTACEA. Many consume ZOOPLANKTON and a few are predacious. Many antarctic species, such as Euphausia superba, constitute the chief food of other animals.Antarctic Regions: The continent lying around the South Pole and the southern waters of the Atlantic, Pacific, and Indian Oceans. It includes the Falkland Islands Dependencies. (From Webster's New Geographical Dictionary, 1988, p55)Proteoglycans: Glycoproteins which have a very high polysaccharide content.Chondroitin Sulfate Proteoglycans: Proteoglycans consisting of proteins linked to one or more CHONDROITIN SULFATE-containing oligosaccharide chains.Keratan Sulfate: A sulfated mucopolysaccharide initially isolated from bovine cornea. At least two types are known. Type I, found mostly in the cornea, contains D-galactose and D-glucosamine-6-O-sulfate as the repeating unit; type II, found in skeletal tissues, contains D-galactose and D-galactosamine-6-O-sulfate as the repeating unit.Aviation: Design, development, manufacture, and operation of heavier-than-air AIRCRAFT.Oceanography: The science that deals with the ocean and its phenomena. (Webster, 3d ed)Biodiversity: The variety of all native living organisms and their various forms and interrelationships.Ecosystem: A functional system which includes the organisms of a natural community together with their environment. (McGraw Hill Dictionary of Scientific and Technical Terms, 4th ed)Magnetometry: The measurement of various aspects of MAGNETIC FIELDS.Indian Ocean: A body of water covering approximately one-fifth of the total ocean area of the earth, extending amidst Africa in the west, Australia in the east, Asia in the north, and Antarctica in the south. Including the Red Sea and the Persian Gulf, it constitutes the third largest ocean after the ATLANTIC OCEAN and the PACIFIC OCEAN. (New Encyclopaedia Britannica Micropaedia, 15th ed, 1990, p289)GreeceDolphins: Mammals of the families Delphinidae (ocean dolphins), Iniidae, Lipotidae, Pontoporiidae, and Platanistidae (all river dolphins). Among the most well-known species are the BOTTLE-NOSED DOLPHIN and the KILLER WHALE (a dolphin). The common name dolphin is applied to small cetaceans having a beaklike snout and a slender, streamlined body, whereas PORPOISES are small cetaceans with a blunt snout and rather stocky body. (From Walker's Mammals of the World, 5th ed, pp978-9)Encyclopedias as Topic: Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)Porpoises: Mammals of the family Phocoenidae comprising four genera found in the North Pacific Ocean and both sides of the North Atlantic Ocean and in various other seas. They differ from DOLPHINS in that porpoises have a blunt snout and a rather stocky body while dolphins have a beak-like snout and a slender, streamlined body. They usually travel in small groups. (From Walker's Mammals of the World, 5th ed, pp1003-4)Bottle-Nosed Dolphin: The species Tursiops truncatus, in the family Delphinidae, characterized by a bottle-shaped beak and slightly hooked broad dorsal fin.Sea Lions: A group comprised of several species of aquatic carnivores in different genera, in the family Otariidae. In comparison to FUR SEALS, they have shorter, less dense hair.Seals, Earless: The family Phocidae, suborder PINNIPEDIA, order CARNIVORA, comprising the true seals. They lack external ears and are unable to use their hind flippers to walk. It includes over 18 species including the harp seal, probably the best known seal species in the world.Pinnipedia: The suborder of aquatic CARNIVORA comprising the WALRUSES; FUR SEALS; SEA LIONS; and EARLESS SEALS. They have fusiform bodies with very short tails and are found on all sea coasts. The offspring are born on land.Phoca: A genus in the family of EARLESS SEALS (Phocidae) and collectively the most abundant PINNIPEDS in the Northern Hemisphere.Fur Seals: A group comprised of several species of eared seals found in two genera, in the family Otariidae. In comparison to SEA LIONS, they have an especially dense wooly undercoat.GreenlandLions: Large, chiefly nocturnal mammals of the cat family FELIDAE, species Panthera leo. They are found in Africa and southern Asia.Genome, Mitochondrial: The genetic complement of MITOCHONDRIA as represented in their DNA.TurtlesReptiles: Cold-blooded, air-breathing VERTEBRATES belonging to the class Reptilia, usually covered with external scales or bony plates.DNA, Mitochondrial: Double-stranded DNA of MITOCHONDRIA. In eukaryotes, the mitochondrial GENOME is circular and codes for ribosomal RNAs, transfer RNAs, and about 10 proteins.Nucleic Acid Conformation: The spatial arrangement of the atoms of a nucleic acid or polynucleotide that results in its characteristic 3-dimensional shape.Genes, Mitochondrial: Genes that are located on the MITOCHONDRIAL DNA. Mitochondrial inheritance is often referred to as maternal inheritance but should be differentiated from maternal inheritance that is transmitted chromosomally.Phylogeny: The relationships of groups of organisms as reflected by their genetic makeup.Galaxies: Large aggregates of CELESTIAL STARS; COSMIC DUST; and gas. (From McGraw Hill Dictionary of Scientific and Technical Terms, 6th ed)Astronomy: The science concerned with celestial bodies and the observation and interpretation of the radiation received in the vicinity of the earth from the component parts of the universe (McGraw Hill Dictionary of Scientific and Technical Terms, 5th ed)Astronomical Phenomena: Aggregates of matter in outer space, such as stars, planets, comets, etc. and the properties and processes they undergo.Magnetic Resonance Imaging: Non-invasive method of demonstrating internal anatomy based on the principle that atomic nuclei in a strong magnetic field absorb pulses of radiofrequency energy and emit them as radiowaves which can be reconstructed into computerized images. The concept includes proton spin tomographic techniques.Skull: The SKELETON of the HEAD including the FACIAL BONES and the bones enclosing the BRAIN.Ficus: A plant genus of the family MORACEAE. It is the source of the familiar fig fruit and the latex from this tree contains FICAIN.Mammals: Warm-blooded vertebrate animals belonging to the class Mammalia, including all that possess hair and suckle their young.

Discovery of a low frequency sound source in Mysticeti (baleen whales): anatomical establishment of a vocal fold homolog. (1/16)

The mechanism of mysticete (baleen whale) vocalization has remained a mystery. Vocal folds (true vocal "cords"), the structures responsible for sound production in terrestrial mammals, were thought to be absent in whales. This study tests the hypothesis that the mysticete larynx possesses structures homologous to vocal folds and that they are capable of sound generation. Laryngeal anatomy was examined in 37 specimens representing 6 mysticete species. Results indicate the presence of a U-shaped fold (U-fold) in the lumen of the larynx. The U-fold is supported by arytenoid cartilages, controlled by skeletal muscles innervated by the recurrent laryngeal nerve, is adjacent to a diverticulum (laryngeal sac) covered with mucosa innervated by the superior laryngeal nerve, and contains a ligament-conditions that also define the vocal folds of terrestrial mammals and, therefore, supports homology. Unlike the vocal folds of terrestrial mammals, which are perpendicular to airflow, the mysticete U-fold is oriented parallel to airflow. U-fold adduction/abduction and elevation/depression may control airflow, and vibration of its edges may generate sounds. The walls of the laryngeal sac can expand and contract, may serve as a resonant space, and may also propagate vibrations generated by movements of the supporting arytenoid cartilages. The extensive musculature surrounding the laryngeal sac may enable rapid and forceful expulsion of air from the lumen of the sac into other respiratory spaces, or maintain a constant sac volume despite the effects of ambient pressure (e.g., changes during diving or ascent). The size and complexity of the mysticete larynx indicates an organ with multiple functions, including protection during breathing/swallowing, regulation of airflow and pressures in the respiratory spaces, and sound generation. The presence of a vocal fold homolog offers a new insight into both the mechanism of sound generation by mysticetes and the divergent evolution of odontocete and mysticete cetaceans.  (+info)

Effects of semen extenders and storage temperatures on characteristics of frozen-thawed Bryde's (Balaenoptera edeni) whale spermatozoa. (2/16)

The present study investigated effects of three semen extenders and storage temperatures on post-thaw characteristics of Bryde's whale spermatozoa. Spermatozoa were collected from the vasa deferens of three mature Bryde's whales captured during the Japanese whale research in the north-west Pacific (May to August 2007) after death. The three semen extenders used for freezing were 1) a commercialized synthetic extender (AndroMed: AM), 2) Tris-based + 10% bovine serum albumin (BSA) and 3) Tris-based + egg yolk (EY). The sperm samples from the three whales were frozen with the three extenders, and the post-thaw spermatozoa were stored at three different temperatures (35 C; 20-25 C, room temperature; and 5 C) for 0, 6, 12, 24, 48 and 96 h. At each time-point, total and progressive motility (PM), viability (live or dead), the hypo-osmotic test, defective acrosomes and malformation were examined. Immediately after thawing, AM resulted in similar recovery rates (60.4 and 83.3%) in 2 of the 3 whales examined and had comparable post-thaw recovery rates to those obtained using the EY and BSA extenders. Immediately after thawing, the proportion of PM in EY (17.6%) was higher (P<0.05) than that in BSA (15.0%). In the hypo-osmotic test, the proportions of AM (26.0%) and BSA (25.2%) were higher (P<0.05) than that of EY (17.3 %). The three extenders had similar viabilities (36.7, 37.9 and 32.1%, respectively), but the viability of BSA was higher (P<0.05) than that of EY. The present study showed that a synthetic semen extender, AndroMed, could be used for cryopreservation of whale spermatozoa in addition to Tris-based extenders containing bovine serum albumin or egg yolk. Storage of the post-thaw Bryde's whale spermatozoa was better at 5 C than at room temperature or 35 C. The frozen-thawed Bryde's whale spermatozoa maintained their motility and viability for at least two days at room temperature and for four days at 5 C.  (+info)

Exposure to seismic survey alters blue whale acoustic communication. (3/16)

 (+info)

Production of Sei whale (Balaenoptera borealis) cloned embryos by inter- and intra-species somatic cell nuclear transfer. (4/16)

The objectives of this study were to choose an effective embryo reconstruction method and an effective post-activation agent for in vitro production of sei whale (Balaenoptera borealis) interspecies somatic cell nuclear transfer (iSCNT) embryos. Moreover, trichostatin A (TSA) treatment of whale iSCNT embryos was performed to improve the in vitro embryo development. In Experiment 1, the fusion rate was significantly higher (88.1%) in embryos reconstructed using the intracytoplasmic cell injection method (ICI) than that (48.7%) in the subzonal cell insertion (SUZI) counterpart. The rates of pseudopronucleus (PPN) formation (77.4 vs. 77.2%) and cleavage (24.5 vs. 37.0%) did not vary between ICI and SUZI. However, the PPN formation and cleavage rates were significantly (P<0.05) lower in the iSCNT embryos than in the parthenogenetic control (95.7% and 64.4%, respectively). Although 21.5% of the bovine parthenogenetic embryos developed to the blastocyst stage, no iSCNT embryo developed beyond the 6-cell stage. In Experiment 2, the cleavage rate did not vary between the TSA (50 nM)-treated and non-treated whale iSCNT embryos (30.5 vs. 32.3%, respectively). Moreover, it did not vary between the TSA-treated iSCNT and SCNT embryos (30.5 vs. 32.0%, respectively). Only one TSA non-treated iSCNT embryo developed to a compacted morula with 20 nuclei. One TSA-treated whale SCNT embryo developed to the 8-cell stage, and out of five whale iSCNT embryos, a 6-cell stage embryo was positive for whale DNA. In conclusion, bovine oocytes have the ability to support development of sei whale nuclei up to the 6-cell stage.  (+info)

Mechanics, hydrodynamics and energetics of blue whale lunge feeding: efficiency dependence on krill density. (5/16)

 (+info)

Recovering population parameters from a single gene genealogy: an unbiased estimator of the growth rate. (6/16)

 (+info)

Convergent evolution driven by similar feeding mechanics in balaenopterid whales and pelicans. (7/16)

 (+info)

Blue whales respond to anthropogenic noise. (8/16)

 (+info)

This action plan addresses the entire set of populations of Blue, Fin, Sei and North Pacific Right Whales (Balaenoptera musculus, B. physalus, B. borealis, and Eubalaena japonica) in Canadian Pacific waters. It identifies recovery measures to implement the broad goals and objectives outlined in the Recovery Strategy for Blue, Fin and Sei Whales in Pacific Canadian Waters (Gregr et al. 2006), and the Recovery Strategy for North Pacific Right Whales (DFO 2011). All four species are being considered together because of their similar geographic distribution, common threats to survival, and the efficiency of integrating activities and resources required for recovery.
A speculative life rendering of the fossil whale [I]Balaenoptera bertae[/I] unearthed in the San Francisco Bay Area. The whale belongs within the same genus as minke and fin whales, indicating that the [I]Balaenoptera[/I] lineage has lasted for 3-4 million years. [I]Balaenoptera bertae[/I] would have been approximately 5-6 meters in length, slightly smaller than modern minke whales. It was named by University of Otago Ph.D. student Robert Boessenecker in honor of San Diego State Universitys Professor Annalisa Berta.
BRANCH TA, Stafford KM, Palacios DM, ALLISON C, BANNISTER JL, BURTON CLK, CABRERA E, CARLSON CA, B. VERNAZZANI GALLETTI, GILL PC, et al. Past and present distribution, densities and movements of blue whales Balaenoptera musculus in the Southern Hemisphere and northern Indian Ocean. Mammal Review. 2007 ;37(2):116 - 175. ...
BRANCH TA, Stafford KM, Palacios DM, ALLISON C, BANNISTER JL, BURTON CLK, CABRERA E, CARLSON CA, B. VERNAZZANI GALLETTI, GILL PC, et al. Past and present distribution, densities and movements of blue whales Balaenoptera musculus in the Southern Hemisphere and northern Indian Ocean. Mammal Review. 2007 ;37(2):116 - 175. ...
Text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. By using this site, you agree to the Terms of Use and Privacy Policy. ...
ABSTRACT: Understanding the factors influencing habitat selection is critical to improving management and conservation plans for large whales. Many studies have linked the distribution of cetaceans to basic environmental features such as underwater topography and sea surface temperature (SST), but the mechanisms underlying these relationships are poorly understood. Dynamic mesoscale processes like thermal fronts are prime candidates to link physiographic factors to whale distribution because they increase biological productivity and aggregate prey. However, previous studies of large whales have found little evidence of such associations, possibly because they were not at the appropriate spatio-temporal scales. We quantified the relationship between SST fronts and the distribution of blue Balaenoptera musculus, finback B. physalus, humpback Megaptera novaeangliae and minke B. acutorostrata whales in the northern Gulf of St. Lawrence. We compared the distribution of 1094 whale sightings collected ...
Fan alle oare libbene groepen bisten binne de sûchdieren it naust besibbe oan e fûgels en de reptilen, wêrfant se har ûnderskiede troch it hawwen fan hier, trije bonkjes yn it middenear, molkklieren en in neokorteks (in diel fan e harsens). Dêropta ûnderskiede se har fan e reptilen trochdat se waarmbloedich binne, wêrbyt de harsens op autonome wize de lichemstemperatuer regelje. De bloedsirkulaasje wurdt fersoarge troch in fjouwerkeamerige hertspier. Hast alle moderne sûchdieren binne libbenbernjend, wat sizze wol dat se har jongen libben te wrâld bringe, en net ynkapsele yn in aai.. Ta de sûchdieren hearre de grutste hjoeddeiske bisten, wêrûnder de blauwe finfisk (Balaenoptera musculus), it grutste wetterdier, en de savanne-oaljefant (Loxodonta africana), it grutste lândier. De blauwe finfisk kin in lingte fan 33 m berikke, wylst it lytste sûchdier, de holderflearmûs (Craseonycteris thonglongyai) mar 30-40 mm grut is. Boppedat omfiemet dizze groep ek de yntelligintste ...
Blue whales dont live in a world of excess and the decisions these animals make are critical to their survival," said Ari Friedlaender, a principal investigator with the Marine Mammal Institute at Oregon State Universitys Hatfield Marine Science Center and co-author on the study. "If you stick your hand into a full bag of pretzels, youre likely to grab more than if you put your hand into a bag that only had a few pretzels.". The feeding pattern that focuses more effort on the densest krill patches provides a new example of blue whale foraging specializations that support the animals tremendous size.. This kind of lunge-feeding takes a lot more effort, but "the increase in the amount of energy they get from increased krill consumption more than makes up for it," noted Jeremy Goldbogen, a marine biologist from Stanford University and co-author on the study.. "Lunge-feeding is a unique form of ram-feeding that involves acceleration to high speed and the engulfment of large volumes of ...
I dont know the caloric content of a blue whale. Some googling shows that cows weigh about a thousand pounds, and one cow can make about a thousand quarter-pound burgers. With each burger coming in at roughly 300 calories, this give a typical cow about 300,000 calories. Admittedly, this ignores non-burger stuff that we eat, but since I also dont know how meaty a blue whale is, lets just run with these numbers and see what happens ...
April Flowers for redOrbit.com - Your Universe Online. Researchers attempting to define populations of a medium-sized and poorly understood baleen whale say that saving the whales often means knowing - sometimes on a genetic level - one group of whales from another. A group of scientists from Wildlife Conservation Society, the American Museum of Natural History, Columbia University, NOAA, and other groups are working to define separate groups and subspecies of the Brydes whale, which are sometimes targeted by Japans scientific whaling program, found in the Indian and western Pacific Oceans.. The team was able to discriminate among different Brydes whales (pronounced BREW-dus) by generating genetic information that was akin to a bar code. The research team was able to confirm the existence of two subspecies: one is larger in size and lives in offshore waters, the other is smaller and frequents more coastal marine habitats. The results of this study are published in the Journal of ...
(Phys.org)-A team of researchers working in Australia has found via DNA analysis, that the lack of genetic diversity in pygmy blue whales is due to natural causes, not because of whaling. In their paper published in the journal Biology Letters, the researchers, affiliated with a variety of institutions in Australia, describe their study of the whales and why what they learned may help save them.
Blue whales are the largest animals to have ever existed. Learn why theyre larger than any land animal and why they were hunted for years, making them endangered.
Shop Blue Whales Baby Shower Invitation Address Labels created by printabledigidesigns. Personalise it with photos & text or purchase as is!
The 50-day online challenge requires the participant to complete different tasks, one each day. The tasks are given by an anonymous handler and the participant needs to complete the task and send photos or videos as proof.. The tasks assigned are extremely dangerous and includes self mutilation, watching horror content alone, standing at the edge of a bridge or balcony etc. The final task is always suicide and the handler gives instruction to the teen on how to end ones life.. Last month, a student of Class 9 in Mumbais Andheri committed suicide, apparently because of the Blue Whale challenge. He posted what he called his "last picture" on Instagram before jumping off a building in the Andheri suburb. A 13 year old boy from Indore also tried to take his life by jumping from the third floor of his school building but fortunately was saved after intervention from his friends and teachers.. The game is believed to be created by Philipp Budeikin, a 22-year-old Russian psychology student who ...
Blue whales are the largest animals to have ever existed. Learn why theyre larger than any land animal and why they were hunted for years, making them endangered.
The Wednesday Hot Links are in with Yersel Cumdog, Jason Chaffetz, Jeff Sessions, Andrew Christian, blue whales feeding, Lady Gagas The Cure and more.
Lunge feeding by rorqual whales (Balaenopteridae) is associated with a high energetic cost that decreases diving capacity, thereby limiting access to dense prey patches at depth. Despite this cost, rorquals exhibit high rates of lipid deposition and extremely large maximum body size. To address this …
Undersea noise from naval exercises appears to give beaked whales the bends. Scientists for years have suspected a link between sonar activities and mass strandings of marine mammals. Autopsies performed on a group of beaked whales that stranded themselves on beaches in the Canary Islands four hours after military sonar activities commenced there support this connection.|br|
VSS210 volume sound source is a special mid-high frequency volume sound source developed by BSWA TECH. It can be used in in noise transfer function (P/F) and acoustics transfer function (P/Q) reciprocity test, TPA analysis, acoustic excitation test such a
&nbsp; <p class="MsoNormal"><span style="mso-ansi-language: EN-GB;" lang="EN-GB">The AmpliMove medical operates with rectangular impulses between 1000 and 10000 Hz.</span> <p class="MsoNormal"><span...
Whales have evolved efficient solutions that biomimicry can borrow for bio-inspiration. Filters inspired by baleen, fans, and wind turbines inspired by their flippers are just some of these.
Why would you factor it out? Whale oil is rendered down from the blubber, which in all the above calculations is being eaten, not discarded ...
Old Salt Blog - a virtual port of call for all those who love the sea - A home for lovers of the sea, tellers of tales, for sailors and dreamers
A world of memories is yours with RCI. As the worlds largest and most experienced vacation exchange company, RCI enhances the value of your vacation ownership with access to more than 3,700 premier resorts worldwide. Explore them here along with all the other great benefits of RCI membership - and start creating a lifetime of memories.
Biology, ecology, habitat, and status of rare, threatened and endangered species of mammals and information on their native countries: biodiversity, ecosystems, population, and land use
And while Noriegas speedy runs and Blacks hard-hitting counterpunches had the group flirting with the punkish drive of John Zorns Naked City every now and again, Endangered Blood isnt nearly as scary as its name. With Black punctuating the beat with a crinkled cymbal that looked like it was found in a parking lot, Elvin Lisbon had an agreeably sweet melodic drive centered on Speed and Noriegas cyclical interplay. Set-opener Plunge found the two horn players gliding atop a heavy-footed funk groove from Dunn and Black, who kept the ground shifting around them with a grab bag of time-warping acrobatics.. With much of the second set carrying a driving sort of swing, the group nodded toward its roots with a clattering take on Epistrophy balanced between Speeds woozy lead and a breathy bass clarinet from Noriega. As the two horn players clustered around a restless bass line from Dunn and an increasingly unhinged backing pulse from Black, the crowd let out occasional whoops and yelps as ...
Cohen Brothers Realty will announce a deal to buy and renovate the Blue Whale, West Hollywoods Pacific Design Center, which is floundering under mortgage payments.
A standard on stages throughout the world for years, the Shure SM58 Dynamic Vocal Microphone offers a carefully tailored frequency rise at about 4,000 Hz for smooth as silk vocals that stand out in the mix. Long associated with its unmistakable sound and unsurpassed reliability, the Shure SM58 Dynamic Vocal Microphone is widely considered the most popular mic in the world. Designed for professional vocal use in sound reinforcement and studio recording, the Shure SM58 Dynamic Vocal Microphone utilizes a highly effective, built-in, spherical filter that minimizes wind and breath pop noise while the cardioid pickup pattern isolates the main sound source and minimizes unwanted background noise. The tailored vocal response on the SM58 is a legendary tone that has become a world standard. Shure SM58 Dynamic Vocal Microphone Features Smooth, mid-frequency presence rise for world-famous SM58 Mic sound Uniform cardioid pickup pattern isolates the main sound source Minimizes background noise Pneumatic ...
Abstract Current trends for IC-engines are driving the development of more efficient engines with higher specific power. This is true for both light and heavy duty vehicles and has led to an increased use of super-charging. The super-charging can be both in the form of a single or multi-stage turbo-charger driven by exhaust gases, or via a directly driven compressor. In both cases a possible noise problem can be a strong Blade Passing Frequency (BPF) typically in the kHz range and above the plane wave range. In this paper a novel type of compact dissipative silencer developed especially to handle this type of problem is described and optimized. The silencer is based on a combination of a micro-perforated (MPP) tube backed by a locally reacting cavity. The combined impedance of micro-perforate and cavity is chosen to match the theoretical optimum known as the Cremer impedance at the mid-frequency in the frequency range of interest ...
Power spectra of epicardial electrograms were studied in 13 anesthetized dogs subjected to occlusion of the left anterior descending coronary artery. Electrograms were obtained from a bipolar electrode placed on the epicardial surface of the left ventricle and recorded before and after coronary occlusion. After digitization, power spectra of the first and every 50th subsequent waveform were evaluated and compared with the power spectrum of the average waveform obtained from the baseline recording. In particular, we examined variations in relative power content in three frequency ranges: 150-250 Hz, previously shown to be directly affected by myocardial ischemia; 40-150 Hz, presumably corresponding to the fine notches and slurs on the body surface QRS; and 2-40 Hz, the low-frequency range. Apart from a mild initial rise during the first 50 heart beats, the power in the high-frequency range gradually decreased, reaching 5% of the control value at wave 500. The power in the mid-frequency range ...
Introduction. My name is Cecily Oakley and I am here at the Australian Academy of Science to talk to Dr Bryan Fry about his life in science. Welcome, Bryan, and congratulations on your Fenner medal.. Toxic first memory. Lets start at the beginning. Where and when were you born?. I was born in the United States in 1970, just after my parents moved there from Norway.. When did you first get interested in venomous animals?. Toxins have been the abiding theme of my entire life. My first memory is of being torn apart by toxins. That memory is of being strapped to the bed at just under two years of age with spinal meningitis. I had full head and leg restraints and surgery to put tubes into my skull and legs. Thats my first memory - of being torn apart. I have a lingering reminder of that event in my right ear. That ear is useful for hanging sunglasses off and not much more than that. All the neurones have been wiped from that ear, except for one random mid-frequency peak where I have perfect hearing ...
This site was designed and produced solely by Pelican Parts. Pelican Parts is not associated with Porsche Cars North America in any manner, except for a mutual appreciation and love of the cars. All pictures and references to the Porsche name, and the car names and shapes are for restoration reference only, and do not imply any association with Porsche. Pelican Parts is not responsible for any typographical errors contained within the site. Information and technical articles within this website are for reference only. Consult authorized factory manuals when performing repair procedures. By entering this site, you agree to hold Pelican Parts free from any liability arising out of the use of any information contained within ...
This site was designed and produced solely by Pelican Parts. Pelican Parts is not associated with Porsche Cars North America in any manner, except for a mutual appreciation and love of the cars. All pictures and references to the Porsche name, and the car names and shapes are for restoration reference only, and do not imply any association with Porsche. Pelican Parts is not responsible for any typographical errors contained within the site. Information and technical articles within this website are for reference only. Consult authorized factory manuals when performing repair procedures. By entering this site, you agree to hold Pelican Parts free from any liability arising out of the use of any information contained within ...
My personal interest aside, educating and learning about the oceans vastness is crucial in our ability to protect it. For example, when the disastrous BP oil spill occurred in 2010, we were only able to understand and counteract the damage caused to the ocean because of our knowledge of it. You cannot cure a disease until you study its symptoms, and the same ideology holds when it comes to protecting all of the oceans creatures, from Blue Whales to Gonostomatidae. This protection of our oceans is why studying it is so important, not to mention the possibilities of using the incredible abilities of these amazing animals to further our worlds technology. Like space exploration this oceanic exploration is essential, our resources are running out and we need to put time and thought into resources that arent going anywhere. The ocean is a perfect example of a "reliable" resource, harnessing the immense power of the tides and water in general has been one of the more promising forms of alternative ...
...Any multicellular animal from a blue whale to a human being poses a ...Most of the cells in its body will die without reproducing; only a pri...How could the extreme degree of cooperation required by multicellular ...Joan Strassmann and David Queller evolutionary biologists at Washingt...,Close,family,ties,keep,microbial,cheaters,in,check,,study,finds,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
Researchers are deeply impressed by the depth and breadth of the viral universe, or virome. Viruses have managed to infiltrate the cells of every life form known to science. They infect animals, plants, bacteria, slime mold, even larger viruses. They replicate in their host cells so prodigiously and stream out into their surroundings so continuously that if you collected all the viral flotsam afloat in the worlds oceans, the combined tonnage would outweigh that of all the blue whales. ...
During the rainy season when there is a sudden change in temperature various viruses and bacterias are produced and they cause Diarrhea says Dr. Rahul. He further says that infants and kids are most affected by this. To know more watch the video. మీ పిల్లల్లో విపరీత ధోరణిని మీరు గుర్తించగలరా..? - https://youtu.be/obM4NaW2N7I What Parents Need to Know About Blue Whale Challenge? - https://youtu.be/myQfGiYHC4o What Is Real Love ? - https://youtu.be/d3VXu7VlFM4 What We Should Know About Child Abuse - https://youtu.be/UPk1QDtuXV0 How To Turn Anger Into Creative Energy? - https://youtu.be/-OlswO4XA2M
Why dont animals use wheels in locomotion? Why arent blue whales bigger? Why are there no freshwater starfish? Why are there no tree dwelling cephalopods?
Whether a worm, a human, or a blue whale, all multicellular life begins as a single-celled egg. From this solitary cell emerges the galaxy of…. ...
within this equation, big bodies require comensurately-big nervous systems ,be-cause they have to signal longer distances within that bigger body, which ,means that neruons have to be larger so that they can contain larger versions ,of the energy-transformation stuff that empowers neural activation dynamics. , So blue whale have huge neurons? And rat neurons are puny? And ours are somewhere in between? Even if that is the case, it seems to apply significantly only to motor and sensory cortex. The size of the body doesnt result in association cortex having to communicate across longer distances ...
(March, 2012) Pianist Oscar Hernandez played the Blue Whale last nite...the joints first ever Latin anything show. This one was pure Latin jazz with a helluva band, including a righteously fired up Justo Almario on tenor and bassist Carlitos Del Puerto, who has the coolest hair this side of Esperanza Spalding. Good crowd, loud and drinking…
Buy Pelican 1400 Case at Teds Camera Store. Read Pelican 1400 Case reviews, detailed specs and find all related Pelican products easily!
Pelican IM2050 Storm Case Swirl. The Pelican Storm Case has the same legendary DNA as our Pelican Protector Case, with one primary difference: A unique Press and Pull latch that locks automatically, but open with a light touch.Swirl it up just in case...G
Pelican is offering a Protector Case to our US military veterans who have sacrificed a limb while protecting the freedoms we hold dear.
Buy Pelican 1600 Case with Foam Set (Black) featuring Watertight, Dustproof Case, Made of Ultra-High Impact Copolymer, Foam Set, Automatic Pressure Equalization Valve, Easy Open Double Throw Latches, Rubber Over-Molded Handle, Lifetime Guarantee of Excellence. Review Pelican 1600 Case
... | Trusted Australian Owned Pelican Premium Dealer Stocking Full Range Of Sizes. Custom foam Inserts & Technical Packaging Available
Buy Pelican 1434 Top Loader 1430 Case with Photo Divider Set (Orange) features Watertight, Dustproof Case, Made of Ultra High Impact Copolymer. Review Pelican Hard & Watertight Cases, Hard & Waterproof Cases
Pelican 1510M Mobility Case No Foam - Black Pelican Mobility Case 1510M with NO FOAM - Black - 1510M-NF 1510M Case (Mobility Version) Interior Dimensions: 19.75 x 11.00...Click-1516121803
The Pelican 1750 long gun case can hold your rifle or shotgun with ease, and it has a durable waterproof case. Comes with lifetime replacement warranty.
So much more than just a carrying case. Pelican transport cases are engineered to provide total protection for the tools you depend on most.
Здесь вы найдете и сможете купить мужскую одежду, обувь и аксессуары PELICAN в лучших интернет-магазинах по выгодным ценам, со скидками и акциями
So much more than just a carrying case. Pelican transport cases are engineered to provide total protection for the tools you depend on most.
Tour Supply sells gaffer tape, Procell batteries, wireless from Shure, Sennheiser, Lectrosonics, ATA cases, guitar strings, drum heads, Mogami, Switchcraft & Neutrik, rack panels, Furman, midi switching, effects!
The engulfed mass shall be pictured as a long train of individual slugs of dimensions determined not only by mouth size, but also by the whale and reflux dynamics taking place at the time each is being engulfed (figures 2 and 5). Such a slug-tracking approach has been used with great success in the past, for example in parachute inflation simulations of the recontact of the wake onto a rapidly decelerating parachute (Spahr & Wolf 1981). In the BLFm, slug dynamics will be determined by the laws of one-dimensional hydrodynamics in which all the relevant motions and forces evolve along only one dimension, namely that of the whales longitudinal axis. This follows from the assumption that the energy and momentum being transmitted to the engulfed water (while inside the cavity) are used mostly to move it forward and longitudinally, rather than to change its shape or to impart transverse sloshing and/or turbulent motion. Video footage of a rorqual whales underbelly during engulfment shows some ...
The fin whale is the second longest of all of the baleen whales, and has the typical rorqual body form, which is long, slender and streamlined. Fin whales produce a tall columnar blow that can be six metres high. The fin whale is found in all of the worlds major oceans. It is a migratory species that spends the winter months in temperate mid-latitude waters where it gives birth and mates and then it migrates to higher latitudes for intensive summer feeding.
Body size is one of the most important physiological parameters that determine the energetics of foraging in air-breathing marine vertebrates. Large body size in particular confers a variety of physiological advantages that increase foraging efficiency, including a lower cost of transport and enhanced diving capacity (Halsey et al., 2006; Williams, 1999). However, as predators increase in size they also experience decreased acceleration and maneuvering performance, both of which may limit foraging success (Domenici, 2001). Predators at the upper extreme of body mass must therefore exhibit specialized morphology to increase maneuvering performance (Miklosovic et al., 2004) or foraging strategies (i.e. cooperative foraging, corralling, tail slaps) that do not involve whole-body attacks (Domenici, 2001). Furthermore, many large-bodied predators have evolved bulk-filter feeding modes that are designed to exploit aggregations of prey items that are smaller by several orders of magnitude.. Bulk filter ...
As I mentioned in a previous post, Ive been preparing a fossil mysticete skull I collected from the Purisima Formation in 2005 for a long time (i.e. 4.5 years). This winter and spring I really stepped up preparation, and you can see in these photos what the specimen looked like in January. At this point, Tom Demere of the San Diego Natural History Museum, who specializes in fossil mysticetes, tentatively identified this specimen as belonging to "Balaenoptera" cortesii var. portisi, a medium sized balaenopterid from the Pliocene of Italy, Florida, and California (Demere et al. 2005). An undescribed cranium (UCMP) from the San Diego Formation and several crania Ive seen in the Purisima Formation have this same morphology, but I did not realize this taxon was B. cortesii var. portisi, or that this specimen belonged in that taxon. "Balaenoptera" cortesii var. portisi is characterized by elongate, widely diverging zygomatic processes, which these other fossils have; it appears that the zygomatics ...
order Cetacea, suborder Mysticeti). A family that includes the fin, humpback, and blue whales. The body is streamlined, the snout pointed, the throat and chest grooved. The dorsal fin is hooked and set far back on the body. The tail is slightly notched at the mid-line, and scalloped along the posterior edge. The cervical vertebrae are not fused. The baleen plates are broad and short, the left and right rows being joined anteriorly. The animals are typically grey on the dorsal surface, with some white on the ventral surface; but Megaptera novaengliae (humpback) may be black above and below, with white flippers. Members of the family feed on krill and small fish, and occur in both hemispheres. They grow to 7-30 m depending on species. There are six species, in two genera: Balaenoptera (B. acutorostrata, minke or lesser rorqual; B. borealis, sei; B. physalus, fin; B. musculus, blue; B. edeni, Brydes); and Megaptera novaengliae (humpback). ...
There are two types of whale: baleen and toothed.. Baleen whales have long bristle-fringed plates, known as baleen, which are made of keratin (a protein also found in human hair and fingernails) and fixed to the roof of the mouth. These sieve the minute crustaceans, such as krill, that they feed on. Baleen whales have two blowholes. And unlike some other whales, they do not use echolocation (emitting sounds to locate solid objects).. Baleen whales include the largest animals ever known. Greatest of all is the blue whale; the heaviest ever recorded was a female of 190 tonnes. Baleen whales migrate through New Zealand waters on their way south to feed on krill, which are abundant in the Southern Ocean. Of the worlds 13 species of baleen whales, eight are known in New Zealand, but only two, the southern right whale and Brydes whale, breed in New Zealand waters.. ...
Alfred the fossil whale skull: Photo credit: Ben Healley.. Monash University scientists have played a key role in discovering the origin of filter feeding in baleen whales - the largest animal known to have ever existed.. The discovery is detailed in a paper co-written with international researchers and palaeontologists from Museum Victoria. Alfred the 25- million-year-old fossilised whale skull was unveiled at the Museum today.. "Alfred shows how ancient baleen whales made the evolutionary switch from biting prey with teeth to filtering using baleen," said Monash Science Senior Research Fellow, Dr Alistair Evans, one of the authors of the paper.. "They first became suction feeders. Feeding in this way resulted in reduced need for teeth, so over time their teeth were lost before baleen appeared.". There has been a lot of mystery around how and when baleen first formed.. "But we now have long-sought evidence of how whales evolved from having teeth to hair-like baleen - triggering the rise of ...
Another non-exclusive explanation for the higher prevalence of lesions observed in blue whales when compared with fin whales could relate to differences in migration patterns. This is because UVR (and consequently skin cancer radiation dosage) varies across latitudes, being five times higher at lower latitudes when compared with mid-latitudes [18]. Across Mexico, UVR is high during most of the year, and the UV index at clear sky values (a measure of the potential human exposure to UVR) is normally 6 (high) to 15 (extreme) [28]. Thus, blue whales from the northeast pacific population that migrate annually from the feeding areas between Alaska and California [29] to the Gulf of California, where some remain for at least two months (normally arriving in January/February and leaving in April/May) [30], are abruptly exposed to higher UVR. Conversely, fin whales are year-round residents of the Gulf of California [31] and thus constantly exposed to high UVR. If, as occurs in humans, sun-induced damage ...
And by biggest, do we mean the tallest, longest, or most massive? As nearly every schoolchild has heard, the Blue Whale is the most massive animal that has ever lived, stretching up to 33 meters and 180 metric tons. Not even the longest sauropod dinosaurs were as long (despite unverified claims to the contrary). But the interesting fact comes when we wonder why, over the long history of the world including giant dinosaurs and everything else, the absolute biggest would just so happen to exist now? The answer comes from math, and it has to do with the Blue Whales specialized feeding technique called lunge feeding. With a burst of speed, it opens its mouth so big as to gulp some 125% of its body weight of water, straining some half a million calories of krill. Thats a big job with a high energy cost, and it requires a lot of calories to do it. As the size of the animal goes up, the energy cost increases faster than the potential energy gain from the food. It turns out that about 33 meters is the ...
Medical organizations endorse the "Undetectable = Untransmissible" campaign, which aims to raise awareness of scientific evidence showing that virally suppressed people living with HIV cannot infect others.. 0 Comments. ...
Here are some of the latest health and medical news developments, compiled by the editors of HealthDay:. Blue Whale Online Game Responsible for Teens Suicide: Family. A 15-year-old San Antonio boy committed suicide after receiving an Internet challenge, according to his family.. They said Isaiah Gonzalez was a victim of an online fad called the Blue Whale Challenge, a social media group that encourages teens to harm themselves and even commit suicide, WOAI San Antonio reported.. Isaiah was found early Saturday morning after he committed suicide. His family is urging parents to closely monitor their childrens social media use.. After joining the Blue Whale Challenge, members are assigned daily tasks for 50 days. The tasks become progressively more extreme and dangerous. If the tasks are not completed, those controlling the challenge send threats, Isaiahs older sister Alexis told WOAI San Antonio.. -----. Child Measles Deaths in Europe an Unacceptable Tragedy: WHO. The measles deaths of 35 ...
BSWA Sound Sources. Mid-frequency Volume Source · Omni-sound Sorce & Power Amplifier · Tapping Machine · Low Frequency Volume Source.
English: Baleen (also called whalebone) is a substance made of keratin and is therefore stiff but somewhat elastic. Baleen makes up baleen plates, which are arranged in two parallel rows that look like combs of thick hair; they are attached to the upper jaws of baleen whales. Whales use these combs for filter feeding ...
The sauropods most defining characteristic was their size. Even the dwarf sauropods (perhaps 5 to 6 metres, or 20 feet long) were counted among the largest animals in their ecosystem. Their only real competitors in terms of size are the rorquals, such as the blue whale. But, unlike whales, sauropods were primarily terrestrial animals.. Their body structure did not vary as much as other dinosaurs, perhaps due to size constraints, but they displayed ample variety. Some, like the diplodocids, possessed tremendously long tails, which they may have been able to crack like a whip as a signal or to deter or injure predators,[15] or to make sonic booms.[16] Supersaurus, at 33 to 34 metres (108 to 112 ft) long,[17] was the longest sauropod known from reasonably complete remains, but others, like the old record holder, Diplodocus, were also extremely long. The holotype (and now lost) vertebra of Amphicoelias fragillimus may have come from an animal 58 metres (190 ft) long;[18] its vertebral column would ...
Researchers have captured never-seen-before footage of blue whales performing 360-degree rolling manoeuvres to gulp mouthfuls of krill. Courtesy: National
After four years of being cleaned naturally by flesh eating microorganisms, scientists dug up and reassembled the bones of a blue whale skeleton.
Rescuers who are caring for a pelican found in Long Beach with its pouch slashed offered a $2,500 reward for information about the person or people responsible for mutilating the bird.. The International Bird Rescue said Long Beach Animal Care Services found the bird on April 16 in the 5400 block of Ocean Boulevard. Such injuries are not common in nature, and the clean cut and type of cut indicate the injury was intentionally done.. Although the California brown pelican was recently removed from the list of endangered species, it is a crime to hurt migratory birds, according to the U.S. Fish and Wildlife Service.. Jay Holcomb, the rescue organizations director, said fishermen sometimes injure birds because they are falsely seen as competition.. "Pelicans are of no threat to anyone, yet they continue to be mutilated and even killed by people who see them as competition for fish," Holcomb said in a statement. "The truth is a pelicans diet is mostly anchovies and sardines - fish that are used as ...
Review for Pelican Deitanseki, Pelican Deitanseki Charcoal Soap, Soap. Read more Pelican Deitanseki product reviews at Total Beauty.
I recently heard that pound for pound, ants outweigh mammals. Yes, all mammals. Its amazing they outweigh a single blue whale, much less all of us warm-blooded, hairy animals. Now, I dont know how anyone would go about actually calculating such a figure but my point is, thats a lot of ants. It makes me not feel so bad about accidentally squashing one once in a while. I dont go out of my way to torture them like I did when I was a kid, drowning them or feeding them to ant lions and such (yes, I know--Im awful) but maybe it is time to reconsider a personal crusade against the pesky insects. It seems like theyve been nothing but trouble here and trouble is being generous ...
cross-section of jaw showing bone a, gum b, rigid plate c and frayed baleen hairs d and e. Baleen is a filter-feeder system inside the mouths of baleen whales. The baleen system works Other whales, such as the gray whale, only use one side of their baleen. These baleen bristles are arranged in plates across the upper ...
Ricky is a great white pelican who played the part of Rufus in the movie Dolphin Tale. Great white pelicans are the second largest in the pelican family
India Pelican Ale is a American IPA style beer brewed by Pelican Pub & Brewery in Pacific City, OR. 4.11 average with 273 ratings, reviews and opinions.
India Pelican Ale is a American IPA style beer brewed by Pelican Pub & Brewery in Pacific City, OR. 4.11 average with 273 ratings, reviews and opinions.
The Pelican 1520 case is the go-to choice for your must-stay-dry gear such as cameras, camcorders, GPS units and just about anything else. Equipped with an open cell core, solid wall design, with an O-ring seal and an automatic pressure equalization valve, this strong, light-weight case offers superior protection on and off the river. Every Pelican comes standard with stainless steel hardware, Pick N Pluck foam and convoluted lid foam. Lifetime Guarantee ...
books.google.comhttps://books.google.com/books/about/The_Pelican_Guide_to_English_Literature.html?id=7SweAAAAIAAJ&utm_source=gb-gplus-shareThe Pelican Guide to English Literature ...
Shop Carolines Treasures Pelican Fleur de lis House Vertical Flag at Staples. Choose from our wide selection of Carolines Treasures Pelican Fleur de lis House Vertical Flag and get fast & free shipping on select orders.
x_inc [and optionally y_inc] is the grid spacing. Optionally, append a suffix modifier. Geographical (degrees) coordinates: Append m to indicate arc minutes or s to indicate arc seconds. If one of the units e, f, k, M, n or u is appended instead, the increment is assumed to be given in meter, foot, km, Mile, nautical mile or US survey foot, respectively, and will be converted to the equivalent degrees longitude at the middle latitude of the region (the conversion depends on PROJ_ELLIPSOID). If y_inc is given but set to 0 it will be reset equal to x_inc; otherwise it will be converted to degrees latitude. All coordinates: If +e is appended then the corresponding max x (east) or y (north) may be slightly adjusted to fit exactly the given increment [by default the increment may be adjusted slightly to fit the given domain]. Finally, instead of giving an increment you may specify the number of nodes desired by appending +n to the supplied integer argument; the increment is then recalculated from the ...
14] We have already demonstrated that the polarization response favors longer λ; that is, Epx would be larger for d/λ values less than unity. For example, if the base of the F layer is at 250 km altitude, and CGW propagation occurs at an elevation angle of, say 40°, d would be about 400 km. Then, d/λ= 1 for λ = 400 km, which is the example in Figure 2a. For experimental estimates of d, we referred to Waldock and Jones [1987], assuming GW propagation is similar at low and middle latitudes. Through inverse ray tracing, they found that the source region was located between 250 and 1500 km in distance from the observation location. This means λ would have to be larger, if d increases, in order to keep the ratio near unity. Hence, according to our model, the observed λ should have values similar to d, between 250 and 1500 km.. [15] In fact, this range of λ values appears to match observations. Given that ESF occurs in patches, which are collocated with upwellings in LSWS [Tsunoda and White, ...
Lunges can be used to work several muscles in your lower body, including your quads, glutes, and hamstrings. You can also target additional muscles by trying lunge variations, such as the side lunge or a lunge with torso twist.
Kayak anglers looking for a fishing kayak with a ton of build in fishing features at a value price should check out Pelicans Catch 120. The Catch 120 has features you usually only see on kayaks that cost thousands more. A raised framed seat with Ergocast dual position seating, build in flush mount rod holders, stand assist strap, quick lock hatch and more make the Catch 120 the perfect kayak for anglers looking for the most bang for their buck.
Buy the Pelican Cases 1526 Medium Black Case with Additional Convertible Travel Bag at Full Compass. NOTE: Additional convertible travel bag not shown above.Features: Watertight, crushproof, and dust proof Easy open Double Throw latches Open cell core with solid wall design - strong, light weigh
Buy the Pelican Cases 1200NF Mini-D Case WITHOUT Foam at Full Compass. NOTE: THe PC1200NF is shown above with foam, although it does NOT come with foam. Available in the following colors: Black (pictured) Desert Tan Yellow OD Green Orang SilverFeatures:
Great price on Pelican Select colostomy bag maxi 106950 50mm Opaque(Pel). FREE delivery options available. Trusted service, convenient and safe shopping online
Great price on Pelican Select ileostomy bag paed 101603 10-50mm Opaque(Pel). FREE delivery options available. Trusted service, convenient and safe shopping online
Pelican SabreLite 2000 Flashlight - 2000-010-110 - Item #556398 at pcRUSH.com with best price for only $ 32.71 as of Saturday, December 16, 2017 - Page 1
Ive visited the Kennedy Space Center before - at the tail end of a business trip in 1998, when a bunch of us were fortunate enough to watch the Endeavour come in for a landing from a distance. We may visit it tomorrow; stay tuned.. ...
Joest porsche racing jacket (962) I believe the jacket to be circa 1980s It was also never worn! Sent from my iPhone using Tapatalk
would a dtml cause low fuel pressure change sending unit for fuel filter car started ran then put into drive car dies when bypassing the hose to vapor
Master the lunge with plate arc and intensify your leg and butt training by adding the benefits of reactive core training into the mix.
Find reviews, trailers, release dates, news, screenshots, walkthroughs, and more for Choaniki: Sei Naru Protein Densetsu here on GameSpot.
原文地址:http://www.vpsee.com/tag/python/ 使用 Flask 搭建静态博客 2014年10月15日 | 标签: flask, python 现在流行的静态博客/网站生成工具有很多,比如 Jekyll, Pelican, Middleman, Hyde 等等,StaticGen 列出了目前最流行的一些静态网站生成工具。 我们的内部工具由 P
The behaviour evident for the various North Atlantic fin whale populations following earlier reductions through whaling differs. It ranges from clear evidence of recovery to no firm indications of any increase. An estimated 14,000 fin whales were killed off North Norway during 1876-1904, and a further 1,500 during 1948-71, but fin whales are rare there now (although quite abundant off western Spitsbergen, where about 1,500 whales had been killed during 1904-11) (Øien 2003, 2004). An estimated 12,000 fin whales were killed off Iceland during 1890-1915, until whaling was suspended partly due to concerns about the reductions in the stocks, but the modern abundance data suggest that the there has been a recovery in the population that may still be continuing, particularly west of Iceland, despite catches during 1948-89 averaging about 220 per year (Branch and Butterworth 2006). An estimated 10,000 fin whales were taken from the Faeroes, but about 25% of these were actually caught off eastern ...
Human-induced mortality from vessel collisions and bycatch in fishing gear (Panigada et al. 2006), together with the potential effects of the disturbance caused by growing whale watching activities, lead to the inference that the subpopulation is declining. Fin Whales have been described as particularly abundant during the summer months in the Corso-Ligurian-Basin, which is considered their major feeding ground in the Mediterranean Sea. A sharp decrease in Fin Whale abundance has been observed in the Pelagos Sanctuary over the last decade, with estimates of 900 individuals reported from the western Ligurian Sea in 1992 (Forcada et al. 1995), declining to significantly lower numbers (N=147; CV=27.04%; 95% CI=86-250) in 2009 (Panigada and Lauriano pers. comm.). While the sharp decrease of Fin Whales in the Pelagos Sanctuary may be due to whales relocating elsewhere within the Mediterranean, their decrease in prime Fin Whale habitat must be addressed with precaution, and a population decline in the ...
Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by ...
Scientists in the past have used this waxy matrix as an aging tool, similar to counting tree rings. Then, the question arose: Could whale earwax chronologically archive chemicals, such as man-made pollutants?" said Usenko, assistant professor of environmental science in Baylors College of Arts and Sciences. Over the past two years, Trumble and Usenko developed analytical methods capable of answering that very question. "The type of information we can derive from these earplugs along with our methodology is exceptionally valuable. There is nothing like it. It really should be classified as a new field of research," Usenko said. Historically, scientists have used whale blubber to determine hormone and chemical exposure, but that method only provides information over short, finite periods of time and can be difficult to obtain and cost-prohibitive. "Whales are free-ranging animals and you cant get these types of profiles or information on free-ranging animals in any part of the world. This has ...
The cheek teeth [of Aetiocetus] are leaf shaped, similar to those of Patriocetus, but smaller and with the roots coalesced. The triangular rostrum, reduced dentition, and the conformation of the posterior ends of the maxillae, premaxillae, and nasals (Ernlong, 1966:s) are characters that would be expected in the ancestor of the mysticetes. Thenius (1969:489) stated: "Even if Aetiocetus, because of its geologic age (upper Oligocene) cannot be a direct stem form of the cetotheres, yet this genus documents that a specific family (Aetiocetidae) must be classified as ancestor, the link between ancient and baleen whales.. "Among the few Cetacea known from deposits of middle Oligocene age are two occurrences of unmistakable Mysticeti. One of these, Mauicetus Benham, 1939, from New Zealafid, has long nasals embraced by premaxillae and maxillae which extend posteriorly to the level of the supraorbital process of the frontal, together with an anteriorly thrusting triangular supraoccipital. The Oligocene ...
Minke whales feed on fish and various invertebrates; like all baleen whales they filter their food from the water using their baleen plates like sieves. Although largely a solitary species, when feeding minke whales can often be seen in pairs, and on particularly good feeding grounds up to a hundred individuals may congregate. A number of feeding techniques have been observed, including trapping shoals of fish against the surface of the water. After a ten month gestation period, births occur in mid-winter, at birth the calf measures up to 2.8 metres in length. It will be weaned at four months of age, and will stay with its mother for up to two years, becoming sexually mature at seven years of age. Minke whales have an average life span of around 50 years. Minke whales are rather inquisitive and often swim by the side of boats for up to half an hour ...
Whales are separated into the toothed whales, Odontocetes (which includes dolphins, porpoises, narwhals, beaked whales and sperm whales), and the whalebone, or baleen, whales, also called Mysticetes. The latter are mostly very large, which, instead of teeth, have baleen (whalebone) to filter small prey from the water; they are what people generally think of when the word whale is used. The whalebone whales include the rorquals - the blue whale, fin whale, sei whale, Brydes whale, minke whale, and humpback whale; the grey whale; and the various right whales. Although whales are famed for the massive size reached by some species, such as the blue whale (the largest animal to ever live), others are relatively small, like the pygmy right whale which grows to about 20 feet.[1] Though whales have many traits in common with fish (including fins and tails) they are classified as mammals under the Linnaean taxonomy classification system because they breathe air and lactate. Whales have a number of ...
On 15-16 January 2005, three offshore species of cetaceans (33 short-finned pilot whales, Globicephala macrorhynchus, one minke whale, Balaenoptera acutorostrata, and two dwarf sperm whales, Kogia sima) stranded alive on the beaches of North Carolina. The pilot whales stranded near Oregon Inlet, the minke whale in northern North Carolina, and the dwarf sperm whales near Cape Hatteras. Live strandings of three species in one weekend was unique in North Carolina and qualified as an Unusual Mortality Event.. Gross necropsies were conducted on 16-17 January 2005 on 27 pilot whales, two dwarf sperm whales, and the minke whale. Samples were collected for clinical pathology, parasitology, gross pathology, histopathology, microbiology and serology. There was variation in the number of animals sampled for each collection type, however, due to carcasses washing off the beach or degradation in carcass condition during the course of the response. Comprehensive histologic examination was conducted on 16 ...
This study investigates the effects of acoustic conditions on speech comprehension, rather than speech intelligibility as often reported in existing literature. Sets of 15-minute-long listening comprehension tests were developed based on the format of the Test of English for International Communication (TOEIC). Each test set includes four types of tasks: matching aural phrases to photographs, selecting appropriate responses to aural questions, and answering questions after listening to conversations (between two talkers) and talks (single talker). Within the Nebraska acoustics test chamber, native-English-speaking participants are asked to perform these tests under 15 acoustic conditions, from combinations of three background noise levels (RC-30, 40 and 50) and five mid-frequency reverberation times (0.4 to 1.2 seconds). The background noise levels are varied via an Armstrong i-Ceiling system, while the reverberation times are simulated from convolving the anechoic test signals with binaural room
But what if he could, tho?. What would this super awesome therapy THE MAN doesnt want you to know about look like? How would it work?. That would be a fun and educational game to play!. Okay, to play this game you first have to understand what CAEV is. Caprine arthritis-encephalitis virus is a retrovirus that infects goats. It is like HIV in the sense that they are both lentiviruses, that is, more complex (more genes) retroviruses. They both share the standard gag, pol, and env genes all retroviruses have, plus a few accessory genes: rev, tat, and vif. HIV also has a few more.. But while there are similarities, CAEV and HIV are not the same any more than you and blue whales are the same (I tried to align an amino acid sequence of a CAEV Env with an HIV-1 Env, and the program was like Nuh uh. Dees dont go together.). So: How could CAEV be used to cure HIV?. 1- Anti-CAEV antibodies from goats could stop HIV!. Dr. Whatever said, specifically, that he looked for the absence of disease. ...
Increased whaling numbers contrary to scientific and international decisions. WASHINGTON, DC: A coalition of international whale protection organisations today strongly condemned the start of Norways 2017 whaling season, which began on April 1.. The coalition believes the hunt could result in the cruel slaughter of up to 999 minke whales, a self-allocated quota more than 100 higher than that set by the Norwegian Government in 2016. In addition, 90 percent of the minke whales hunted by Norways whaling industry are females and almost all of them are pregnant, effectively nearly doubling the actual death toll and seriously impacting future generations of the species.. The increased quota comes as domestic demand for whale meat has flagged and international exports of Norwegian whale products have escalated, in contravention of global bans on both commercial whaling and international trade in whale products.. This years whaling quota, which is not authorised by the International Whaling ...
Of course itʼs impossible to contain the ocean in a book, but The Ocean Almanac comes very near to doing just that. This entertaining, informative almanac offers essays, anecdotes, facts and legends, all pertaining to the earthʼs oceans: life in the seven seas, from the humble plankton (the absolute bottom of the food chain and hence the basis of all life on earth) to the mighty blue whale (the largest creature ever to live on the planet); sea monsters, from Jonahʼs ʺgreat fishʺ to Moby Dick; sailorsʼ superstitions (never carry a black seabag; always board a ship right foot first); great ships and seamen, from the fifteenth-century voyages of discovery to contemporary naval commanders; pirates, buccaneers, mutineers and other seafaring outcasts; the riches of the sea, from tuna to petroleum; great sea disasters; ocean and beach sports; seafood recipes; and virtually everything else that one could want to know about the oceans of the world, the creatures who inhabit them and the people who tap
Genus: Balaenoptera *Fin whale Balaenoptera physalus EN. *Minke whale Balaenoptera acutorostrata NT ...
Balaenoptera borealis) and Bryde's whale (Balaenoptera brydei) than to other Balaenoptera species, and closer to the humpback ... "Cook Islands Biodiversity : Balaenoptera musculus - Blue Whale".. *^ "GEF Project Site Maps" (PDF). thegef.org. 13 March 2016. ... Balaenoptera acutorostrata and Balaenoptera bonaerensis).[13][14] If further research confirms these relationships, it will be ... "Blue whale, Balaenoptera musculus". MarineBio.org. Retrieved 21 April 2006.. *NOAA Fisheries, Office of Protected Resources ...
Wilson (1967); "Balaenoptera sp. Rorquals", p. 213. Wilson (1967); "Physeter sp. Sperm Whale", p. 212. Holman, J. Alan; Fisher ... He also reported the discovery of an Arkonan-aged rorqual rib of the genus Balaenoptera. The fossil had been discovered upright ...
Genesee is noted for having had the fossil of an ancient whale known as Balaenoptera Lacepede unearthed in Thetford Township ... "Fossilworks: Balaenoptera". paleodb.org. http://paleodb.org/cgi-bin/bridge.pl?action=displayCollectionDetails&collection_no= ...
Wilson (1967); "Balaenoptera sp. Rorquals", p. 213. Wilson (1967); "Physeter sp. Sperm Whale", p. 212. Holman, J. Alan; Fisher ... rorqual rib of the genus Balaenoptera. The fossil had been discovered upright in the sand during the excavation of a cellar in ...
Cetacean Specialist Group (1996). "Balaenoptera edeni". IUCN Red List of Threatened Species. Version 2006. International Union ... Cetacean Specialist Group (1996). "Balaenoptera physalus". IUCN Red List of Threatened Species. Version 2006. International ... Cetacean Specialist Group (1996). "Balaenoptera musculus". IUCN Red List of Threatened Species. Version 2006. International ... Cetacean Specialist Group (1996). "Balaenoptera borealis". IUCN Red List of Threatened Species. Version 2006. International ...
Common minke whale Balaenoptera acutorostrata LC Fin whale Balaenoptera physalus EN Humpback whale Megaptera novaeangliae LC ... "Balaenoptera physalus". The IUCN Red List of Threatened Species. IUCN. 2013: e.T2478A44210520. doi:10.2305/IUCN.UK.2013-1.RLTS. ... "Balaenoptera acutorostrata". The IUCN Red List of Threatened Species. IUCN. 2008: e.T2474A9444043. doi:10.2305/IUCN.UK.2008. ...
"Balaenoptera acutorostrata". Integrated Taxonomic Information System. Retrieved 18 March 2006. "Balaenoptera bonaerensis". ... In 1804, Bernard Germain de Lacépède described a juvenile specimen of Balaenoptera acuto-rostrata. The name is a partial ... Most modern classifications split the minke whale into two species; Common minke whale or northern minke whale (Balaenoptera ... acutorostrata) and Antarctic minke whale or southern minke whale (Balaenoptera bonaerensis). Taxonomists further categorize the ...
"Sei Whale & Bryde's Whale Balaenoptera borealis & Balaenoptera edeni". American Cetacean Society. March 2004. Archived from the ... Balaenoptera borealis, Megaptera novaeangliae, and Balaenoptera physalus". J. Mamm. 60 (1): 155-163. doi:10.2307/1379766. JSTOR ... Draft Recovery Plan for the Fin Whale Balaenoptera physalus and Sei Whale Balaenoptera borealis (PDF). Silver Spring, Maryland ... 2008). "Balaenoptera borealis". The IUCN Red List of Threatened Species. IUCN. 2008: e.T2475A9445100. doi:10.2305/IUCN.UK.2008. ...
Cetacean Specialist Group (1996). "Balaenoptera musculus ssp. musculus (North Pacific stock)". IUCN Red List of Threatened ... Cetacean Specialist Group (1996). "Balaenoptera physalus". IUCN Red List of Threatened Species. Version 2006. International ... "Balaenoptera acutorostrata". IUCN Red List of Threatened Species. Version 2006. International Union for Conservation of Nature ...
The southern fin whale (Balaenoptera physalus quoyi) is a subspecies of fin whale that lives in the Southern Ocean. At least ... "Balaenoptera physalus". Integrated Taxonomic Information System. Retrieved 2012-08-15. Perrin, William F., James G. Mead, and ... Based on differences in the vertebrae, the Swedish zoologist Einar Lönnberg (1931) designated Balaenoptera physalus quoyii ( ...
The northern fin whale (Balaenoptera physalus physalus) is a subspecies of fin whale that lives in the North Atlantic Ocean and ... "Balaenoptera physalus". Integrated Taxonomic Information System. Retrieved 2012-08-15. Evans, Peter G. H. (1987). The Natural ...
2008). "Balaenoptera bonaerensis". The IUCN Red List of Threatened Species. IUCN. 2008: e.T2480A9449324. doi:10.2305/IUCN.UK. ... The Antarctic minke whale or southern minke whale (Balaenoptera bonaerensis) is a species of minke whale within the suborder of ... J., Scholl, T.G.S. and Moura de Oliveira, J. (2011). "Antarctic minke whales (Balaenoptera bonaerensis) near the Equator". ... 2016). First record of Antarctic minke whale, Balaenoptera bonaerensis, in the northern Gulf of Mexico. Mar. Bio. Rec. 9:63. ...
Balaenoptera edeni and Balaenoptera brydei. The six specimens obtained in the Solomon Sea in 1976 were only noted to be smaller ... Balaenoptera edeni Wilson, D.E.; Reeder, D.M., eds. (2005). Mammal Species of the World: A Taxonomic and Geographic Reference ( ... Yamada, T.K. (2008). Omura's whale (Balaenoptera omurai), pp. 799-801. In Perrin, W.F.P., B. Würsig, and J.G.M. Thewissen, eds ... Omura's whale or the dwarf fin whale (Balaenoptera omurai) is a species of rorqual about which very little is known. Before its ...
The pygmy blue whale (Balaenoptera musculus brevicauda) is a subspecies of the blue whale (Balaenoptera musculus) found in the ... "Assessment and Update Status Report on the Blue Whale Balaenoptera musculus" (PDF). Committee on the Status of Endangered ... Cetacean Specialist Group (1996). "Balaenoptera musculus ssp. brevicauda". IUCN Red List of Threatened Species. IUCN. 1996: e. ... "Balaenoptera musculus - Blue Whale". Canberra: Australian Government: Department of the Environment and Water Resources. 2007. ...
참고래 Balaenoptera physalus. Retrieved on August 26, 2017 EB (1878), p. 390. "Corea", Encyclopædia Britannica, 9th ed., Vol. VI, ...
"Red List of Threatened Species - Balaenoptera physalus". IUCN. Retrieved 2006-12-04. "Balaenoptera musculus ssp. intermedia ( ... "Balaenoptera musculus ssp. musculus (North Atlantic stock) (Blue Whale, North Atlantic Blue Whale)". IUCN Red List of ... "Balaenoptera borealis (Sei Whale, Coalfish Whale, Pollack Whale, Rudophi's Rorqual)". IUCN Red List of Threatened Species. ... "Balaenoptera musculus ssp. musculus (North Pacific stock) (Blue Whale)". IUCN Red List of Threatened Species. International ...
2008). "Balaenoptera bonaerensis". The IUCN Red List of Threatened Species. IUCN. 2008: e.T2480A9449324. doi:10.2305/IUCN.UK. ...
Balaenoptera acutorostrata). Whale Tongue (Balaenoptera acutorostrata). Whale lung (Balaenoptera acutorostrata). Whale kidney ( ... Balaenoptera acutorostrata). Whale artery (cut) (Balaenoptera acutorostrata). Cetaceans portal Marine life portal List of ... 2008). "Balaenoptera acutorostrata". The IUCN Red List of Threatened Species. IUCN. 2008: e.T2474A9444043. doi:10.2305/IUCN.UK. ... "Fossilworks: Balaenoptera acutorostrata". fossilworks.org. Bull, H. J. (1896). The cruise of the 'Antarctic' to the South Polar ...
참고래 Balaenoptera physalus. Retrieved on August 26, 2017 "평년값자료(30년) 울릉도(115)". Korea Meteorological Administration. Retrieved ...
2007). Bryde's Whales, Balaenoptera edeni, observed in the Azores: a new species record for the region. Mar Biod. Rec. 1:1-6. ... 濒危物种数据库 - 鳀鲸 Balaenoptera edeni Anderson, 1879]. the CITES. Retrieved on November 24. 2014 Wang Pei Lei (王丕烈). (1984). 中国近海鲸类的分 ... Bryde's Whale (Balaenoptera edeni). Retrieved on March 06, 2017 Shimada, H. and Pastene, L.A. (1995). Report of a Sightings ... Balaenoptera brydei on Wikimedia Commons Cetaceans portal Marine life portal List of whale and dolphin species Marine biology ...
"Fin Whale - Balaenoptera physalus". Kenai Fjords Nation al Park. National Park Service. Retrieved February 11, 2013. "Humpback ... "Minke Whale - Balaenoptera acutorostrata". Kenai Fjords National Park. National Park Service. Retrieved February 11, 2013. " ...
The Bryde's whale (Balaenoptera brydei) is named after him. He was born at Laurvig in Vestfold, Norway. He was the son of Johan ... "Bryde's Whale, Balaenoptera edeni". us.whales.org. Retrieved August 1, 2017. Henriksen, Petter, ed. (2007). "Sandefjord". Store ...
"Blue whale (Balaenoptera musculus)". NOAA Fisheries (National Marine Fisheries Service). February 10, 2016. Retrieved November ...
"Blue Whale (Balaenoptera musculus)". Mohamed bin Zayed Species Conservation Fund. Retrieved 2012-04-02. "Proyecto Alfaguara" ( ...
"Balaenoptera physalus (Linnaeus, 1758)". World Cetacea Database. World Register of Marine Species. Retrieved August 9, 2010. W ...
Balaenoptera Lacépède, 1804 + * Balaenoptera acutorostrata Lacépède, 1804 * Balaenoptera acutorostrata acutorostrata Lacépède, ... The Northern minke whale (Balaenoptera acutorostrata), is a very large cetacean, in the family of Rorquals (Balaenoptera). The ... Balaenoptera acutorostrata - Overview Minke Whale learn more about names for this taxon ... Jennifer Hammock split the classifications by Inventaire National du Patrimoine Naturel from Balaenoptera acutorostrata ...
The fin whale is the second longest of all of the baleen whales, and has the typical rorqual body form, which is long, slender and streamlined. Fin whales produce a tall columnar blow that can be six metres high. The fin whale is found in all of the worlds major oceans. It is a migratory species that spends the winter months in temperate mid-latitude waters where it gives birth and mates and then it migrates to higher latitudes for intensive summer feeding.
Balaenoptera physalus. The IUCN Red List of Threatened Species 2007: e.T2478A9448238. . Downloaded on 22 January 2018.. ... Home » Balaenoptera physalus (Common Rorqual, Finback, Fin-backed Whale, Finner, Fin Whale, Herring Whale, Razorback) ...
Spatial distribution of Antarctic minke whales (Balaenoptera bonaerensis) in relation to spatial distributions of krill in the ... Balaenoptera borealis) and Brydes whales (B. brydei) in the western North Pacific, Fisheries Oceanography, 2013, n/a. Wiley ... Balaenoptera borealis) in the subarctic-subtropical transition area of the western North Pacific in relation to oceanic fronts ...
Subspecies (for MSW): Balaenoptera musculus musculus, Balaenoptera musculus brevicauda, Balaenoptera musculus indica, ... Abgerufen von „https://commons.wikimedia.org/w/index.php?title=Balaenoptera_musculus&oldid=150621755" ...
Antarctic minke whale Balaenoptera borealis, Sei whale Balaenoptera brydei, Brydes whale †Balaenoptera cephalus †Balaenoptera ... Balaenoptera edeni, Edens whale Balaenoptera musculus, blue whale Balaenoptera omurai, Omuras whale Balaenoptera physalus, ... fin whale †Balaenoptera siberi (Pliocene, Peru) †Balaenoptera sursiplana †Balaenoptera taiwanica Many fossil Balaenoptera ... The species Balaenoptera omurai was published in 2003. Balaenoptera is a diverse genus and comprises all but one of the extant ...
2005) note that Balaenoptera ryani can be diagnosed by a unique combination of characters found in both Balaenopteridae and non ... "Balaenoptera" ryani is an extinct species of Balaenopteridae from the late Miocene of California. It was originally considered ... a species of Balaenoptera, but is now recognized as more primitive than any extant or fossil balaenopterid and thus in need of ...
I]Balaenoptera bertae[/I] would have been approximately 5-6 meters in length, slightly smaller than modern minke whales. It was ... The whale belongs within the same genus as minke and fin whales, indicating that the [I]Balaenoptera[/I] lineage has lasted for ... Balaenoptera bertae[/I] unearthed in the San Francisco Bay Area. ... Balaenoptera bertae would have been approximately 5-6 meters in ... The whale belongs within the same genus as minke and fin whales, indicating that the Balaenoptera lineage has lasted for 3-4 ...
Balaenoptera musculus ssp. intermedia (errata version published in 2016). The IUCN Red List of Threatened Species 2008: e. ...
Genus: Balaenoptera Species: Balaenoptera musculus Name[edit]. *Balaenoptera musculus (Linnaeus, 1758) *Type Locality: UK, ... Balaenoptera musculus in Mammal Species of the World. Wilson, Don E. & Reeder, DeeAnn M. (Editors) 2005. Mammal Species of the ... Balaenoptera musculus (Linnaeus, 1758) Report on ITIS. Vernacular names[edit]. Afrikaans: Blouwalvis. العربية: حوت أزرق. ... Retrieved from "https://species.wikimedia.org/w/index.php?title=Balaenoptera_musculus&oldid=4776999" ...
Balaenoptera borealis in Mammal Species of the World.. Wilson, Don E. & Reeder, DeeAnn M. (Editors) 2005. Mammal Species of the ... Smithsonian Institution - North American Mammals: Balaenoptera borealis. Vernacular names[edit]. Bahasa Indonesia: Paus Sei. ... Retrieved from "https://species.wikimedia.org/w/index.php?title=Balaenoptera_borealis&oldid=3598035" ...
GenDR A curated database of genes associated with dietary restriction in model organisms either from genetic manipulation experiments or gene expression profiling.. ...
Minke whale (Balaenoptera acutorostrata) flipper model, cast from a fresh flipper. After removal of skin folds from the model, ... Minke whale (Balaenoptera acutorostrata) flipper in (A) dorsal view and (B) leading edge view. Bones colored red, cartilage ... Minke whales (Balaenoptera acutorostrata) are the smallest member of balaenopterid whales and little is known of their ... Hydrodynamic performance of the minke whale (Balaenoptera acutorostrata) flipper Message Subject (Your Name) has sent you a ...
The sei whale is the 3rd largest baleen whale after the fin whale and the blue whale. It inhabits most of the worlds oceans and its adjoining seas, but prefers
Genus: Balaenoptera. Species. Balaenoptera edeni. Common name. Brydes whale. Lifespan, ageing, and relevant traits. Maximum ... AnAge entry for Balaenoptera edeni Classification (HAGRID: 01933). Taxonomy. Kingdom: Animalia. Phylum: Chordata. Class: ...
Balaenoptera musculus (Linnaeus, 1758). TAXONOMY: ANIMALIA; CHORDATA; GNATHOSTOMATA (Jawed Vertebrates); TETRAPODA; MAMMALIA; ...
Balaenoptera musculus), fin (Balaenoptera physalus), and sei whales (Balaenoptera borealis) and sperm whales (Physeter ... Balaenoptera musculus B. borealis B. physalus Physeter macrocephalus Parasites Giardia Balantidium This is a preview of ... Akao S (1970) A new species of sarcocystis parasitic in the whale balaenoptera borealis. J Protozool 17:290-294. doi: 10.1111/j ... Endoparasite survey of free-swimming baleen whales (Balaenoptera musculus, B. physalus, B. borealis) and sperm whales (Physeter ...
Behavioral responses of individual blue whales (Balaenoptera musculus) to mid-frequency military sonar ... Behavioral responses of individual blue whales (Balaenoptera musculus) to mid-frequency military sonar ... Behavioral responses of individual blue whales (Balaenoptera musculus) to mid-frequency military sonar ... Behavioral responses of individual blue whales (Balaenoptera musculus) to mid-frequency military sonar ...
Balaenoptera musculus photograph, stock photo of a Blue Whale, image #27023, by Professional Natural History Photographer ... Blue Whale Photo, Balaenoptera musculus. Home > Natural History Photography Blog > Search > [email protected] (760) 707- ... Species: Blue whale, Balaenoptera musculus. Location: Santa Rosa Island, California, USA. Copyright © Phillip Colla, all rights ...
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenopteridae; ...
Balaenoptera physalus) surfacing, Baja California, Mexico Stock Photos. Search over 12 million royalty free images and rights ...
Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)Imported. Automatic assertion inferred ... Balaenoptera acutorostrata scammoni OX=310752 GN=MAGI1 PE=4 SV=1 MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAENGEFPYVGAVAAAEAAGLPGGGQ ...
Proteoglycans in cancer - Balaenoptera acutorostrata scammoni (minke whale) [ Pathway menu , Organism menu , Pathway entry , ...
The Antarctic blue whale (Balaenoptera musculus intermedia) was hunted to near extinction between 1904 and 1972, declining from ... Circumpolar Diversity and Geographic Differentiation of mtDNA in the Critically Endangered Antarctic Blue Whale (Balaenoptera ... balaenoptera musculus intermedia). PloS One, 7(3), e32579. doi: 10.1371/journal.pone.0032579 ...
1989 Propulsion of a fin whale (Balaenoptera physalus)-why the fin whale is a fast swimmer. Proc. R. Soc. B. 237, 175-200. doi: ... 2008 Hydrodynamic performance of the minke whale (Balaenoptera acutorostrata) flipper. J. Exp. Biol. 211, 1859-1867. doi: ... Kinematics of a fin whale Balaenoptera physalus lunge. The schematic shows the different stages of engulfment and the expansion ... 1997 Histology of the grooved ventral pouch of the minke whale, Balaenoptera acutorostrata, with special reference to the ...
  • britanski zoolog William Henry Flower nazvao je primjerak od 13,7 metara, koji je nabavljen iz Pekalongana , na sjevernoj obali Jave , Sibbaldius (= Balaenoptera ) schlegelii - trebalo je sve do 1946. (wikipedia.org)
  • Jennifer Hammock split the classifications by Inventaire National du Patrimoine Naturel from Balaenoptera acutorostrata Lacépède, 1804 to their own page . (eol.org)
  • Pennella balaenoptera is a mesoparasitic copepod that has been reported in at least 17 cetacean species. (int-res.com)
  • We also obtained data on infection parameters of P. balaenoptera based on 450 individuals of 6 cetacean species stranded on the Spanish Mediterranean coast between 1980 and 2017. (int-res.com)