A phylum of bacteria comprised of three classes: Bacteroides, Flavobacteria, and Sphingobacteria.
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
A collective genome representative of the many organisms, primarily microorganisms, existing in a community.
One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.
A phylum of bacteria consisting of the purple bacteria and their relatives which form a branch of the eubacterial tree. This group of predominantly gram-negative bacteria is classified based on homology of equivalent nucleotide sequences of 16S ribosomal RNA or by hybridization of ribosomal RNA or DNA with 16S and 23S ribosomal RNA.
The relationships of groups of organisms as reflected by their genetic makeup.
DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.
The variety of all native living organisms and their various forms and interrelationships.
A family of gram-negative, gliding bacteria in the order Cytophagales, class Cytophagia. They are found in SOIL and SEA WATER.
Deoxyribonucleic acid that makes up the genetic material of bacteria.
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
A phylum of anaerobic, gram-negative bacteria with a chemoorganotrophic heterotrophic metabolism. They are resident flora of the OROPHARYNX.
Generally refers to the digestive structures stretching from the MOUTH to ANUS, but does not include the accessory glandular organs (LIVER; BILIARY TRACT; PANCREAS).
The spectrum of different living organisms inhabiting a particular region, habitat, or biotope.
The salinated water of OCEANS AND SEAS that provides habitat for marine organisms.
The full collection of microbes (bacteria, fungi, virus, etc.) that naturally exist within a particular biological niche such as an organism, soil, a body of water, etc.
Genes, found in both prokaryotes and eukaryotes, which are transcribed to produce the RNA which is incorporated into RIBOSOMES. Prokaryotic rRNA genes are usually found in OPERONS dispersed throughout the GENOME, whereas eukaryotic rRNA genes are clustered, multicistronic transcriptional units.
Electrophoresis in which various denaturant gradients are used to induce nucleic acids to melt at various stages resulting in separation of molecules based on small sequence differences including SNPs. The denaturants used include heat, formamide, and urea.
A physiologically diverse phylum of acidophilic, gram-negative bacteria found in a wide variety of habitats, but particularly abundant in soils and sediments.
A mass of organic or inorganic solid fragmented material, or the solid fragment itself, that comes from the weathering of rock and is carried by, suspended in, or dropped by air, water, or ice. It refers also to a mass that is accumulated by any other natural agent and that forms in layers on the earth's surface, such as sand, gravel, silt, mud, fill, or loess. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed, p1689)
A phylum of gram-negative bacteria containing seven class-level groups from a wide variety of environments. Most members are chemoheterotrophs.
A group of different species of microorganisms that act together as a community.
A genus of gram-negative, anaerobic, nonsporeforming, nonmotile rods. Organisms of this genus had originally been classified as members of the BACTEROIDES genus but overwhelming biochemical and chemical findings in 1990 indicated the need to separate them from other Bacteroides species, and hence, this new genus was established.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A genus of gram-negative, anaerobic, rod-shaped bacteria. Its organisms are normal inhabitants of the oral, respiratory, intestinal, and urogenital cavities of humans, animals, and insects. Some species may be pathogenic.
The relative amounts of the PURINES and PYRIMIDINES in a nucleic acid.
The presence of bacteria, viruses, and fungi in the soil. This term is not restricted to pathogenic organisms.
Class of BACTERIA with diverse morphological properties. Strains of Actinobacteria show greater than 80% 16S rDNA/rRNA sequence similarity among each other and also the presence of certain signature nucleotides. (Stackebrandt E. et al, Int. J. Syst. Bacteriol. (1997) 47:479-491)
A genus of gram-positive, anaerobic, cocci to short rod-shaped ARCHAEA, in the family METHANOBACTERIACEAE, order METHANOBACTERIALES. They are found in the GASTROINTESTINAL TRACT or other anoxic environments.
Ribonucleic acid in bacteria having regulatory and catalytic roles as well as involvement in protein synthesis.
The genomic analysis of assemblages of organisms.
A genus of gram-negative, chemoorganotrophic bacteria in the family CYTOPHAGACEAE. In some species there is a cyclic change in cell morphology.
Excrement from the INTESTINES, containing unabsorbed solids, waste products, secretions, and BACTERIA of the DIGESTIVE SYSTEM.
Community of tiny aquatic PLANTS and ANIMALS, and photosynthetic BACTERIA, that are either free-floating or suspended in the water, with little or no power of locomotion. They are divided into PHYTOPLANKTON and ZOOPLANKTON.
A family of bacteria in the order Sphingobacteriales, class Sphingobacteria. They are gram-negative rods, mostly saprophytic in terrestrial and aquatic habitats.
Water containing no significant amounts of salts, such as water from RIVERS and LAKES.
The processes by which organisms utilize organic substances as their nutrient sources. Contrasts with AUTOTROPHIC PROCESSES which make use of simple inorganic substances as the nutrient supply source. Heterotrophs can be either chemoheterotrophs (or chemoorganotrophs) which also require organic substances such as glucose for their primary metabolic energy requirements, or photoheterotrophs (or photoorganotrophs) which derive their primary energy requirements from light. Depending on environmental conditions some organisms can switch between different nutritional modes (AUTOTROPHY; heterotrophy; chemotrophy; or PHOTOTROPHY) to utilize different sources to meet their nutrients and energy requirements.
A group of the proteobacteria comprised of facultatively anaerobic and fermentative gram-negative bacteria.
The presence of bacteria, viruses, and fungi in water. This term is not restricted to pathogenic organisms.
One of the three domains of life (the others being BACTERIA and Eukarya), formerly called Archaebacteria under the taxon Bacteria, but now considered separate and distinct. They are characterized by: (1) the presence of characteristic tRNAs and ribosomal RNAs; (2) the absence of peptidoglycan cell walls; (3) the presence of ether-linked lipids built from branched-chain subunits; and (4) their occurrence in unusual habitats. While archaea resemble bacteria in morphology and genomic organization, they resemble eukarya in their method of genomic replication. The domain contains at least four kingdoms: CRENARCHAEOTA; EURYARCHAEOTA; NANOARCHAEOTA; and KORARCHAEOTA.
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
A set of statistical methods used to group variables or observations into strongly inter-related subgroups. In epidemiology, it may be used to analyze a closely grouped series of events or cases of disease or other health-related phenomenon with well-defined distribution patterns in relation to time or place or both.
Refuse liquid or waste matter carried off by sewers.
A family of gram-negative bacteria found primarily in the intestinal tracts and mucous membranes of warm-blooded animals. Its organisms are sometimes pathogenic.
Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.
A functional system which includes the organisms of a natural community together with their environment. (McGraw Hill Dictionary of Scientific and Technical Terms, 4th ed)
A class in the phylum PROTEOBACTERIA comprised mostly of two major phenotypes: purple non-sulfur bacteria and aerobic bacteriochlorophyll-containing bacteria.
Inland bodies of still or slowly moving FRESH WATER or salt water, larger than a pond, and supplied by RIVERS and streams.
The immediate physical zone surrounding plant roots that include the plant roots. It is an area of intense and complex biological activity involving plants, microorganisms, other soil organisms, and the soil.
The relationship between two different species of organisms that are interdependent; each gains benefits from the other or a relationship between different species where both of the organisms in question benefit from the presence of the other.
The genetic complement of a BACTERIA as represented in its DNA.
A genus of gram-negative gliding bacteria found in SOIL; HUMUS; and FRESHWATER and marine habitats.
Bacteria which retain the crystal violet stain when treated by Gram's method.
Physiological processes and properties of BACTERIA.
Tools or devices for generating products using the synthetic or chemical conversion capacity of a biological system. They can be classical fermentors, cell culture perfusion systems, or enzyme bioreactors. For production of proteins or enzymes, recombinant microorganisms such as bacteria, mammalian cells, or insect or plant cells are usually chosen.
A genus of gram-negative, aerobic, rod-shaped bacteria widely distributed in SOIL and WATER. Its organisms are also found in raw meats, MILK and other FOOD, hospital environments, and human clinical specimens. Some species are pathogenic in humans.
Liquid water present beneath the surface of the earth.
Contaminated water generated as a waste product of human activity.
A phylum of anoxygenic, phototrophic bacteria including the family Chlorobiaceae. They occur in aquatic sediments, sulfur springs, and hot springs and utilize reduced sulfur compounds instead of oxygen.
The enrichment of a terrestrial or aquatic ECOSYSTEM by the addition of nutrients, especially nitrogen and phosphorus, that results in a superabundant growth of plants, ALGAE, or other primary producers. It can be a natural process or result from human activity such as agriculture runoff or sewage pollution. In aquatic ecosystems, an increase in the algae population is termed an algal bloom.
The unconsolidated mineral or organic matter on the surface of the earth that serves as a natural medium for the growth of land plants.
The section of the alimentary canal from the STOMACH to the ANAL CANAL. It includes the LARGE INTESTINE and SMALL INTESTINE.
A group of substances similar to VITAMIN K 1 which contains a ring of 2-methyl-1,4-naphthoquinione and an isoprenoid side chain of varying number of isoprene units. In vitamin K 2, each isoprene unit contains a double bond. They are produced by bacteria including the normal intestinal flora.
Measurable quantity of bacteria in an object, organism, or organism compartment.
Any normal or abnormal coloring matter in PLANTS; ANIMALS or micro-organisms.
Degree of saltiness, which is largely the OSMOLAR CONCENTRATION of SODIUM CHLORIDE plus any other SALTS present. It is an ecological factor of considerable importance, influencing the types of organisms that live in an ENVIRONMENT.
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
Deoxyribonucleic acid that makes up the genetic material of archaea.
The simplest saturated hydrocarbon. It is a colorless, flammable gas, slightly soluble in water. It is one of the chief constituents of natural gas and is formed in the decomposition of organic matter. (Grant & Hackh's Chemical Dictionary, 5th ed)
A class in the phylum PROTEOBACTERIA comprised of chemoheterotrophs and chemoautotrophs which derive nutrients from decomposition of organic material.
A thick mass of ICE formed over large regions of land; RIVERS; LAKES; ponds; or SEAWATER.
The Arctic Ocean and the lands in it and adjacent to it. It includes Point Barrow, Alaska, most of the Franklin District in Canada, two thirds of Greenland, Svalbard, Franz Josef Land, Lapland, Novaya Zemlya, and Northern Siberia. (Webster's New Geographical Dictionary, 1988, p66)
The phylum of sponges which are sessile, suspension-feeding, multicellular animals that utilize flagellated cells called choanocytes to circulate water. Most are hermaphroditic. They are probably an early evolutionary side branch that gave rise to no other group of animals. Except for about 150 freshwater species, sponges are marine animals. They are a source of ALKALOIDS; STEROLS; and other complex molecules useful in medicine and biological research.
Movement or the ability to move from one place or another. It can refer to humans, vertebrate or invertebrate animals, and microorganisms.
Phylum of green nonsulfur bacteria including the family Chloroflexaceae, among others.
The naturally occurring transmission of genetic information between organisms, related or unrelated, circumventing parent-to-offspring transmission. Horizontal gene transfer may occur via a variety of naturally occurring processes such as GENETIC CONJUGATION; GENETIC TRANSDUCTION; and TRANSFECTION. It may result in a change of the recipient organism's genetic composition (TRANSFORMATION, GENETIC).
Worthless, damaged, defective, superfluous or effluent material from industrial operations.
The sequential correspondence of nucleotides in one nucleic acid molecule with those of another nucleic acid molecule. Sequence homology is an indication of the genetic relatedness of different organisms and gene function.
A large order of insects characterized by having the mouth parts adapted to piercing or sucking. It is comprised of four suborders: HETEROPTERA, Auchenorrhyncha, Sternorrhyncha, and Coleorrhyncha.
Free-floating minute organisms that are photosynthetic. The term is non-taxonomic and refers to a lifestyle (energy utilization and motility), rather than a particular type of organism. Most, but not all, are unicellular algae. Important groups include DIATOMS; DINOFLAGELLATES; CYANOBACTERIA; CHLOROPHYTA; HAPTOPHYTA; CRYPTOMONADS; and silicoflagellates.
The discarding or destroying of liquid waste products or their transformation into something useful or innocuous.
A type of IN SITU HYBRIDIZATION in which target sequences are stained with fluorescent dye so their location and size can be determined using fluorescence microscopy. This staining is sufficiently distinct that the hybridization signal can be seen both in metaphase spreads and in interphase nuclei.
Life or metabolic reactions occurring in an environment containing oxygen.
Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.
A rod-shaped, gram-positive, non-acid-fast, non-spore-forming, non-motile bacterium that is a genus of the family Bifidobacteriaceae, order Bifidobacteriales, class ACTINOBACTERIA. It inhabits the intestines and feces of humans as well as the human vagina.
The first stomach of ruminants. It lies on the left side of the body, occupying the whole of the left side of the abdomen and even stretching across the median plane of the body to the right side. It is capacious, divided into an upper and a lower sac, each of which has a blind sac at its posterior extremity. The rumen is lined by mucous membrane containing no digestive glands, but mucus-secreting glands are present in large numbers. Coarse, partially chewed food is stored and churned in the rumen until the animal finds circumstances convenient for rumination. When this occurs, little balls of food are regurgitated through the esophagus into the mouth, and are subjected to a second more thorough mastication, swallowed, and passed on into other parts of the compound stomach. (From Black's Veterinary Dictionary, 17th ed)
The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
A genus of aerobic, gram-negative bacteria in the family FLAVOBACTERIACEAE. Many of its species were formerly in the genus FLAVOBACTERIUM.
A large collection of DNA fragments cloned (CLONING, MOLECULAR) from a given organism, tissue, organ, or cell type. It may contain complete genomic sequences (GENOMIC LIBRARY) or complementary DNA sequences, the latter being formed from messenger RNA and lacking intron sequences.

Phylogenetic position of Chitinophaga pinensis in the Flexibacter-Bacteroides-Cytophaga phylum. (1/434)

Comparison of the 16S rRNA gene sequence determined for Chitinophaga pinensis showed that this species is most closely related to Flexibacter filiformis in the Flexibacter-Bacteroides-Cytophaga phylum. These two chitinolytic bacteria, which are characterized by transformation into spherical bodies on ageing, belong to a strongly supported lineage that also includes Cytophaga arvensicola, Flavobacterium ferrugineum and Flexibacter sancti. The lineage is distinct from the microcyst-forming species Sporocytophaga myxococcoides.  (+info)

Coenonia anatina gen. nov., sp. nov., a novel bacterium associated with respiratory disease in ducks and geese. (2/434)

Taxon 1502 was originally described as a Riemerella anatipestifer-like bacterium causing exudative septicaemia in ducks and geese. In the present study, an integrated genotypic and phenotypic approach was used to elucidate the phylogenetic affiliation and taxonomic relationships of 12 strains of taxon 1502. Whole-cell protein and fatty acid analyses and an extensive biochemical examination by using conventional tests and several API microtest systems indicated that all isolates formed a homogeneous taxon, which was confirmed by DNA-DNA hybridizations. 16S rDNA sequence analysis of a representative strain (LMG 14382T) indicated that this taxon belongs to the Cytophaga-Flavobacterium-Bacteroides phylum and revealed a moderate but distinct relationship to species of the genus Capnocytophaga (overall 16S rDNA sequence identities were 88.8-90.2%). Taxon 1502 is concluded to represent a single species that should be allocated to a novel genus, and the name Coenonia anatina gen. nov., sp. nov. is proposed. The DNA G + C content of representative strains was 35-36 mol% and the type strain is LMG 14382T.  (+info)

Physicochemical parameters for growth of the sea ice bacteria Glaciecola punicea ACAM 611(T) and Gelidibacter sp. strain IC158. (3/434)

The water activity and pH ranges for growth of Glaciecola punicea (a psychrophile) were extended when this organism was grown at suboptimal rather than optimal temperatures. No such extension was observed for Gelidibacter sp. strain IC158 (a psychrotolerant bacterium) at analogous temperatures. Salinity and pH may be primary physicochemical parameters controlling bacterial community development in sea ice.  (+info)

Dynamics of bacterial community composition and activity during a mesocosm diatom bloom. (4/434)

Bacterial community composition, enzymatic activities, and carbon dynamics were examined during diatom blooms in four 200-liter laboratory seawater mesocosms. The objective was to determine whether the dramatic shifts in growth rates and ectoenzyme activities, which are commonly observed during the course of phytoplankton blooms and their subsequent demise, could result from shifts in bacterial community composition. Nutrient enrichment of metazoan-free seawater resulted in diatom blooms dominated by a Thalassiosira sp., which peaked 9 days after enrichment ( approximately 24 microg of chlorophyll a liter(-1)). At this time bacterial abundance abruptly decreased from 2.8 x 10(6) to 0.75 x 10(6) ml(-1), and an analysis of bacterial community composition, by denaturing gradient gel electrophoresis (DGGE) of PCR-amplified 16S rRNA gene fragments, revealed the disappearance of three dominant phylotypes. Increased viral and flagellate abundances suggested that both lysis and grazing could have played a role in the observed phylotype-specific mortality. Subsequently, new phylotypes appeared and bacterial production, abundance, and enzyme activities shifted from being predominantly associated with the <1.0-microm size fraction towards the >1.0-microm size fraction, indicating a pronounced microbial colonization of particles. Sequencing of DGGE bands suggested that the observed rapid and extensive colonization of particulate matter was mainly by specialized alpha-Proteobacteria- and Cytophagales-related phylotypes. These particle-associated bacteria had high growth rates as well as high cell-specific aminopeptidase, beta-glucosidase, and lipase activities. Rate measurements as well as bacterial population dynamics were almost identical among the mesocosms indicating that the observed bacterial community dynamics were systematic and repeatable responses to the manipulated conditions.  (+info)

Increase in bacterial community diversity in subsurface aquifers receiving livestock wastewater input. (5/434)

Despite intensive studies of microbial-community diversity, the questions of which kinds of microbial populations are associated with changes in community diversity have not yet been fully solved by molecular approaches. In this study, to investigate the impact of livestock wastewater on changes in the bacterial communities in groundwater, bacterial communities in subsurface aquifers were analyzed by characterizing their 16S rDNA sequences. The similarity coefficients of restriction fragment length polymorphism (RFLP) patterns of the cloned 16S ribosomal DNAs showed that the bacterial communities in livestock wastewater samples were more closely related to those in contaminated aquifer samples. In addition, calculations of community diversity clearly showed that bacterial communities in the livestock wastewater and the contaminated aquifer were much more diverse than those in the uncontaminated aquifer. Thus, the increase in bacterial-community diversity in the contaminated aquifer was assumed to be due to the infiltration of livestock wastewater, containing high concentrations of diverse microbial flora, into the aquifer. Phylogenetic analysis of the sequences from a subset of the RFLP patterns showed that the Cytophaga-Flexibacter-Bacteroides and low-G+C gram-positive groups originating from livestock wastewater were responsible for the change in the bacterial community in groundwater. This was evidenced by the occurrence of rumen-related sequences not only in the livestock wastewater samples but also in the contaminated-groundwater samples. Rumen-related sequences, therefore, can be used as indicator sequences for fecal contamination of groundwater, particularly from livestock.  (+info)

Dyadobacter fermentans gen. nov., sp. nov., a novel gram-negative bacterium isolated from surface-sterilized Zea mays stems. (6/434)

A Gram-negative bacterium, designated NS114T, was isolated from duplicate treatments of surface-sterilized Zea mays stems. The plants were grown in synthetic soil under greenhouse conditions and watered with fertilizer containing no nitrogen. Strain NS114T could not be isolated from plants watered with the standard level or 20% (w/v) of the standard level of nitrogen. Cells occurred as pairs in young cultures that attached to form angled arrangements in R2A broth and occasionally formed rounded, horseshoe arrangements in YM broth. Cell variation resulted in flocculent chains of coccoid cells in old cultures. Strain NS114T fermented glucose and sucrose. The G + C content was 48 mol%. Phylogenetic analysis of the 16S rRNA gene showed that the strain was a member of the domain Bacteria and branched from a point equidistant from an aquatic organism, Runella slithyformis and a marine isolate, 'Microscilla furvescens'. Phenotypic and genotypic analyses indicated that strain NS114T could not be assigned to any recognized genus; therefore a new genus and species, Dyadobacter fermentans gen. nov., sp. nov., is proposed, for which NS114T is the type strain.  (+info)

Bacterial community structure associated with a dimethylsulfoniopropionate-producing North Atlantic algal bloom. (7/434)

The bacteria associated with oceanic algal blooms are acknowledged to play important roles in carbon, nitrogen, and sulfur cycling, yet little information is available on their identities or phylogenetic affiliations. Three culture-independent methods were used to characterize bacteria from a dimethylsulfoniopropionate (DMSP)-producing algal bloom in the North Atlantic. Group-specific 16S rRNA-targeted oligonucleotides, 16S ribosomal DNA (rDNA) clone libraries, and terminal restriction fragment length polymorphism analysis all indicated that the marine Roseobacter lineage was numerically important in the heterotrophic bacterial community, averaging >20% of the 16S rDNA sampled. Two other groups of heterotrophic bacteria, the SAR86 and SAR11 clades, were also shown by the three 16S rRNA-based methods to be abundant in the bloom community. In surface waters, the Roseobacter, SAR86, and SAR11 lineages together accounted for over 50% of the bacterial rDNA and showed little spatial variability in abundance despite variations in the dominant algal species. Depth profiles indicated that Roseobacter phylotype abundance decreased with depth and was positively correlated with chlorophyll a, DMSP, and total organic sulfur (dimethyl sulfide plus DMSP plus dimethyl sulfoxide) concentrations. Based on these data and previous physiological studies of cultured Roseobacter strains, we hypothesize that this lineage plays a role in cycling organic sulfur compounds produced within the bloom. Three other abundant bacterial phylotypes (representing a cyanobacterium and two members of the alpha Proteobacteria) were primarily associated with chlorophyll-rich surface waters of the bloom (0 to 50 m), while two others (representing Cytophagales and delta Proteobacteria) were primarily found in deeper waters (200 to 500 m).  (+info)

Description of Cellulophaga algicola sp. nov., isolated from the surfaces of Antarctic algae, and reclassification of Cytophaga uliginosa (ZoBell and Upham 1944) Reichenbach 1989 as Cellulophaga uliginosa comb. nov. (8/434)

A group of strains with potent extracellular enzymic activity were isolated from the surfaces of the chain-forming sea-ice diatom Melosira and from an unidentified macrophyte collected from the Eastern Antarctic coastal zone. 16S rDNA sequence analysis indicated that the strains belonged to the genus Cellulophaga and showed greatest similarity to the species Cellulophaga baltica (sequence similarity 97%). Phenotypic characteristics, DNA base composition and DNA-DNA hybridization values clearly separate the Antarctic strains from Cellulophaga baltica and other Cellulophaga species. Thus, the strains form a distinct and novel species and have the proposed name Cellulophaga algicola sp. nov. (type strain IC166T = ACAM 630T). In addition, it was recognized that the species Cytophaga uliginosa (ZoBell and Upham 1944) Reichenbach 1989, a species phylogenetically remote from the type species of the genus Cytophaga, possessed 16S rDNA sequences and phenotypic and chemotaxonomic traits similar to those of other Cellulophaga species. Thus, it was proposed that the species Cytophaga uliginosa be renamed as Cellulophaga uliginosa comb. nov.  (+info)

Glycobiology is important for the periodontal pathogen Tannerella forsythia, affecting the bacteriums cellular integrity, its life-style, and virulence potential. The bacterium possesses a unique Gram-negative cell envelope with a glycosylated surface (S-) layer as outermost decoration that is proposed to be anchored via a rough lipopolysaccharide. The S-layer glycan has the structure 4‑MeO-b-ManpNAcCONH2-(1→3)-[Pse5Am7Gc-(2→4)-]-b-ManpNAcA-(1→4)-[4-MeO-a-Galp-(1→2)-]-a-Fucp-(1→4)-[-a-Xylp-(1→3)-]-b-GlcpA-(1→3)-[-b-Digp-(1→2)-]-a-Galp and is linked to distinct serine and threonine residues within the D(S/T)(A/I/L/M/T/V) amino acid motif. Also several other Tannerella proteins are modified with the S‑layer oligosaccharide, indicating the presence of a general O‑glycosylation system. Protein O‑glycosylation impacts the life-style of T. forsythia since truncated S-layer glycans present in a defined mutant favor biofilm formation. While the S‑layer has also been shown to be a
Strain NJ-44T, isolated from sediment of the eutrophic Guanting Reservoir in Beijing (China), was subjected to a taxonomic study using a polyphasic approach. The strain was aerobic, with salmon-pink-pigmented colonies on R2A agar. Cells were single, Gram-negative rods, motile by gliding. Phylogenetic analysis based on the 16S rRNA gene sequence showed that strain NJ-44T belonged to the phylum Bacteroidetes, with Terrimonas ferruginea ATCC 13524T (90.8 % similarity), Terrimonas lutea DYT (90.5 %) and Niabella aurantiaca R2A15-11T (89.1 %) as its closest relatives. Strain NJ-44T was clearly differentiated from members of the genera Terrimonas and Niabella in its DNA G+C content (40.6 mol%) and its major fatty acids, iso-C15 : 1 G, iso-C15 : 0, anteiso-C15 : 0, iso-C16 : 0 3-OH, iso-C17 : 0 3-OH, anteiso-C15 : 1 A and iso-C15 : 0 3-OH. It is proposed that strain NJ-44T represents a novel genus and species, named Sediminibacterium salmoneum gen. nov., sp. nov. The type strain of Sediminibacterium salmoneum
Tannerella forsythia, a Gram-negative member of the Bacteroidetes has evolved to harvest and utilize sialic acid.. The most common sialic acid in humans is a mono-N-acetylated version termed Neu5Ac. Many bacteria are known to access sialic acid using sialidase enzymes. However, in humans a high proportion of sialic acid contains a second acetyl group attached via an O- group i.e. chiefly O-acetylated Neu5,9Ac2 or Neu5,4Ac2. This diacetylated sialic acid is not cleaved efficiently by many sialidases and in order to access diacetylated sialic acid, some organisms produce sialate-O-acetylesterases that catalyse removal of the second acetyl group. In this study we performed bioinformatic and biochemical characterization of a putative sialate-O-acetylesterase from T. forsythia (NanS), which contains two putative SGNH-hydrolase domains related to sialate-O-acetylesterases from a range of organisms. Purification of recombinant NanS revealed an esterase that has activity against Neu5,9Ac2 and its ...
Ubiquinone (UQ), also called coenzyme Q, and plastoquinone (PQ) are electron carriers in oxidative phosphorylation and photosynthesis, respectively. The quinoid nucleus of ubiquinone is derived from the shikimate pathway; 4-hydroxybenzoate is directly formed from chorismate in bacteria, while it can be formed from either chorismate or tyrosine in yeast. The following biosynthesis of terpenoid moiety involves reactions of prenylation, decarboxylation, and three hydroxylations alternating with three methylations. The order of these reactions are somewhat different between bacteria and yeast. Phylloquinone (vitamin K1), menaquinone (vitamin K2), and tocopherol (vitamin E) are fat-soluble vitamins. Phylloquinone is a compound present in all photosynthetic plants serving as a cofactor for photosystem I-mediated electron transport. Menaquinone is an obligatory component of the electron-transfer pathway in bacteria ...
In the gastrointestinal microbiota Bacteroidetes have a very broad metabolic potential and are regarded as one of the most stable part of gastrointestinal microflora. Reduced abundance of the Bacteroidetes in some cases is associated with obesity and irritable bowel syndrome. This bacterial group appears to be enriched in patients suffering from type 1 and type 2 diabetes.[1] Bacteroides spp. in contrast to Prevotella spp. were recently found to be enriched in the metagenomes of subjects with low gene richness that were associated with adiposity, insulin resistance and dyslipidaemia as well as an inflammatory phenotype. Bacteroidetes species that belong to classes Flavobacteriales and Sphingobacteriales are typical soil bacteria and can only occasionally detected in the gastrointestinal tract, except Capnocytophaga spp. and Sphingobacterium spp. that can be detected in the human oral cavity.[1] Bacteroidetes are not limited to gut microbiota, they colonize a variety of habitats on Earth.[4] For ...
The novel isolate belonging to the genus Terrimonas , designated CR94T, was isolated from rhizosphere soil of a ginseng field in Geumsan, Korea. Cells of strain CR94T were strictly aerobic, Gram-stain-negative, non-motile, non-filamentous single rods. Growth was observed at 10-37 °C (optimum 28 °C) and at pH 4.0-10.0 (optimum pH 6.0). Phylogenetic analyses based on 16S rRNA gene sequences indicated that strain CR94T belonged to the genus Terrimonas , showing highest sequence similarity to Terrimonas lutea DYT (97.3 %), Terrimonas pekingensis QHT (97.1 %), Terrimonas aquatica RIB1-6T (95.6 %), Terrimonas rubra M-8T (94.7 %) and Terrimonas ferruginea ATCC 13524T (93.8 %). DNA-DNA relatedness values between strain CR94T and T. lutea KACC 13047T, T. pekingensis KACC 18795T, T. ferruginea KACC 11310T and T. aquatica LMG 24825T were 30.5, 28.9, 17.8 and 13.5 %, respectively. The DNA G+C content was 46.5 mol% and the major respiratory quinone was menaquinone-7 (MK-7). The major cellular fatty
Metagenomic studies confirm that obesity is associated with a composition of gut microbiota. There are some controversies, however, about the composition of gut microbial communities in obese individuals in different populations. To examine the association between body mass index and microbiota composition in Ukrainian population, fecal concentrations of Bacteroidetes, Firmicutes, Actinobacteria and Firmicutes/Bacteroidetes (F/B) ratio were analyzed in 61 adult individuals. The relative abundance of Actinobacteria was small (5-7%) and comparable in different BMI categories. The content of Firmicutes was gradually increased while the content of Bacteroidetes was decreased with increasing body mass index (BMI). The F/B ratio also raised with increasing BMI. In an unadjusted logistic regression model, F/B ratio was significantly associated with BMI (OR = 1.23, 95% CI 1,09-1,38). This association continued to be significant after adjusting for confounders such as age, sex, tobacco smoking and physical
Microbial source tracking to distinguish between human, livestock and wildlife fecal pollution using molecular techniques is a rapidly evolving approach in many developed countries, but has not previously been applied on the African continent. DNA extracts from cow, donkey, and human fecal specimens and raw domestic sewage samples collected in Kenya were tested against five existing quantitative PCR assays designed to detect universal (2), human-specific (2), and cow-specific (1) fecal Bacteroidales genetic markers. Water samples from the River Njoro in Kenya were evaluated using the five tested Bacteroidales markers and a multi-species assay for Cryptosporidium in a preliminary exploration of fecal pollution sources and health risks in this watershed. Diagnostic sensitivity on the validation set varied from 18 to 100% for the five assays while diagnostic specificity was 100%. Of the 2 universal assays, Total Bacteroidales [Dick, L.K, Field, K.G., 2004. Rapid estimation of numbers of fecal ...
Sheridan , P O , Martin , J C , Lawley , T D , Browne , H P , Harris , H M B , Bernalier-Donadille , A , Duncan , S H , OToole , P W , Scott , K P & Flint , H J 2016 , Polysaccharide utilization loci and nutritional specialization in a dominant group of butyrate-producing human colonic Firmicutes Microbial Genomics , vol 2 , no. 2 , 43 , pp. 1-16 . DOI: 10.1099/mgen. ...
As Bacteroidetes ou bacterioidetas son un filo de bacterias composto por tres grandes clases de bacterias gramnegativas, non formadoras de esporas, anaeróbicas, e con forma de bacilos, que están amplamente distribuídas no ambiente, e que aarecen no solo, sedimentos, mares e nos intestinos e pel dos animais. Con diferenza, a clase Bacteroidia é a mellor estudada deste filo, e inclúe os xéneros Bacteroides (un organismo abundante nas feces dos animais de sangue quente, incluídos os humanos), e Porphyromonas, que habitan na cavidade bucal humana. A clase actual Bacteroidia antes foi chamada formalmente Bacteroidetes xa que ata hai pouco era a única clase do filo (nese caso coinciden os nomes do filo e a clase), pero o nome foi cambiado no cuarto volume do Bergeys Manual of Systematic Bacteriology.[1] Membros do xénero Bacteroides son patóxenos oportunistas. Os membros das outras dúas clases raramente son patóxenos para os humanos. O investigador Jeffrey Gordon e os seus colegas ...
C. atlanticus, G. forsetii, and R. biformata are marine bacteria that are thought to play important roles in the digestion of macromolecules (43-45). As with other marine bacteroidetes, these bacteria are probably enriched on surfaces such as algal cells or organic detritus particles known as marine snow, and the ability to glide over these surfaces may be important for their survival (46). R. anatipestifer is an important poultry pathogen (47), and motility may play a role in pathogenesis. P. propionicigenes, which was isolated from an anoxic rice field (48), has not been studied extensively, and the importance of gliding motility in its lifestyle is unclear.. In addition to the 22 finished genome sequences for members of the classes Flavobacteriia, Cytophagia, and Sphingobacteriia described above, draft genome sequences were available for another 27 members of these classes (see Table S3 in the supplemental material). We analyzed these and determined that all contained the 11 core gliding ...
Lineage: cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidetes; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes ...
TY - JOUR. T1 - Freezing fecal samples prior to DNA extraction affects the Firmicutes to Bacteroidetes ratio determined by downstream quantitative PCR analysis. AU - Bahl,Martin Iain. AU - Bergström,Anders. AU - Licht,Tine Rask. PY - 2012. Y1 - 2012. N2 - Freezing stool samples prior to DNA extraction and downstream analysis is widely used in metagenomic studies of the human microbiota but may affect the inferred community composition. In this study, DNA was extracted either directly or following freeze storage of three homogenized human fecal samples using three different extraction methods. No consistent differences were observed in DNA yields between extractions on fresh and frozen samples; however, differences were observed between extraction methods. Quantitative PCRanalysis was subsequently performed on all DNA samples using six different primer pairs targeting 16S rRNA genes of significant bacterial groups, and the community composition was evaluated by comparing specific ratios of the ...
Lineage: cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidetes; unclassified Bacteroidetes; unclassified Bacteroidetes (miscellaneous ...
ID A0A142HPY3_9SPHI Unreviewed; 914 AA. AC A0A142HPY3; DT 08-JUN-2016, integrated into UniProtKB/TrEMBL. DT 08-JUN-2016, sequence version 1. DT 07-JUN-2017, entry version 8. DE SubName: Full=DNA ligase {ECO:0000313,EMBL:AMR30941.1}; GN ORFNames=A0256_05625 {ECO:0000313,EMBL:AMR30941.1}; OS Mucilaginibacter sp. PAMC 26640. OC Bacteria; Bacteroidetes; Sphingobacteriia; Sphingobacteriales; OC Sphingobacteriaceae; Mucilaginibacter. OX NCBI_TaxID=1300914 {ECO:0000313,EMBL:AMR30941.1, ECO:0000313,Proteomes:UP000073092}; RN [1] {ECO:0000313,EMBL:AMR30941.1, ECO:0000313,Proteomes:UP000073092} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=PAMC 26640 {ECO:0000313,EMBL:AMR30941.1, RC ECO:0000313,Proteomes:UP000073092}; RA Park H.; RT Mucilaginibacter sp. genome sequencing.; RL Submitted (MAR-2016) to the EMBL/GenBank/DDBJ databases. CC ----------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms CC ...
Dernières PublicationsDe novo assembly of the complex genome of Nippostrongylus brasiliensis using MinION long reads. (2018) Eccles D, Chandler J, (...)
Dernières PublicationsPULDB: the expanded database of Polysaccharide Utilization Loci. (2018) Terrapon N, Lombard V, Drula E , Lapebie P, (...)
anecdotal evidence exists that Elixa is increasing populations of Lactobacilli in the gut and decreases Firmicutes/Bacteroidetes ratio that has been directly related to weight loss (elevated in obese subjects). ...
RYU, H., T. TRAN, M. W. WARE, B. Iker, S. GRIFFIN, A. EGOROV, T. Edge, N. Newmann, E. N. VILLEGAS, AND J. W. SANTO-DOMINGO. Application of leftover sample material from waterborne protozoa monitoring for the molecular detection of ,I,Bacteroidales,/I, and fecal source tracking markers. JOURNAL OF MICROBIOLOGICAL METHODS. Elsevier Science Ltd, New York, NY, 86(3):337-343, (2011 ...
SEQUENCE amino acids 424 aa >ZP_02031795.1 gi,154492169,ref,ZP_02031795.1, hypothetical protein PARMER_01801 [Parabacteroides merdae ATCC 43184 MKMRVYSLLFMMLFALSIGANAQVKFFTDVNSKQIKTLQVKVAGELISEPYIALGGEEQI EINFDGLGSGYTRYAYNVVHCNADWTQSQLSPIEYMNGFQGTTIDDFANSIGTTTQYSNY RLLLPNDDVQFKVSGNYAIQVYNEDTPDQIIFTACFSVVEPVVNISASVSGNTDIDTNQS HQQVSFNINNKNFPITYPQTDLKIFVYQDNRRDNAVTDLQPMSILENQISYTYNRNLIFP AGNEYRRMEFLSNKYNGMHVENISFHNPYYNVELMTDYRRDKGTYQYDQDQDGRFFIRCS DCNDPDTEADYYIVHFTLACDPLPDGSVYLNGELFNNVLDEKSKMGYNFETKQYEKAVLL KQGSYNYQYLFVPTGSSVGQTGPIEGNYYQTQNEYSIYVYYRPMGARYDRLIGVTTVRNE MQVF CDS cDNA 1275 bp 1 atgaaaatga gagtgtacag tttactattt atgatgcttt ttgccctttc catcggggca 60 61 aacgcacagg taaagttctt caccgatgtc aatagcaagc agataaaaac gcttcaggtg 120 121 aaagttgccg gagagttgat atccgaacct tacatagcgt tgggaggaga agagcaaatt 180 181 gaaatcaatt tcgacggttt ggggagtgga tacacacgat atgcctataa cgtggtgcat 240 241 tgcaacgccg actggacgca atcgcagttg agtccgatcg aatatatgaa tggtttccaa 300 301 ggaacaacaa tcgacgattt tgccaattcc atcgggacta ...
Salinibacter ruber ATCC ® BAA-605D-5™ Designation: Genomic DNA from Salinibacter ruber strain DSM 13855 TypeStrain=True Application:
The oral pathogen Tannerella forsythia possesses a unique surface (S-) layer with a complex O-glycan containing a bacterial sialic acid mimic in the form of either pseudaminic acid or legionaminic acid at its terminal position. We hypothesize that different T. forsythia strains employ these stereoisomeric sugar acids for interacting with the immune system and resident host tissues in the periodontium. Here, we show how T. forsythia strains ATCC 43037 and UB4, displaying pseudaminic acid and legionaminic acid, respectively, and selected cell surface mutants of these strains, modulate the immune response in monocytes and human oral keratinocytes (HOK) using a multiplex immunoassay ...
It has been known for decades that many human gut bacteria have the ability to utilize a wide variety of plant polysaccharides (PS) and animal glycans for their metabolism and growth (1, 2). The members of Bacteroides, a genus with numerous species abundant in the human colon, are especially adept at utilizing the vast array of PS and glycans that arrive to the colon from the diet or are present on the mucins overlying the epithelial layer. Early studies analyzing genes necessary for starch utilization in Bacteroides thetaiotaomicron led to the identification of the sus locus (3-6), the first characterized locus of a Bacteroides species encoding a cluster of genes necessary to utilize a complex carbohydrate. It was not until the publication of the first Bacteroides genome sequence in 2003 (7) that the vast number of these polysaccharide utilization loci (PUL), as they were named (8), was appreciated. The genome of the B. thetaiotaomicron type strain contains 88 PUL with an average of 10 genes ...
Significantly more reads were assigned to the Bacteroidetes phylum in the experimental sample (36%) as compared to the control sample (8.2%). At the class level, Bacteroidia (1.3% in the control sample vs. 24.4% in the experimental sample) and Sphingobacteria (1.1% in the control sample vs. 7.8% in the experimental sample) contributed to higher percentages of the microbiota in the experimental sample than in the control sample. The significant elevation of Bacteroidetes in the intestinal community of the starved seabass sample is in agreement with some other studies [2, 34, 35] on dietary shifts. For example, in mice [34], fasting was associated with a significant increase in the proportional representation of the Bacteroidetes [from 20.6% (fed) to 42.3% (fasted)]. Bacteroides with a much larger genome size (e.g., Bacteroides fragilis Strain NCTC9343: 5,205,140 bp) are normally mutualistic in the animal gastrointestinal flora. A large part of the proteins made by the Bacteroides genome are able ...
This study evaluated the effects of fucoidan from Acaudina molpadioides (Am-FUC) on modulation of the gut microbiota and improvement in insulin resistance in mice. Results showed that Am-FUC greatly alleviated insulin resistance and modified gut microbiota, involving Bacteroidetes and Firmicutes phylum. Am-FUC reducted serum and fecal lipopolysaccharide (LPS) concentrations and inhibited transcrip ...
The human gut microbiome is a highly diverse microbial ecosystem of approximately 400 different species, with most of the species belonging to the phylum Bacteroidetes or Firmicutes. Each person has an unique composition of bacteria, and its also clear that subsets of the population have microbiomes that look more a like, as different diets promote the growth of certain species in the gut, and some health disorders are characterized by a specific microbial profile. By now its well established that obesity is associated with an obese microbiota that is quite different than the microbiota of a lean person (1,2).. The first studies looking into the microbiota in overweight and obesity found that obese individuals have a decreased Bacteroidetes/Firmicutes ratio, but recent findings show that this isnt always the case. Also, since both good and bad bugs belong to both of these major groups of bacteria, the ratio between Bacteroidetes and Firmicutes doesnt necessarily tell us much about the ...
The human colonic microbiota is a dense ecosystem comprised of numerous microbes, including bacteria, phage, fungi, archaea, and protozoa, that compete for nutrients and space. Studies are beginning to reveal the antagonistic mechanisms that gut bacteria use to compete with other members of this ecosystem. In the healthy human colon, the majority of the Gram-negative bacteria are of the order Bacteroidales. Proteobacteria, such as Escherichia coli, are numerically fewer but confer important properties to the host, such as colonization resistance. Several enteric pathogens use type VI secretion systems (T6SSs) to antagonize symbiotic gut E. coli, facilitating colonization and disease progression. T6SS loci are also widely distributed in human gut Bacteroidales, which includes three predominant genera: Bacteroides, Parabacteroides, and Prevotella. There are three distinct genetic architectures of T6SS loci among the gut Bacteroidales, termed GA1, GA2, and GA3. GA1 and GA2 T6SS loci are contained on
Article A comparative study of culture-independent, library-independent genotypic methods of fecal source tracking. Untitled Document Culture-independent fecal source tracking methods have many potential advantages over library-depende...
Name Bench ID Date MICR3004 ==Classification== ===Higher order taxa=== Bacteria - Bacteroidetes - Bacteroidia - Bacteroidales - Porphyromonadaceae - Porphyromonas - P. gingivalis ===Species=== Species: Porphyromonas gingivalis Strain: W88 ==Description and significance== Porphyromonas gingivalis is an obligately aerobic, gram-negative bacterium belonging to the phylum Bacteroidetes. Characterised by its rod shaped morphology, it is a non-spore bearing and non-motile bacterium most commonly inhabiting the oral cavity ,sup>[[#References,[2]]],/sup>. Recognised as an opportunistic pathogen, P. gingivalis is capable of living in commensal harmony with the host ,sup>[[#References,[5]]],/sup>. Termed as a pathobiont, the bacterium causes episodes of disease when a change in the ecological balance of the periodontal microenvironment transpires ,sup>[[#References,[5]]],/sup> ,sup>[[#References,[14]]],/sup>. Although the bacterium is capable of existing as a commensal organism, ...
Members of the Bacteroidetes, formerly known as the Cytophaga-Flavobacteria-Bacteroides (CFB) phylum, are among the major taxa of marine heterotrophic bacterioplankton frequently found on macroscopic organic matter particles (marine snow). In addition, they have been shown to also represent a significant part of free-living microbial assemblages in nutrient-rich microenvironments. Their abundance and distribution pattern in combination with enzymatic activity studies has led to the notion that organisms of this group are specialists for degradation of high molecular weight compounds in both the dissolved and particulate fraction of the marine organic matter pool, implying a major role of Bacteroidetes in the marine carbon cycle. Despite their ecological importance, comprehensive molecular data on organisms of this group have been scarce so far. Here we report on the first whole genome analysis of a marine Bacteroidetes representative, Gramella forsetii KT0803. Functional analysis of the ...
additional source Nedashkovskaya, O.I., Kim, S.B., Kwon, K.K.,Shin, D.S., Xuseong, L., Kim, S.-J., and Mikhailov, V.V. Proposal of Algoriphagus vanfongensis sp. nov., transfer of members of the genera Hongiella Yi and Chun 2004 emend. Nedashkovskaya et al. 2004 and Chimaereicella Tiago et al. 2006 to the genus Algoriphagus, and emended description of the genus Algoriphagus Bowman et al. 2003 emend. Nedashkovskaya et al. 2004. Int. J. Syst. Evol. Microbiol. (2007) 57:1988-1994. [details] ...
Holmes DE, Nevin KP, Woodard TL, Peacock AD, Lovley DR. 2007. Prolixibacter bellariivorans gen. nov., sp. nov., a sugar-fermenting, psychrotolerant anaerobe of the phylum Bacteroidetes, isolated from a marine-sediment fuel cell.. Int J Syst Evol Microbiol. 57(Pt 4):701-7. ...
Holmes DE, Nevin KP, Woodard TL, Peacock AD, Lovley DR. 2007. Prolixibacter bellariivorans gen. nov., sp. nov., a sugar-fermenting, psychrotolerant anaerobe of the phylum Bacteroidetes, isolated from a marine-sediment fuel cell.. Int J Syst Evol Microbiol. 57(Pt 4):701-7. ...
Tripos muelleri infected by Amoebophrya ceratii-like. Photo: Catharina Alves-de-Souza. Green: cytoplasm of the parasite stained by FISH. Red: nuclei stained by propidium iodide. Blue: Host theca stained by calcofluor. ...
The largest group of bacteria but somewhat less diverse than the proteobacteria. Firmicutes play an important role in beer, wine, and cider spoilage and are present in greater numbers in obese individuals (vs Bacteroidetes). The group is typically divided into the Clostridia, which are anaerobic, the Bacilli, which are obligate or facultative aerobes, and the Mollicutes. It contains approximately 2475 species, 40% of which are aggregated in just 6 genera; Lactobacillus - 100 sp., Mycoplasma - 110 sp., Bacillus - 114 sp, Clostridium 146 sp and Streptomyces 509. The Firmicutes are all gram-positive bacteria unlike the Proteobacteria which are gram-negative. The Firmicutes are further divided according to their GC ratios. This is the ratio of Guanine and Cytosine to Guanine, Cytosine, Adenine and Thymine in the cell, thus a GC ratio = G+C divided by G+C+A+T times 100. Fermicutes are either High GC or Low GC. Each of these categories contains 3 major groups. ...
A novel mineral-weathering bacterium was isolated from weathered rock (potassic trachyte) surfaces collected from Nanjing (Jiangsu, PR China). Cells of strain JN246T were Gram-stain-negative, rod-shaped and non-motile. Strain JN246T was aerobic, catalase- and oxidase-positive, and grew optimally at 28 °C and pH 7.0. On the basis of 16S rRNA gene sequence analysis, strain JN246T belonged to the genus Chitinophaga and the closest phylogenetic relatives were Chitinophaga eiseniae YC6729T (98.5 % 16S rRNA gene sequence similarity), Chitinophaga terrae KP01T (96.8 %), and Chitinophaga jiangningensis JN53T (96.3 %). The major respiratory quinone was MK-7 and the major polyamine was homospermidine. The major fatty acids were iso-C15 : 0, C16 : 1ω5c, C16 : 0 and iso-C17 : 0 3-OH. The polar lipid profile of strain JN246T consisted of phosphatidylethanolamine, unknown aminolipids and unknown lipids. The genomic DNA G+C content of strain JN246T was 48.8 mol%. Based on the low level of DNA-DNA relatedness of
Article Population Dynamics, Biokinetics and Gaseous Nitrogen Production from Partial Nitrification Reactors Operated Under Oxygen Limited Conditions. Biological nitrogen removal based on partial nitrification and denitrification via nitrite is a cos...
Tannerella forsythia ATCC ® 43037D-5™ Designation: Genomic DNA from Tannerella forsythia strain FDC 338 TypeStrain=True Application:
Monoclonal antibody against Tannerella forsythia, strain FDC 331 (OMZ 348) expressed by for use in Western Blot against Tannerella forsythia
from male volunteers with hypercholesterolemia (HC) and normocholesterolemia (NC) were determined by 16S rDNA sequencing, HPLC, GC and NMR, respectively. HC subjects were characterized by having lower relative abundance of Anaeroplasma (0.002% vs 0.219%, p-value = 0.026) and Haemophilus (0.041% vs 0.078%, p-value = 0.049), and higher of Odoribacter (0.51% vs 0.16%; p-value = 0.044). Correlation analysis revealed that Anaeroplasma and Haemophilus were associated to an unfavourable lipid profile: they correlated negatively to cholesterol and triglycerides related biomarkers and the ratio total to high density lipoprotein (HDL) cholesterol, and positively to HDL size. Odoribacter displayed an opposite behaviour. Faecal SCFAs profile revealed higher abundance of isobutyric (2.76% vs 0.82%, p-value = 0.049) and isovaleric acid (1.32% vs 0.06%, p-value = 0.016) in HC. Isobutyric acid correlated positively with Odoribacter and lipid parameters indicative of an unfavourable profile. BA profile did not ...
Tenuipalpidae comprises mites that transmit viruses to agriculturally important plants. Several tenuipalpid species present parthenogenesis, and in Brevipalpus yothersi, the endosymbiont Cardinium has been associated with female-only colonies. It is unclear what the bacterial composition of B. yothersi is, and how common Cardinium is in those microbiomes. We performed a comparative analysis of the bacteriomes in three populations of B. yothersi and three additional Tetranychoidea species using sequences from V4-fragment of 16S DNA. The bacteriomes were dominated by Bacteroidetes (especially Cardinium) and Proteobacteria, showing a remarkably low alpha diversity. Cardinium was present in about 22% of all sequences; however, it was not present in R. indica and T. evansi. In B. yothersi, the proportion of Cardinium was higher in adults than eggs, suggesting that proliferation of the bacteria could be the result of selective pressures from the host. This hypothesis was further supported because colonies of
Starting around 2004, the hallmark studies of Gordon et al demonstrated a potential relationship between the gut microbiome and development of an obese phenotype. An increase in relative abundance of Firmicutes and a proportional decrease in Bacteroidetes were associated with the microbiota of obese mice,23 which was confirmed in a human dietary intervention study demonstrating that weight loss of obese individuals (body mass index, BMI,30) was accompanied by an increase in the relative abundance of Bacteroidetes.24 Nevertheless, based on most human studies, the obesity-associated decrease in the ratio of Bacteroidetes to Firmicutes (B:F) remains controversial.24 ,25 This is likely due to heterogeneity among human subjects with respect to genotype and lifestyle. Recent studies have identified diet, especially fat, as a strong modulator of the microbiota, particularly in inbred and age-standardised laboratory animals. The sources of variation in the microbiota are mainly limited to the ...
We have analyzed 5,088 bacterial 16S rRNA gene sequences from the distal intestinal (cecal) microbiota of genetically obese ob/ob mice, lean ob/+ and wild-type siblings, and their ob/+ mothers, all fed the same polysaccharide-rich diet. Although the majority of mouse gut species are unique, the mouse and human microbiota(s) are similar at the division (superkingdom) level, with Firmicutes and Bacteroidetes dominating. Microbial-community composition is inherited from mothers. However, compared with lean mice and regardless of kinship, ob/ob animals have a 50% reduction in the abundance of Bacteroidetes and a proportional increase in Firmicutes. These changes, which are division-wide, indicate that, in this model, obesity affects the diversity of the gut microbiota and suggest that intentional manipulation of community structure may be useful for regulating energy balance in obese individuals. The sequences reported in this paper have been deposited in the GenBank database [accession nos. DQ ...
Dietary supplementation of an HFD with GP led to dramatic changes in gut microbial community structure, including a reduction in the ratio of Firmicutes to Bacteroidetes and a bloom of A. muciniphila. These changes may confer some degree of protection from the negative consequences of an HFD. HFD and high-fat, high-sugar diets have repeatedly been shown to increase the proportion of Firmicutes to Bacteroidetes (36), a microbial community structure that is sufficient to induce increased host body fat upon transplantation into germ-free mouse recipients (7,42). Furthermore, administration of A. muciniphila, but not heat-killed cells, to HFD-fed mice can reduce host adiposity, inflammatory markers, and insulin resistance (43). Similarly, consumption of oligofructose by ob/ob mice deficient for the leptin gene leads to a marked increase in A. muciniphila abundance and similar metabolic improvements (44). A. muciniphila increases in abundance after gastric bypass surgery in humans (45) and mice (42); ...
Objective The early intestinal microbiota exerts important stimuli for immune development, and a reduced microbial exposure as well as caesarean section (CS) has been associated with the development of allergic disease. Here we address how microbiota development in infants is affected by mode of delivery, and relate differences in colonisation patterns to the maturation of a balanced Th1/Th2 immune response.. ...
In order to identify the origin of the fecal contamination observed in French estuaries, two library-independent microbial source tracking (MST) methods were selected: (i) Bacteroidales host-specific...
RODERIC (Repositori dObjectes Digitals per a lEnsenyament la Recerca i la Cultura) es el repositorio institucional de la Universitat de València. Se concibe como una ventanilla única para el acceso y la difusión de la producción digital de la Universitat. RODERIC responde al compromiso de la Universitat con el movimiento de acceso abierto al conocimiento adquirido con su adhesión a la Declaración de Berlín (30 Septiembre de 2008).
A new study published September 26, 2017 from Zachary A. Costliow, Patrick H. Degnan at the University of Illinois points out that all gut microbes require thiamine, (Vitamin B1). They discovered that the gut microbe Bacteroidetes can make their own … Read moreThiamine Affects Gut Bacteria. ...
We have all heard the saying you are what you eat. While there is a lot of truth to that statement, it is becoming clear that it may need to be updated to you are what you and your gut bacteria eat. Research into the function of the 100 trillion bacteria that call our gastrointestinal tract home has been exploding over the past few years. We now know that they are not merely uninvited house guests but instead play active roles in our health as well as metabolic activity effecting our digestion, immune function, hormonal function and mood.. One area of research that has received much attention is the discovery that gut bacteria have an effect on the development of obesity, metabolic syndrome and type 2 diabetes. People with higher levels of bacteria in the Firmicutes family and lower levels of bacteria in the Bacteroidetes family seem to be more likely to be obese and are at an increased risk of developing diabetes and metabolic syndrome. The increased risk of diabetes and metabolic syndrome ...
Changes in the population of Lactobacillus spp, Firmicutes and Bacteroidetes between the control and the experimental groups in chicks.Results were based on the
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
Bacteroidetes[edit]. Main article: Bacteroidetes. The Bacteroidetes (diderm Gram negative) is a member of the FBC superphylum. ... Bacteroides, Flavobacteria and relatives (later renamed Bacteroidetes *Bacteroides (Bacteroides, Fusobacterium). * ... The FCB group (now called Sphingobacteria) includes Bacteroidetes, the unplaced genus Caldithrix, Chlorobi, candidate phylum ...
Lineage( full ) cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidetes; Flavobacteriia; ...
"Bacteroidetes". List of Prokaryotic names with Standing in Nomenclature (LPSN). Retrieved 2016-03-20. Sayers; et al. " ... "Bacteroidetes". National Center for Biotechnology Information (NCBI) taxonomy database. Retrieved 2016-03-20. v t e. ...
in the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 63 (Pt 4): 1219-1228. doi: ... Cytophagales is included in the Bacteroidetes phylum. The name Cytophagales means 'cell eater', referring to the degradation of ... Subcommittee on the Taxonomy of Aerobic Bacteroidetes met to discuss taxonomic changes in 2017. Additionally, Lopez et al (2019 ... "Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes". Frontiers in Microbiology. 10: 2083 ...
within the phylum Bacteroidetes; includes a microaerobic filamentous bacterium isolated from specimens from diseased rodent ... 4 (The Bacteroidetes, Spirochaetes, Tenericutes (Mollicutes), Acidobacteria, Fibrobacteres, Fusobacteria, Dictyoglomi, ...
BAL39, within the phylum Bacteroidetes. The motif might be in the 5′ untranslated regions of operons containing genes predicted ...
Bacteroidetes, Firmicutes and Proteobacteria. Proteobacteria are dominantly present in every life stage, and Bacteroidetes are ...
Munoz, R; Rosselló-Móra, R; Amann, R (July 2016). "Revised phylogeny of Bacteroidetes and proposal of sixteen new taxa and two ... "Genome-Based Taxonomic Classification of Bacteroidetes". Frontiers in Microbiology. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC ...
The major OTUs are Bacteroidetes and Firmicutes. Common natural predators include coyotes, wolves, and mountain lions. American ...
nov., a novel member of the phylum Bacteroidetes isolated from seawater in a mussel farm". International Journal of Systematic ... nov., a member of the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 62 (Pt 9): 2213 ...
The second most common phylum is Bacteroidetes. In people with IBS, the Bacteroidetes phylum has been shown to have an overall ... Generally Bacteroidetes, Firmicutes, and Proteobacteria are increased and Actinobacteria, Bifidobacteria, and Lactobacillus are ... Individuals with IBS have been found to have decreased diversity and numbers of bacteroidetes microbiota. Preliminary research ... a decrease in bacteria belonging to the phylum Bacteroidetes, and an increase in those belonging to the phylum Firmicutes. The ...
nov., a member of the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 62 (Pt 9): 2213 ...
nov., of the phylum Bacteroidetes, isolated from compost". International Journal of Systematic and Evolutionary Microbiology. ...
The proteobacteria and bacteroidetes-cytophaga-flavobacteria dominate the community of Licancabur Lake bacteria, something that ... Typical bacterial taxa are actinobacteria, bacteroidetes and betaproteobacteria. Overall, at such high lakes only a limited ...
In this early succession stage, members of the class Flavobacteria (Bacteroidetes) are typically the dominant components of the ... "Ecology of marine Bacteroidetes: a comparative genomics approach". The ISME Journal. 7 (5): 1026-37. doi:10.1038/ismej.2012.169 ...
J.P. Euzéby: Bacteroidetes Gupta, R. S. (2004). The phylogeny and signature sequences characteristics of Fibrobacteres, ... The order Flavobacteriales is of one of the four orders from the phylum Bacteroidetes. Comparative genomic studies have ... Chlorobi, and Bacteroidetes. Critical Reviews in Microbiology. 30:123-140. doi:10.1080/10408410490435133. Gupta, R. S. and ... that are specific for the Bacteroidetes and Chlorobi species. BMC Evolutionary Biology. 7:71. doi:10.1186/1471-2148-7-71. v t e ...
Research of human microbiota show that human gut is mainly inhabited by two phyla of bacteria - Firmicutes and Bacteroidetes, ...
Bacteroidetes Class: Bacteroidia Order: Bacteroidales Family: Bacteroidaceae Genus: Bacteroides. Castellani & Chalmers 1919[1] ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Alkaliflexus derives from: New Latin noun alkali (from ...
nov., of the phylum Bacteroidetes, isolated from marine sediment". International Journal of Systematic and Evolutionary ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Adhaeribacter derives from: Latin v. adhaereo -ere, ...
... is a genus in the phylum Bacteroidetes (Bacteria). Two species have been described so far: T. agarivorans and T. ... As all members of the Bacteroidetes they are Gram negative.' They are non-flaggelate rod shaped, produced non-diffusible ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Algoriphagus derives from: Latin masculine gender noun ...
... is a genus in the phylum Bacteroidetes (Bacteria). The various species have been recovered from sea water, sea ... The Bacteroidetes, Spirochaetes, Tenericutes (Mollicutes), Acidobacteria, Fibrobacteres, Fusobacteria, Dictyoglomi, ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Cryomorpha derives from: Greek noun kruos, icy cold, ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Acetothermus derives from: Latin noun acetum, vinegar ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Croceitalea derives from: Latin adjective croceus, ...
... is a genus in the phylum Bacteroidetes (Bacteria). The name Alistipes derives from: Latin adjective alius, other; ...
A. sediminis, like other members of the phylum Bacteroidetes, is Gram-negative and its major respiratory quinone is MK-6. ... Actibacter is a genus in the phylum Bacteroidetes (Bacteria). The genus contains a single species, namely A. sediminis. ...
Bacteroidetes are not limited to gut microbiota, they colonize a variety of habitats on Earth.[4] For example, Bacteroidetes, ... Relatedness of Bacteroidetes, Chlorobi and Fibrobacteres phyla[edit]. Species from the Bacteroidetes and Chlorobi phyla branch ... Bacteroidetes species that belong to classes Flavobacteriales and Sphingobacteriales are typical soil bacteria and can only ... Gastrointestinal Bacteroidetes species produce succinic acid, acetic acid, and in some cases propionic acid, as the major end- ...
Bacteroidetes/Chlorobi group. › Bacteroidetes. › unclassified Bacteroidetes. › unclassified Bacteroidetes (miscellaneous). See ...
Bacteroidetes, a group of non-sporeforming, gram-negative, anaerobic rod-shaped bacteria; unique characteristics of ... Bacteroidetes Bacteria. Some 180 species of Bacteroidetes bacteria are non-sporeforming, Gram-negative, anaerobic rods usually ... Bacteroidetes are known to have a remarkable ability to digest and grow on a variety of complex substrates including cellulose ... Bacteroidetes found in soil are typically decomposers which contribute to the turnover of polymeric carbon. ...
Wikimedia Commons ten máis contidos multimedia na categoría: Bacteroidetes Ligazóns externas[editar , editar a fonte]. * ... "Bacteroidetes". National Center for Biotechnology Information. Consultado o 4 xullo 2012.. *↑ The All-Species Living Tree ... As Bacteroidetes ou bacterioidetas son un filo de bacterias composto por tres grandes clases de bacterias gramnegativas, non ... "Bacteroidetes". List of Prokaryotic names with Standing in Nomenclature. Arquivado dende o orixinal o 13 de xuño de 2011. ...
Genome-Based Taxonomic Classification of Bacteroidetes Journal Article Hahnke, Richard L. ; Meier-Kolthoff, Jan P. ; García- ... Genome-Based Taxonomic Classification of Bacteroidetes Journal Article Hahnke, Richard L. ; Meier-Kolthoff, Jan P. ; García- ... Published Article: Corrigendum: Genome-Based Taxonomic Classification of Bacteroidetes. Title: Corrigendum: Genome-Based ... The bacterial phylum Bacteroidetes, characterized by a distinct gliding motility, occurs in a broad variety of ecosystems, ...
Acidobacteria • Aktinobakterid • Aquificae • Bacteroidetes • Caldiserica • Chrysiogenetes • Deferribacteres • Deinococcus- ... Bacteroidetes on hõimkond anaeroobseid spoore mittemoodustavaid pulgakujulisi gramnegatiivseid baktereid, mis jagunevad kolme ... Pärit leheküljelt "https://et.wikipedia.org/w/index.php?title=Bacteroidetes&oldid=3565220" ...
PUL predictions in 67 Bacteroidetes genomes from the human gut microbiota and two additional species, from the canine oral ... A given Bacteroidetes genome can encode dozens of different PULs whose boundaries and precise gene content are difficult to ... Automatic prediction of polysaccharide utilization loci in Bacteroidetes species Bioinformatics. 2015 Mar 1;31(5):647-55. doi: ... PULs are prevalent in the Bacteroidetes phylum and are key to the digestion of complex carbohydrates, notably by the human gut ...
Moreover, Bacteroidetes genomes appear to be highly plastic and frequently reorganized through genetic rearrangements, gene ... Moreover, Bacteroidetes genomes appear to be highly plastic and frequently reorganized through genetic rearrangements, gene ... This review presents the current knowledge on the role and mechanisms of polysaccharide degradation by Bacteroidetes in their ... This review presents the current knowledge on the role and mechanisms of polysaccharide degradation by Bacteroidetes in their ...
Why Sequence Bacteroidetes?. Candidatus Amoebophilus in an amoeba host cell, visualized by fluorescence in-situ hybridization ... The highly diverse bacterial phylum Bacteroidetes contains only two major endosymbiont lineages described to date, one of them ... the genomes of these two organisms will be among the first symbiont genomes in the Bacteroidetes. Comparative genome sequence ... genome sequences will make it possible to investigate the evolution of the intracellular lifestyle within the Bacteroidetes and ...
1. The role of calcium (Ca2+) channel inactivation in the molecular mechanism of channel block by phenylalkylamines (PAAs) was… Expand ...
Do Rumen Bacteroidetes Utilize an Alternative Mechanism for Cellulose Degradation?. A. E. Naas, A. K. Mackenzie, J. Mravec, J. ... Do Rumen Bacteroidetes Utilize an Alternative Mechanism for Cellulose Degradation?. A. E. Naas, A. K. Mackenzie, J. Mravec, J. ... Do Rumen Bacteroidetes Utilize an Alternative Mechanism for Cellulose Degradation?. A. E. Naas, A. K. Mackenzie, J. Mravec, J. ... identified AC2a as a potential cellulolytic Bacteroidetes species, which challenges the current idea that Bacteroidetes drive ...
A polysaccharide utilization locus from an uncultured bacteroidetes phylotype suggests ecological adaptation and substrate ... that has been reconstructed from an uncultured Bacteroidetes phylotype (SRM-1) that dominates the rumen microbiome of Arctic ...
"Bacteroidetes" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH (Medical Subject ... This graph shows the total number of publications written about "Bacteroidetes" by people in this website by year, and whether ... Below are the most recent publications written about "Bacteroidetes" by people in Profiles. ...
Near-universal presence of gldB and gldH in members of the phylum Bacteroidetes.Two gliding motility genes, gldB and gldH, were ... The phylum Bacteroidetes is large, and its members are diverse. This study reveals the high prevalence of gliding motility and ... Gliding Motility and Por Secretion System Genes Are Widespread among Members of the Phylum Bacteroidetes. Mark J. McBride, ... HTCC2170.gldA, gldF, and gldG are required for F. johnsoniae gliding but were not found in all gliding bacteroidetes. GldA, ...
nov., a thermophilic and slightly halophilic filamentous bacterium from the phylum Bacteroidetes.. [Heike Anders, Peter F ... of the phylum Bacteroidetes, with the most closely related cultivated strain, Chitinophaga pinensis UQM 2034(T), having 87.6 % ... from all other members of the phylum Bacteroidetes and indicate that it represents a novel species in a new genus, for which ...
... and seagull Bacteroidetes. We compared fecal Bacteroidetes rRNA genes from these hosts using subtractive hybridization, a ... A Bacteroidetes rDNA marker that distinguishes elk and cow feces was identified, as well as a host-specific marker for dog ... We also developed a real time Taq nuclease assay for quantification of fecal Bacteroidetes 16S rDNA, and compared it with an ... There was a high degree of sequence overlap among the fecal Bacteroidetes of wild and domestic ruminants, and among human, ...
nov., a strictly anaerobic bacterium in the phylum Bacteroidetes isolated from a methanogenic reactor of cattle farms ... Bacteroidetes with rather low sequence similarities with the related species such as Rikenella microfusus (85.7% sequence ...
Microbial community development in a dynamic gut model is reproducible, colon region specific, and selective for Bacteroidetes ... the shift from an in vivo to an in vitro environment resulted in an increased Bacteroidetes/Firmicutes ratio, whereas ...
Here, we provide evidence that an undescribed symbiont in the Bacteroidetes group causes CI in a sexual population of the ... A bacterial symbiont in the Bacteroidetes induces cytoplasmic incompatibility in the parasitoid wasp Encarsia pergandiella. ... A bacterial symbiont in the Bacteroidetes induces cytoplasmic incompatibility in the parasitoid wasp Encarsia pergandiella. ... A bacterial symbiont in the Bacteroidetes induces cytoplasmic incompatibility in the parasitoid wasp Encarsia pergandiella ...
Prebiotic fibres dose-dependently increase satiety hormones and alter Bacteroidetes and Firmicutes in lean and obese JCR:LA-cp ... Microbial species measured in the Bacteroidetes division decreased, whereas those in the Firmicutes increased in obese v. lean ...
For phylum Bacteroidetes, 121 862 of 132 120, for phylum Firmicutes 376 912 of 406 649, for phylum Proteobacteria 336 471 of ... Increase in Bacteroidetes α-diversity over time. Distributions of Shannon diversity indices displayed for the 15 vaginally ... CS delivered infants also had a lower abundance and diversity of the Bacteroidetes phylum and were less often colonised with ... Dominant members of anaerobic Firmicutes and Bacteroidetes do not appear to grow outside the gut and hence need to be ...
CS delivered infants also had a lower abundance and diversity of the Bacteroidetes phylum and were less often colonised with ... Conclusions CS was associated with a lower total microbial diversity, delayed colonisation of the Bacteroidetes phylum and ... Decreased gut microbiota diversity, delayed Bacteroidetes colonisation and reduced Th1 responses in infants delivered by ... Decreased gut microbiota diversity, delayed Bacteroidetes colonisation and reduced Th1 responses in infants delivered by ...
... altered the composition of the gut microbiota by increasing Firmicutes and Lactobacillus and decreasing Bacteroidetes.. ... altered the composition of the gut microbiota by increasing Firmicutes and Lactobacillus and decreasing Bacteroidetes.. ... altered the composition of the gut microbiota by increasing Firmicutes and Lactobacillus and decreasing Bacteroidetes. ...
... but there was a decreased proportion of Bacteroidetes in marasmus (culturomics, Marasmus 0.8%, Kwashiorkor 6.5%, p = 0.001; ... Gut Microbiota Alteration is Characterized by a Proteobacteria and Fusobacteria Bloom in Kwashiorkor and a Bacteroidetes ... Gut Microbiota Alteration is Characterized by a Proteobacteria and Fusobacteria Bloom in Kwashiorkor and a Bacteroidetes ...
Microbial community development in a dynamic gut model is reproducible, colon region specific, and selective for Bacteroidetes ... and selective for Bacteroidetes and Clostridium cluster IX. APPLIED AND ENVIRONMENTAL MICROBIOLOGY, 76(15), 5237-5246. ... and Selective for Bacteroidetes and Clostridium Cluster IX." APPLIED AND ENVIRONMENTAL MICROBIOLOGY 76.15 (2010): 5237-5246. ... and Selective for Bacteroidetes and Clostridium Cluster IX." Applied and Environmental Microbiology 76 (15): 5237-5246. ...
In seven of nine cases, the Firmicutes to Bacteroidetes 16S rRNA gene ratio was significantly higher in fecal samples that had ... In seven of nine cases, the Firmicutes to Bacteroidetes 16S rRNA gene ratio was significantly higher in fecal samples that had ... In seven of nine cases, the Firmicutes to Bacteroidetes 16S rRNA gene ratio was significantly higher in fecal samples that had ... title = "Freezing fecal samples prior to DNA extraction affects the Firmicutes to Bacteroidetes ratio determined by downstream ...
In this work, we began with an example from the class Bacteroidia in the phylum Bacteroidetes, which is preponderant among ... BCC were generally dominated by members of Actinobacteria, Proteobacteria, and Bacteroidetes covering about 95% of all ... Twenty-seven bacterial phyla were found in the GIT, with Firmicutes, Verrucomicrobia and Bacteroidetes predominating... ... such as the Bacteroidetes in the mammalian gut. To date, a role for bacterial sphingolipids in immune system maturation has ...
Alpha- and beta-mannan utilization by marine Bacteroidetes.. Authors: Chen, Jing and Robb, Craig S and Unfried, Frank and ... They provide organic substrates for marine microbes such as members of the Bacteroidetes that degrade algal polysaccharides ... We investigated four marine Bacteroidetes isolated from the southern North Sea that harbour putative mannan-specific PULs. ... defined growth experiments with polysaccharides as sole carbon sources we could show that the investigated marine Bacteroidetes ...
... is a diverse group of bacteria common in human gut, in marine and freshwater systems. Their levels rise as body ... Bacteroidetes in the gut are responsible for degradation of high molecular weight organic matter, i.e., proteins and ... Many Bacteroidetes, especially Bacteroides are opportunistic pathogens. The figure shows predominant sites colonized by ...
  • The phylum Bacteroidetes is composed of three large classes of Gram-negative , nonsporeforming, anaerobic or aerobic, and rod-shaped bacteria that are widely distributed in the environment, including in soil, sediments, and sea water, as well as in the guts and on the skin of animals. (wikipedia.org)
  • The bacterial phylum Bacteroidetes, characterized by a distinct gliding motility, occurs in a broad variety of ecosystems, habitats, life styles, and physiologies. (osti.gov)
  • PULs are prevalent in the Bacteroidetes phylum and are key to the digestion of complex carbohydrates, notably by the human gut microbiota. (nih.gov)
  • Members of the diverse bacterial phylum Bacteroidetes have colonized virtually all types of habitats on Earth. (frontiersin.org)
  • The phylum Bacteroidetes is a very diverse bacterial phylum, the name of which changed several times over the past years. (frontiersin.org)
  • Members of the phylum Bacteroidetes have colonized many different ecological niches, including soil, ocean, freshwater, and the gastrointestinal tract (GIT) of animals, where they display various biological functions. (frontiersin.org)
  • The phylum Bacteroidetes is large and diverse, with rapid gliding motility and the ability to digest macromolecules associated with many genera and species. (asm.org)
  • Comparative analysis of 37 genomes of members of the phylum Bacteroidetes revealed the widespread occurrence of gliding motility genes and PorSS genes. (asm.org)
  • Cells of Flavobacterium johnsoniae , and of many other members of the phylum Bacteroidetes , crawl rapidly over surfaces by a process known as gliding motility ( 1 ). (asm.org)
  • nov., a thermophilic and slightly halophilic filamentous bacterium from the phylum Bacteroidetes. (sigmaaldrich.com)
  • On the basis of 16S rRNA gene sequence similarity, strain P373(T) was shown to belong to the family Chitinophagaceae (class Sphingobacteriia) of the phylum Bacteroidetes, with the most closely related cultivated strain, Chitinophaga pinensis UQM 2034(T), having 87.6 % sequence similarity. (sigmaaldrich.com)
  • The distinct phylogenetic position and the phenotypic characteristics separate strain P373(T) from all other members of the phylum Bacteroidetes and indicate that it represents a novel species in a new genus, for which the name Thermoflavifilum aggregans gen. nov., sp. (sigmaaldrich.com)
  • Phylogenetic analysis based on the 16S rRNA gene sequence placed strain WN081 T in the phylum Bacteroidetes with rather low sequence similarities with the related species such as Rikenella microfusus (85.7% sequence similarity), Alistipes putredinis (85.5%) and Alistipes finegoldii (85.5%) in the family Rikenellaceae . (go.jp)
  • CS delivered infants also had a lower abundance and diversity of the Bacteroidetes phylum and were less often colonised with the Bacteroidetes phylum. (bmj.com)
  • Conclusions CS was associated with a lower total microbial diversity, delayed colonisation of the Bacteroidetes phylum and reduced Th1 responses during the first 2 years of life. (bmj.com)
  • The diversity of the Bacteroidetes phylum is lower in CS born infants during the first 2 years of life. (bmj.com)
  • To date, the phylum Bacteroidetes comprises more than 1,500 described species with diverse ecological roles. (usda.gov)
  • Comparative genomic analysis has led to the identification of 27 proteins which are present in most species of the phylum Bacteroidetes. (worldheritage.org)
  • this three-amino-acid deletion in ClpB chaperone is present in all species of the Bacteroidetes phylum except S. ruber . (worldheritage.org)
  • The Bacteroidetes data from the recent Turnbaugh study were examined to determine those members of the phylum detected in human faecal samples. (westminster.ac.uk)
  • When this phylum of bacteria is in a higher proportional ratio to Bacteroidetes, it has been shown to create a dysbacteriosis of the gut. (eatrightdenver.org)
  • Results showed that Am-FUC greatly alleviated insulin resistance and modified gut microbiota, involving Bacteroidetes and Firmicutes phylum. (usda.gov)
  • The phylum Bacteroidetes covers phenotypically diverse groups of Gram negative rods that do not form endospores, and currently includes 6 classes, 6 orders, 33 families and 380 genera. (koreascience.or.kr)
  • 2018. A report of 17 unrecorded bacterial species of Korea belonging to the phylum Bacteroidetes. (koreascience.or.kr)
  • 2018. A report of 28 unrecorded bacterial species, phylum Bacteroidetes, in Korea. (koreascience.or.kr)
  • Some 180 species of Bacteroidetes bacteria are non-sporeforming, Gram-negative, anaerobic rods usually found in soil and sediments. (gopetsamerica.com)
  • Bacteroidetes is a diverse group of bacteria common in human gut, in marine and freshwater systems. (aurametrix.com)
  • [2] The sharing of these three proteins is significant because other than them, no proteins from either the Bacteroidetes or Chlorobi phyla are shared by any other groups of bacteria. (worldheritage.org)
  • In a similar breakdown to human biota, ~90% of the bacteria were in the two mentioned phyla - Firmicutes and Bacteroidetes. (eatrightdenver.org)
  • Firmicutes, it seems, are more adept at liberating calories from food than are bacteria from the other common lineage, Bacteroidetes. (newsweek.com)
  • People harbor bacteria from these same two lineages, with the obese among us having more Firmicutes and fewer Bacteroidetes than slim people, exactly as in fat and lean mice. (newsweek.com)
  • [4] For example, Bacteroidetes , together with Proteobacteria , Firmicutes and Actinobacteria , are also among the most abundant bacterial groups in rhizosphere . (wikipedia.org)
  • All communities were highly diverse and dominated by the phyla Firmicutes, Bacteroidetes, Tenericutes, Actinobacteria and Proteobacteria. (wiley.com)
  • To examine the association between body mass index and microbiota composition in Ukrainian population, fecal concentrations of Bacteroidetes , Firmicutes , Actinobacteria and Firmicutes/Bacteroidetes (F/B) ratio were analyzed in 61 adult individuals. (beds.ac.uk)
  • However, these primers often fail to detect nosZ in non-Proteobacteria strains, including Firmicutes (Gram-positive) and Bacteroidetes. (elsevier.com)
  • Our data showed that only Bacteroidetes-related nosZ sequences were amplified, whereas conventional Proteobacteria-based primers amplified only Proteobacteria-related nosZ. (elsevier.com)
  • Many Bacteroidetes, especially Bacteroides are opportunistic pathogens. (aurametrix.com)
  • Of these, one protein is found in all sequenced Bacteroidetes species, while two other proteins are found in all sequenced species with the exception of those from the genus Bacteroides . (worldheritage.org)
  • Germ-free mice were then colonized with E. rectale and/or a prominent human gut Bacteroidetes, Bacteroides thetaiotaomicron , followed by whole-genome transcriptional profiling, high-resolution proteomic analysis, and biochemical assays of microbial-microbial and microbial-host interactions. (pnas.org)
  • Bacteroides melaninogenicus foi reclasificado recentemente e dividido en Prevotella melaninogenica e Prevotella intermedia . (wikipedia.org)
  • En xeral, os Bacteroides son resistentes a unha ampla gama de antibióticos β-lactámicos, aminoglicósidos , e recentemente moitas especies adquiriron resistencia á eritromicina e á tetraciclina . (wikipedia.org)
  • Here we use a large collection of type-strain genomes from Bacteroidetes and closely related phyla for assessing their taxonomy based on the principles of phylogenetic classification and trees inferred from genome-scale data. (osti.gov)
  • PUL predictions in 67 Bacteroidetes genomes from the human gut microbiota and two additional species, from the canine oral sphere and from the environment, are presented in our database accessible at www.cazy.org/PULDB/index.php. (nih.gov)
  • The recent sequencing of Bacteroidetes genomes confirms the presence of numerous carbohydrate-active enzymes covering a large spectrum of substrates from plant, algal, and animal origin. (frontiersin.org)
  • Moreover, Bacteroidetes genomes appear to be highly plastic and frequently reorganized through genetic rearrangements, gene duplications and lateral gene transfers (LGT), a feature that could have driven their adaptation to distinct ecological niches. (frontiersin.org)
  • We compared fecal Bacteroidetes rRNA genes from these hosts using subtractive hybridization, a method that identifies differences between closely related genomes or gene sequences. (oregonstate.edu)
  • A further eight proteins have been identified which are present in all sequenced Bacteroidetes genomes except Salinibacter ruber . (worldheritage.org)
  • Comparison of these and 25 other gut Firmicutes and Bacteroidetes indicated that the Firmicutes possess smaller genomes and a disproportionately smaller number of glycan-degrading enzymes. (pnas.org)
  • Species from the Bacteroidetes and Chlorobi phyla branch very closely together in phylogenetic trees, indicating a close relationship. (worldheritage.org)
  • Through the use of comparative genomic analysis, three proteins have been identified which are uniquely shared by virtually all members of the Bacteroidetes and Chlorobi phyla. (worldheritage.org)
  • The adult human distal gut microbial community is typically dominated by 2 bacterial phyla (divisions), the Firmicutes and the Bacteroidetes. (pnas.org)
  • Two bacterial phyla, the Firmicutes and the Bacteroidetes, commonly dominate this ecosystem ( 1 ), as they do in the guts of at least 60 mammalian species ( 2 ). (pnas.org)
  • Recent large-scale cloning studies have shown that the ratio of Bacteroidetes to Firmicutes may be important in the obesity-associated gut microbiota, but the species these phyla represent in this ecosystem has not been examined. (westminster.ac.uk)
  • Studies show that once you have established whom the ALPHA bacterial phyla is, which is dictated through early childhood development and dietary intake, how you retain caloric density gets sorted one way or another by the Bacteroidetes or Firmicutes. (eatrightdenver.org)
  • Data obtained from animal models revealed consistent differences in the two major bacterial phyla with significant increase of the Firmicutes and decrease of the Bacteroidetes levels in ob/ob compared to wild-type mice despite a similarity in their diet and activity levels [ 15 ]. (beds.ac.uk)
  • 2018. A report of 22 unrecorded bacterial species in Korea in the phyla Bacteroidetes and Rhodothermaeota. (koreascience.or.kr)
  • The main result was the identification of DNA barcodes targeting the Firmicutes and Bacteroidetes phyla. (biomedcentral.com)
  • can be opportunistic pathogens , many Bacteroidetes are symbiotic species highly adjusted to the gastrointestinal tract. (wikipedia.org)
  • Gastrointestinal Bacteroidetes species produce succinic acid , acetic acid , and in some cases propionic acid , as the major end-products. (wikipedia.org)
  • The Bacteroidetes species also play an important role in protein metabolism by proteolytic activity assigned to the proteases linked to the cell. (wikipedia.org)
  • A more complete understanding of the genetic gateways between food-associated environmental species and intestinal microbial communities sheds new light on the origin and evolution of Bacteroidetes as animals' symbionts. (frontiersin.org)
  • Based on these findings, we propose a further expansion of the PUL paradigm and the saccharolytic capacity of rumen Bacteroidetes species to include cellulose, the most abundant terrestrial polysaccharide on Earth. (asm.org)
  • The saccharolytic machineries of gastrointestinal Bacteroidetes species have thus far been attributed to polysaccharide utilization loci (PULs), gene clusters that encode cell envelope-associated enzyme systems that enable the bacterium to respond to, bind, and degrade specific glycans and import released oligosaccharides ( 5 ). (asm.org)
  • Microbial species measured in the Bacteroidetes division decreased, whereas those in the Firmicutes increased in obese v. lean rats and improved with prebiotic intake. (nih.gov)
  • In the obese mice, there was a 50% higher abundance of the Firmicutes species over Bacteroidetes and the inverse held true in the lean mice. (eatrightdenver.org)
  • During a series of extensive surveys of prokaryotic species diversity in Korea, bacterial strains belonging to Bacteroidetes were isolated from various sources of aquatic and terrestrial environments. (koreascience.or.kr)
  • In the gastrointestinal microbiota Bacteroidetes have a very broad metabolic potential and are regarded as one of the most stable part of gastrointestinal microflora. (wikipedia.org)
  • Bacteroidetes are not limited to gut microbiota, they colonize a variety of habitats on Earth. (wikipedia.org)
  • Piceatannol altered the composition of the gut microbiota by increasing Firmicutes and Lactobacillus and decreasing Bacteroidetes. (liquid-nutrition-vitamins.com)
  • What do we mean when we refer to Bacteroidetes populations in the human gastrointestinal microbiota? (westminster.ac.uk)
  • Specific changes in their gut microbiota such as decreased microbial diversity and increased Firmicutes to Bacteroidetes ratio have been suggested to contribute to obesity via increased microbiota capacity to harvest energy. (springer.com)
  • Recent studies of 16S rRNA genes in the mammalian gut microbiota distinguished a higher Firmicutes / Bacteroidetes ratio in obese individuals compared to lean individuals. (biomedcentral.com)
  • Here we present a cost-effective method that combines 16S rRNA pyrosequencing and DNA barcodes of the Firmicutes and Bacteroidetes 16S rRNA genes to determine the Firmicutes/Bacteroidetes ratio in the gut microbiota of obese humans. (biomedcentral.com)
  • OS Bacteroidetes bacterium MedPE-SWsnd-G2. (genome.jp)
  • OS Bacteroidetes bacterium oral taxon 272 str. (genome.jp)
  • Importantly, the shift from an in vivo to an in vitro environment resulted in an increased Bacteroidetes/Firmicutes ratio, whereas Clostridium cluster IX (propionate producers) was enriched compared to clusters IV and XIVa (butyrate producers). (wur.nl)
  • Bahl, MI , Bergström, A & Licht, TR 2012, ' Freezing fecal samples prior to DNA extraction affects the Firmicutes to Bacteroidetes ratio determined by downstream quantitative PCR analysis ' F E M S Microbiology Letters , vol 329, no. 2, pp. 193-197. (dtu.dk)
  • In seven of nine cases, the Firmicutes to Bacteroidetes 16S rRNA gene ratio was significantly higher in fecal samples that had been frozen compared to identical samples that had not. (dtu.dk)
  • The results demonstratethat storage conditions of fecal samples may adversely affect the determined Firmicutes to Bacteroidetes ratio, which is a frequently used biomarker in gut microbiology. (dtu.dk)
  • Effect of the Firmicutes:Bacteroidetes ratio on (A) daily gain, (B) feed conversion and (C) feed intake. (genetics.org)
  • In humans, the ratio of Firmicutes to Bacteroidetes (F/B ratio) was found to be significantly higher in obese individuals than in lean individuals. (biomedcentral.com)
  • Building on previous work to discriminate ruminant and human fecal contamination, we cloned class Bacteroidetes 16S rRNA genes from pig, elk, dog, cat, and seagull fecal DNAs. (oregonstate.edu)
  • Two XI genes were isolated from the environmental metagenome and they were clustered with XIs from environmental Bacteroidetes group. (biomedcentral.com)
  • Comparative analysis of 5 previously sequenced human gut Bacteroidetes revealed that each genome contains a large repertoire of genes involved in acquisition and metabolism of polysaccharides. (pnas.org)
  • Using DNA barcodes of Bacteroidetes and Firmicutes 16S rRNA genes combined with pyrosequencing is a cost-effective method for monitoring relevant changes in the relative abundance of Firmicutes and Bacteroidetes bacterial communities in microbial ecosystems. (biomedcentral.com)
  • Bacteroidetes on hõimkond anaeroobseid spoore mittemoodustavaid pulgakujulisi gramnegatiivseid baktereid , mis jagunevad kolme klassi ( Bacteroidia , Flavobacteria ja Sphingobacteria ). (wikipedia.org)
  • There was a high degree of sequence overlap among the fecal Bacteroidetes of wild and domestic ruminants, and among human, domestic pet, and seagull Bacteroidetes. (oregonstate.edu)
  • A Bacteroidetes rDNA marker that distinguishes elk and cow feces was identified, as well as a host-specific marker for dog fecal Bacteroidetes. (oregonstate.edu)
  • We also developed a real time Taq nuclease assay for quantification of fecal Bacteroidetes 16S rDNA, and compared it with an EPA-approved enumeration method for the current standard public health indicator, Escherichia coli, in serial dilutions of sewage primary influent. (oregonstate.edu)
  • PCR source identification and enumeration of fecal Bacteroidetes 16S rDNA show promise for application in a health risk-based analysis of fecal pollution. (oregonstate.edu)
  • The obtained data indicate that obese persons in Ukraine adult population have a significantly higher level of Firmicutes and lower level of Bacteroidetes compared to normal-weight and lean adults. (beds.ac.uk)
  • When Gordon's team had 12 obese people follow either a low-fat or a low-carb diet to lose weight, the result was more Bacteroidetes and fewer Firmicutes-the profile of slim people. (newsweek.com)
  • A clase actual Bacteroidia antes foi chamada formalmente Bacteroidetes xa que ata hai pouco era a única clase do filo (nese caso coinciden os nomes do filo e a clase), pero o nome foi cambiado no cuarto volume do Bergey's Manual of Systematic Bacteriology . (wikipedia.org)
  • A polysaccharide utilization locus from an uncultured bacteroidetes phylotype suggests ecological adaptation and substrate versatility. (sigmaaldrich.com)
  • Here we investigate the saccharolytic capabilities of a polysaccharide utilization locus (PUL) that has been reconstructed from an uncultured Bacteroidetes phylotype (SRM-1) that dominates the rumen microbiome of Arctic reindeer. (sigmaaldrich.com)
  • Alpha- and beta-mannan utilization by marine Bacteroidetes. (pacb.com)
  • [4] Halophilic Bacteroidetes genus Salinibacter inhabit hypersaline environments such as salt-saturated brines in hypersaline lakes. (wikipedia.org)
  • In these contrasting ecological niches, Bacteroidetes are increasingly regarded as specialists for the degradation of high molecular weight organic matter, i.e., proteins and carbohydrates. (frontiersin.org)
  • This review presents the current knowledge on the role and mechanisms of polysaccharide degradation by Bacteroidetes in their respective habitats. (frontiersin.org)
  • Do Rumen Bacteroidetes Utilize an Alternative Mechanism for Cellulose Degradation? (asm.org)
  • Uncultured and therefore uncharacterized Bacteroidetes lineages are ubiquitous in many natural ecosystems which specialize in lignocellulose degradation. (asm.org)
  • Bacteroidetes in the gut are responsible for degradation of high molecular weight organic matter, i.e., proteins and carbohydrates. (aurametrix.com)
  • We have interrogated a reconstructed genome from an uncultured Bacteroidetes phylotype that dominates a switchgrass-associated community within the cow rumen. (asm.org)
  • This study demonstrated that XIs clustered in the mammal gut Bacteroidetes group were able to be expressed functionally in S. cerevisiae and background strain anaerobic adaptive evolution in xylose medium is essential for the screening of functional XIs. (biomedcentral.com)
  • Members of Bacteroidetes can be aerobic and anaerobic heterotrophs, hydrogen utilizing chemolithotrophs, or methylotrophs. (koreascience.or.kr)
  • Bacteroidetes found in soil are typically decomposers which contribute to the turnover of polymeric carbon. (gopetsamerica.com)
  • Specifically, the bacterial group Bacteroidetes increased while the group Clostridiales decreased. (pkbond.com)
  • Whereas most observed conflict with the current classification of Bacteroidetes is already visible in 16S rRNA gene trees, as expected whole-genome phylogenies are much better resolved. (osti.gov)
  • A given Bacteroidetes genome can encode dozens of different PULs whose boundaries and precise gene content are difficult to predict. (nih.gov)
  • Phylogenetic analysis of deposited XI sequences showed that XI evolutionary relationship was highly consistent with the bacterial taxonomic orders and quite a few functional XIs in S. cerevisiae were clustered with XIs from mammal gut Bacteroidetes group. (biomedcentral.com)
  • After DNA sequencing, phylogenetic analysis identified many new nosZ sequences with high levels of homology to nosZ from Bacteroidetes, probably because of the high sequence similarity of nosZ from Firmicutes and Bacteroidetes, and a predominance of Bacteroidetes in feedlot environments. (elsevier.com)
  • However, their metabolic contribution remains mysterious, as well-studied cultured Bacteroidetes have been shown to degrade only soluble polysaccharides within the human distal gut and herbivore rumen. (asm.org)
  • Relative abundance of the most abundant genera of the Bacteroidetes (first heatmap row) and Firmicutes groups (second heatmap row). (genetics.org)
  • vii This means, the more plant sources of food we consume the greater the amount of Bacteroidetes that make it into our bodies and the better we can utilize nutrients from these types of foods. (eatrightdenver.org)
  • Firmicutes can digest complex sugars that neither the mice's own enzymes nor Bacteroidetes can, breaking them into simple sugars and fatty acids that the mice's intestines then absorb and turn into more mouse. (newsweek.com)
  • Reduced abundance of the Bacteroidetes in some cases is associated with obesity and irritable bowel syndrome . (wikipedia.org)
  • Bacteroidetes Probiotic Strains Defense Lactose Advantage - Digestive there are millions of candida micro-organisms increases over another within the body. (insightmarketing.eu)
  • O investigador Jeffrey Gordon e os seus colegas descubriron que os homes e os rtos obesos tiñan unha flora intestinal cunha baixa porcentaxe de Bacteroidetes e relativamente maior cantidade de bacterias do grupo Firmicutes . (wikipedia.org)
  • Porén, non están seguros se os Bacteroidetes preveñen a obesidade ou se esta flora intestinal é simplemente seleccionada preferencialmente nas condicións intestinais dos que non están obesos. (wikipedia.org)