AnatomyOrganismsChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsTechnology, Industry, AgricultureInformation ScienceHealth CareGeographicals
BacteroidetesRNA, Ribosomal, 16SMetagenomeBacteriaProteobacteriaPhylogenyDNA, RibosomalBiodiversityCytophagaceaeDNA, BacterialSequence Analysis, DNAFusobacteriaGastrointestinal TractBiotaSeawaterMicrobiotaGenes, rRNADenaturing Gradient Gel ElectrophoresisAcidobacteriaGeologic SedimentsVerrucomicrobiaMicrobial ConsortiaPrevotellaMolecular Sequence DataBacteroidesBase CompositionSoil MicrobiologyActinobacteriaMethanobrevibacterRNA, BacterialMetagenomicsFlexibacterFecesPlanktonMediterranean SeaFlavobacteriaceaeFresh WaterHeterotrophic ProcessesGammaproteobacteriaWater MicrobiologyArchaeaFatty AcidsCluster AnalysisSewageBacteroidaceaeBacterial Typing TechniquesEcosystemAlphaproteobacteriaLakesRhizosphereSymbiosisGenome, BacterialCytophagaGram-Positive BacteriaBacterial Physiological PhenomenaBioreactorsNorth SeaFlavobacteriumGroundwaterWaste WaterChlorobiEutrophicationSoilIntestinesVitamin K 2Bacterial LoadPigments, BiologicalSalinitySpecies SpecificityDNA, ArchaealMethaneBetaproteobacteriaIce CoverArctic RegionsPoriferaLocomotionChloroflexiGene Transfer, HorizontalIndustrial WasteSequence Homology, Nucleic AcidHemipteraPhytoplanktonBacteria, AnaerobicWaste Disposal, FluidIn Situ Hybridization, FluorescenceAerobiosisCarbohydrate MetabolismBifidobacteriumRumenAnaerobiosisPolymerase Chain ReactionChryseobacteriumGene Library
Bacteroidetes
A phylum of bacteria comprised of three classes: Bacteroides, Flavobacteria, and Sphingobacteria.
RNA, Ribosomal, 16S
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
Metagenome
A collective genome representative of the many organisms, primarily microorganisms, existing in a community.
Bacteria
One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.
Proteobacteria
A phylum of bacteria consisting of the purple bacteria and their relatives which form a branch of the eubacterial tree. This group of predominantly gram-negative bacteria is classified based on homology of equivalent nucleotide sequences of 16S ribosomal RNA or by hybridization of ribosomal RNA or DNA with 16S and 23S ribosomal RNA.
Phylogeny
The relationships of groups of organisms as reflected by their genetic makeup.
DNA, Ribosomal
DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.
Biodiversity
The variety of all native living organisms and their various forms and interrelationships.
Cytophagaceae
A family of gram-negative, gliding bacteria in the order Cytophagales, class Cytophagia. They are found in SOIL and SEA WATER.
DNA, Bacterial
Deoxyribonucleic acid that makes up the genetic material of bacteria.
Sequence Analysis, DNA
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
Fusobacteria
A phylum of anaerobic, gram-negative bacteria with a chemoorganotrophic heterotrophic metabolism. They are resident flora of the OROPHARYNX.
Gastrointestinal Tract
Generally refers to the digestive structures stretching from the MOUTH to ANUS, but does not include the accessory glandular organs (LIVER; BILIARY TRACT; PANCREAS).
Biota
The spectrum of different living organisms inhabiting a particular region, habitat, or biotope.
Seawater
The salinated water of OCEANS AND SEAS that provides habitat for marine organisms.
Microbiota
The full collection of microbes (bacteria, fungi, virus, etc.) that naturally exist within a particular biological niche such as an organism, soil, a body of water, etc.
Genes, rRNA
Genes, found in both prokaryotes and eukaryotes, which are transcribed to produce the RNA which is incorporated into RIBOSOMES. Prokaryotic rRNA genes are usually found in OPERONS dispersed throughout the GENOME, whereas eukaryotic rRNA genes are clustered, multicistronic transcriptional units.
Denaturing Gradient Gel Electrophoresis
Electrophoresis in which various denaturant gradients are used to induce nucleic acids to melt at various stages resulting in separation of molecules based on small sequence differences including SNPs. The denaturants used include heat, formamide, and urea.
Acidobacteria
A physiologically diverse phylum of acidophilic, gram-negative bacteria found in a wide variety of habitats, but particularly abundant in soils and sediments.
Geologic Sediments
A mass of organic or inorganic solid fragmented material, or the solid fragment itself, that comes from the weathering of rock and is carried by, suspended in, or dropped by air, water, or ice. It refers also to a mass that is accumulated by any other natural agent and that forms in layers on the earth's surface, such as sand, gravel, silt, mud, fill, or loess. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed, p1689)
Verrucomicrobia
A phylum of gram-negative bacteria containing seven class-level groups from a wide variety of environments. Most members are chemoheterotrophs.
Microbial Consortia
A group of different species of microorganisms that act together as a community.
Prevotella
A genus of gram-negative, anaerobic, nonsporeforming, nonmotile rods. Organisms of this genus had originally been classified as members of the BACTEROIDES genus but overwhelming biochemical and chemical findings in 1990 indicated the need to separate them from other Bacteroides species, and hence, this new genus was established.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Bacteroides
A genus of gram-negative, anaerobic, rod-shaped bacteria. Its organisms are normal inhabitants of the oral, respiratory, intestinal, and urogenital cavities of humans, animals, and insects. Some species may be pathogenic.
Base Composition
The relative amounts of the PURINES and PYRIMIDINES in a nucleic acid.
Soil Microbiology
The presence of bacteria, viruses, and fungi in the soil. This term is not restricted to pathogenic organisms.
Actinobacteria
Class of BACTERIA with diverse morphological properties. Strains of Actinobacteria show greater than 80% 16S rDNA/rRNA sequence similarity among each other and also the presence of certain signature nucleotides. (Stackebrandt E. et al, Int. J. Syst. Bacteriol. (1997) 47:479-491)
Methanobrevibacter
A genus of gram-positive, anaerobic, cocci to short rod-shaped ARCHAEA, in the family METHANOBACTERIACEAE, order METHANOBACTERIALES. They are found in the GASTROINTESTINAL TRACT or other anoxic environments.
RNA, Bacterial
Ribonucleic acid in bacteria having regulatory and catalytic roles as well as involvement in protein synthesis.
Metagenomics
The genomic analysis of assemblages of organisms.
Flexibacter
A genus of gram-negative, chemoorganotrophic bacteria in the family CYTOPHAGACEAE. In some species there is a cyclic change in cell morphology.
Feces
Excrement from the INTESTINES, containing unabsorbed solids, waste products, secretions, and BACTERIA of the DIGESTIVE SYSTEM.
Plankton
Community of tiny aquatic PLANTS and ANIMALS, and photosynthetic BACTERIA, that are either free-floating or suspended in the water, with little or no power of locomotion. They are divided into PHYTOPLANKTON and ZOOPLANKTON.
Mediterranean Sea
Flavobacteriaceae
A family of bacteria in the order Sphingobacteriales, class Sphingobacteria. They are gram-negative rods, mostly saprophytic in terrestrial and aquatic habitats.
Fresh Water
Water containing no significant amounts of salts, such as water from RIVERS and LAKES.
Heterotrophic Processes
The processes by which organisms utilize organic substances as their nutrient sources. Contrasts with AUTOTROPHIC PROCESSES which make use of simple inorganic substances as the nutrient supply source. Heterotrophs can be either chemoheterotrophs (or chemoorganotrophs) which also require organic substances such as glucose for their primary metabolic energy requirements, or photoheterotrophs (or photoorganotrophs) which derive their primary energy requirements from light. Depending on environmental conditions some organisms can switch between different nutritional modes (AUTOTROPHY; heterotrophy; chemotrophy; or PHOTOTROPHY) to utilize different sources to meet their nutrients and energy requirements.
Gammaproteobacteria
A group of the proteobacteria comprised of facultatively anaerobic and fermentative gram-negative bacteria.
Water Microbiology
The presence of bacteria, viruses, and fungi in water. This term is not restricted to pathogenic organisms.
Archaea
One of the three domains of life (the others being BACTERIA and Eukarya), formerly called Archaebacteria under the taxon Bacteria, but now considered separate and distinct. They are characterized by: (1) the presence of characteristic tRNAs and ribosomal RNAs; (2) the absence of peptidoglycan cell walls; (3) the presence of ether-linked lipids built from branched-chain subunits; and (4) their occurrence in unusual habitats. While archaea resemble bacteria in morphology and genomic organization, they resemble eukarya in their method of genomic replication. The domain contains at least four kingdoms: CRENARCHAEOTA; EURYARCHAEOTA; NANOARCHAEOTA; and KORARCHAEOTA.
Fatty Acids
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
Cluster Analysis
A set of statistical methods used to group variables or observations into strongly inter-related subgroups. In epidemiology, it may be used to analyze a closely grouped series of events or cases of disease or other health-related phenomenon with well-defined distribution patterns in relation to time or place or both.
Sewage
Refuse liquid or waste matter carried off by sewers.
Bacteroidaceae
A family of gram-negative bacteria found primarily in the intestinal tracts and mucous membranes of warm-blooded animals. Its organisms are sometimes pathogenic.
Bacterial Typing Techniques
Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.
Ecosystem
A functional system which includes the organisms of a natural community together with their environment. (McGraw Hill Dictionary of Scientific and Technical Terms, 4th ed)
Alphaproteobacteria
A class in the phylum PROTEOBACTERIA comprised mostly of two major phenotypes: purple non-sulfur bacteria and aerobic bacteriochlorophyll-containing bacteria.
Lakes
Inland bodies of still or slowly moving FRESH WATER or salt water, larger than a pond, and supplied by RIVERS and streams.
Rhizosphere
The immediate physical zone surrounding plant roots that include the plant roots. It is an area of intense and complex biological activity involving plants, microorganisms, other soil organisms, and the soil.
Symbiosis
The relationship between two different species of organisms that are interdependent; each gains benefits from the other or a relationship between different species where both of the organisms in question benefit from the presence of the other.
Genome, Bacterial
The genetic complement of a BACTERIA as represented in its DNA.
Cytophaga
A genus of gram-negative gliding bacteria found in SOIL; HUMUS; and FRESHWATER and marine habitats.
Gram-Positive Bacteria
Bacteria which retain the crystal violet stain when treated by Gram's method.
Bacterial Physiological Phenomena
Physiological processes and properties of BACTERIA.
Bioreactors
Tools or devices for generating products using the synthetic or chemical conversion capacity of a biological system. They can be classical fermentors, cell culture perfusion systems, or enzyme bioreactors. For production of proteins or enzymes, recombinant microorganisms such as bacteria, mammalian cells, or insect or plant cells are usually chosen.
North Sea
Flavobacterium
A genus of gram-negative, aerobic, rod-shaped bacteria widely distributed in SOIL and WATER. Its organisms are also found in raw meats, MILK and other FOOD, hospital environments, and human clinical specimens. Some species are pathogenic in humans.
Groundwater
Liquid water present beneath the surface of the earth.
Waste Water
Contaminated water generated as a waste product of human activity.
Chlorobi
A phylum of anoxygenic, phototrophic bacteria including the family Chlorobiaceae. They occur in aquatic sediments, sulfur springs, and hot springs and utilize reduced sulfur compounds instead of oxygen.
Eutrophication
The enrichment of a terrestrial or aquatic ECOSYSTEM by the addition of nutrients, especially nitrogen and phosphorus, that results in a superabundant growth of plants, ALGAE, or other primary producers. It can be a natural process or result from human activity such as agriculture runoff or sewage pollution. In aquatic ecosystems, an increase in the algae population is termed an algal bloom.
Soil
The unconsolidated mineral or organic matter on the surface of the earth that serves as a natural medium for the growth of land plants.
Intestines
The section of the alimentary canal from the STOMACH to the ANAL CANAL. It includes the LARGE INTESTINE and SMALL INTESTINE.
Vitamin K 2
A group of substances similar to VITAMIN K 1 which contains a ring of 2-methyl-1,4-naphthoquinione and an isoprenoid side chain of varying number of isoprene units. In vitamin K 2, each isoprene unit contains a double bond. They are produced by bacteria including the normal intestinal flora.
Bacterial Load
Measurable quantity of bacteria in an object, organism, or organism compartment.
Pigments, Biological
Any normal or abnormal coloring matter in PLANTS; ANIMALS or micro-organisms.
Salinity
Degree of saltiness, which is largely the OSMOLAR CONCENTRATION of SODIUM CHLORIDE plus any other SALTS present. It is an ecological factor of considerable importance, influencing the types of organisms that live in an ENVIRONMENT.
Species Specificity
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
DNA, Archaeal
Deoxyribonucleic acid that makes up the genetic material of archaea.
Methane
The simplest saturated hydrocarbon. It is a colorless, flammable gas, slightly soluble in water. It is one of the chief constituents of natural gas and is formed in the decomposition of organic matter. (Grant & Hackh's Chemical Dictionary, 5th ed)
Betaproteobacteria
A class in the phylum PROTEOBACTERIA comprised of chemoheterotrophs and chemoautotrophs which derive nutrients from decomposition of organic material.
Ice Cover
A thick mass of ICE formed over large regions of land; RIVERS; LAKES; ponds; or SEAWATER.
Arctic Regions
The Arctic Ocean and the lands in it and adjacent to it. It includes Point Barrow, Alaska, most of the Franklin District in Canada, two thirds of Greenland, Svalbard, Franz Josef Land, Lapland, Novaya Zemlya, and Northern Siberia. (Webster's New Geographical Dictionary, 1988, p66)
Porifera
The phylum of sponges which are sessile, suspension-feeding, multicellular animals that utilize flagellated cells called choanocytes to circulate water. Most are hermaphroditic. They are probably an early evolutionary side branch that gave rise to no other group of animals. Except for about 150 freshwater species, sponges are marine animals. They are a source of ALKALOIDS; STEROLS; and other complex molecules useful in medicine and biological research.
Locomotion
Movement or the ability to move from one place or another. It can refer to humans, vertebrate or invertebrate animals, and microorganisms.
Chloroflexi
Phylum of green nonsulfur bacteria including the family Chloroflexaceae, among others.
Gene Transfer, Horizontal
The naturally occurring transmission of genetic information between organisms, related or unrelated, circumventing parent-to-offspring transmission. Horizontal gene transfer may occur via a variety of naturally occurring processes such as GENETIC CONJUGATION; GENETIC TRANSDUCTION; and TRANSFECTION. It may result in a change of the recipient organism's genetic composition (TRANSFORMATION, GENETIC).
Industrial Waste
Worthless, damaged, defective, superfluous or effluent material from industrial operations.
Sequence Homology, Nucleic Acid
The sequential correspondence of nucleotides in one nucleic acid molecule with those of another nucleic acid molecule. Sequence homology is an indication of the genetic relatedness of different organisms and gene function.
Hemiptera
A large order of insects characterized by having the mouth parts adapted to piercing or sucking. It is comprised of four suborders: HETEROPTERA, Auchenorrhyncha, Sternorrhyncha, and Coleorrhyncha.
Phytoplankton
Free-floating minute organisms that are photosynthetic. The term is non-taxonomic and refers to a lifestyle (energy utilization and motility), rather than a particular type of organism. Most, but not all, are unicellular algae. Important groups include DIATOMS; DINOFLAGELLATES; CYANOBACTERIA; CHLOROPHYTA; HAPTOPHYTA; CRYPTOMONADS; and silicoflagellates.
Bacteria, Anaerobic
Waste Disposal, Fluid
The discarding or destroying of liquid waste products or their transformation into something useful or innocuous.
In Situ Hybridization, Fluorescence
A type of IN SITU HYBRIDIZATION in which target sequences are stained with fluorescent dye so their location and size can be determined using fluorescence microscopy. This staining is sufficiently distinct that the hybridization signal can be seen both in metaphase spreads and in interphase nuclei.
Aerobiosis
Life or metabolic reactions occurring in an environment containing oxygen.
Carbohydrate Metabolism
Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.
Bifidobacterium
A rod-shaped, gram-positive, non-acid-fast, non-spore-forming, non-motile bacterium that is a genus of the family Bifidobacteriaceae, order Bifidobacteriales, class ACTINOBACTERIA. It inhabits the intestines and feces of humans as well as the human vagina.
Rumen
The first stomach of ruminants. It lies on the left side of the body, occupying the whole of the left side of the abdomen and even stretching across the median plane of the body to the right side. It is capacious, divided into an upper and a lower sac, each of which has a blind sac at its posterior extremity. The rumen is lined by mucous membrane containing no digestive glands, but mucus-secreting glands are present in large numbers. Coarse, partially chewed food is stored and churned in the rumen until the animal finds circumstances convenient for rumination. When this occurs, little balls of food are regurgitated through the esophagus into the mouth, and are subjected to a second more thorough mastication, swallowed, and passed on into other parts of the compound stomach. (From Black's Veterinary Dictionary, 17th ed)
Anaerobiosis
The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
Polymerase Chain Reaction
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
Chryseobacterium
A genus of aerobic, gram-negative bacteria in the family FLAVOBACTERIACEAE. Many of its species were formerly in the genus FLAVOBACTERIUM.
Gene Library
A large collection of DNA fragments cloned (CLONING, MOLECULAR) from a given organism, tissue, organ, or cell type. It may contain complete genomic sequences (GENOMIC LIBRARY) or complementary DNA sequences, the latter being formed from messenger RNA and lacking intron sequences.

Phylogenetic position of Chitinophaga pinensis in the Flexibacter-Bacteroides-Cytophaga phylum. (1/434)

Comparison of the 16S rRNA gene sequence determined for Chitinophaga pinensis showed that this species is most closely related to Flexibacter filiformis in the Flexibacter-Bacteroides-Cytophaga phylum. These two chitinolytic bacteria, which are characterized by transformation into spherical bodies on ageing, belong to a strongly supported lineage that also includes Cytophaga arvensicola, Flavobacterium ferrugineum and Flexibacter sancti. The lineage is distinct from the microcyst-forming species Sporocytophaga myxococcoides.  (+info)

Coenonia anatina gen. nov., sp. nov., a novel bacterium associated with respiratory disease in ducks and geese. (2/434)

Taxon 1502 was originally described as a Riemerella anatipestifer-like bacterium causing exudative septicaemia in ducks and geese. In the present study, an integrated genotypic and phenotypic approach was used to elucidate the phylogenetic affiliation and taxonomic relationships of 12 strains of taxon 1502. Whole-cell protein and fatty acid analyses and an extensive biochemical examination by using conventional tests and several API microtest systems indicated that all isolates formed a homogeneous taxon, which was confirmed by DNA-DNA hybridizations. 16S rDNA sequence analysis of a representative strain (LMG 14382T) indicated that this taxon belongs to the Cytophaga-Flavobacterium-Bacteroides phylum and revealed a moderate but distinct relationship to species of the genus Capnocytophaga (overall 16S rDNA sequence identities were 88.8-90.2%). Taxon 1502 is concluded to represent a single species that should be allocated to a novel genus, and the name Coenonia anatina gen. nov., sp. nov. is proposed. The DNA G + C content of representative strains was 35-36 mol% and the type strain is LMG 14382T.  (+info)

Physicochemical parameters for growth of the sea ice bacteria Glaciecola punicea ACAM 611(T) and Gelidibacter sp. strain IC158. (3/434)

The water activity and pH ranges for growth of Glaciecola punicea (a psychrophile) were extended when this organism was grown at suboptimal rather than optimal temperatures. No such extension was observed for Gelidibacter sp. strain IC158 (a psychrotolerant bacterium) at analogous temperatures. Salinity and pH may be primary physicochemical parameters controlling bacterial community development in sea ice.  (+info)

Dynamics of bacterial community composition and activity during a mesocosm diatom bloom. (4/434)

Bacterial community composition, enzymatic activities, and carbon dynamics were examined during diatom blooms in four 200-liter laboratory seawater mesocosms. The objective was to determine whether the dramatic shifts in growth rates and ectoenzyme activities, which are commonly observed during the course of phytoplankton blooms and their subsequent demise, could result from shifts in bacterial community composition. Nutrient enrichment of metazoan-free seawater resulted in diatom blooms dominated by a Thalassiosira sp., which peaked 9 days after enrichment ( approximately 24 microg of chlorophyll a liter(-1)). At this time bacterial abundance abruptly decreased from 2.8 x 10(6) to 0.75 x 10(6) ml(-1), and an analysis of bacterial community composition, by denaturing gradient gel electrophoresis (DGGE) of PCR-amplified 16S rRNA gene fragments, revealed the disappearance of three dominant phylotypes. Increased viral and flagellate abundances suggested that both lysis and grazing could have played a role in the observed phylotype-specific mortality. Subsequently, new phylotypes appeared and bacterial production, abundance, and enzyme activities shifted from being predominantly associated with the <1.0-microm size fraction towards the >1.0-microm size fraction, indicating a pronounced microbial colonization of particles. Sequencing of DGGE bands suggested that the observed rapid and extensive colonization of particulate matter was mainly by specialized alpha-Proteobacteria- and Cytophagales-related phylotypes. These particle-associated bacteria had high growth rates as well as high cell-specific aminopeptidase, beta-glucosidase, and lipase activities. Rate measurements as well as bacterial population dynamics were almost identical among the mesocosms indicating that the observed bacterial community dynamics were systematic and repeatable responses to the manipulated conditions.  (+info)

Increase in bacterial community diversity in subsurface aquifers receiving livestock wastewater input. (5/434)

Despite intensive studies of microbial-community diversity, the questions of which kinds of microbial populations are associated with changes in community diversity have not yet been fully solved by molecular approaches. In this study, to investigate the impact of livestock wastewater on changes in the bacterial communities in groundwater, bacterial communities in subsurface aquifers were analyzed by characterizing their 16S rDNA sequences. The similarity coefficients of restriction fragment length polymorphism (RFLP) patterns of the cloned 16S ribosomal DNAs showed that the bacterial communities in livestock wastewater samples were more closely related to those in contaminated aquifer samples. In addition, calculations of community diversity clearly showed that bacterial communities in the livestock wastewater and the contaminated aquifer were much more diverse than those in the uncontaminated aquifer. Thus, the increase in bacterial-community diversity in the contaminated aquifer was assumed to be due to the infiltration of livestock wastewater, containing high concentrations of diverse microbial flora, into the aquifer. Phylogenetic analysis of the sequences from a subset of the RFLP patterns showed that the Cytophaga-Flexibacter-Bacteroides and low-G+C gram-positive groups originating from livestock wastewater were responsible for the change in the bacterial community in groundwater. This was evidenced by the occurrence of rumen-related sequences not only in the livestock wastewater samples but also in the contaminated-groundwater samples. Rumen-related sequences, therefore, can be used as indicator sequences for fecal contamination of groundwater, particularly from livestock.  (+info)

Dyadobacter fermentans gen. nov., sp. nov., a novel gram-negative bacterium isolated from surface-sterilized Zea mays stems. (6/434)

A Gram-negative bacterium, designated NS114T, was isolated from duplicate treatments of surface-sterilized Zea mays stems. The plants were grown in synthetic soil under greenhouse conditions and watered with fertilizer containing no nitrogen. Strain NS114T could not be isolated from plants watered with the standard level or 20% (w/v) of the standard level of nitrogen. Cells occurred as pairs in young cultures that attached to form angled arrangements in R2A broth and occasionally formed rounded, horseshoe arrangements in YM broth. Cell variation resulted in flocculent chains of coccoid cells in old cultures. Strain NS114T fermented glucose and sucrose. The G + C content was 48 mol%. Phylogenetic analysis of the 16S rRNA gene showed that the strain was a member of the domain Bacteria and branched from a point equidistant from an aquatic organism, Runella slithyformis and a marine isolate, 'Microscilla furvescens'. Phenotypic and genotypic analyses indicated that strain NS114T could not be assigned to any recognized genus; therefore a new genus and species, Dyadobacter fermentans gen. nov., sp. nov., is proposed, for which NS114T is the type strain.  (+info)

Bacterial community structure associated with a dimethylsulfoniopropionate-producing North Atlantic algal bloom. (7/434)

The bacteria associated with oceanic algal blooms are acknowledged to play important roles in carbon, nitrogen, and sulfur cycling, yet little information is available on their identities or phylogenetic affiliations. Three culture-independent methods were used to characterize bacteria from a dimethylsulfoniopropionate (DMSP)-producing algal bloom in the North Atlantic. Group-specific 16S rRNA-targeted oligonucleotides, 16S ribosomal DNA (rDNA) clone libraries, and terminal restriction fragment length polymorphism analysis all indicated that the marine Roseobacter lineage was numerically important in the heterotrophic bacterial community, averaging >20% of the 16S rDNA sampled. Two other groups of heterotrophic bacteria, the SAR86 and SAR11 clades, were also shown by the three 16S rRNA-based methods to be abundant in the bloom community. In surface waters, the Roseobacter, SAR86, and SAR11 lineages together accounted for over 50% of the bacterial rDNA and showed little spatial variability in abundance despite variations in the dominant algal species. Depth profiles indicated that Roseobacter phylotype abundance decreased with depth and was positively correlated with chlorophyll a, DMSP, and total organic sulfur (dimethyl sulfide plus DMSP plus dimethyl sulfoxide) concentrations. Based on these data and previous physiological studies of cultured Roseobacter strains, we hypothesize that this lineage plays a role in cycling organic sulfur compounds produced within the bloom. Three other abundant bacterial phylotypes (representing a cyanobacterium and two members of the alpha Proteobacteria) were primarily associated with chlorophyll-rich surface waters of the bloom (0 to 50 m), while two others (representing Cytophagales and delta Proteobacteria) were primarily found in deeper waters (200 to 500 m).  (+info)

Description of Cellulophaga algicola sp. nov., isolated from the surfaces of Antarctic algae, and reclassification of Cytophaga uliginosa (ZoBell and Upham 1944) Reichenbach 1989 as Cellulophaga uliginosa comb. nov. (8/434)

A group of strains with potent extracellular enzymic activity were isolated from the surfaces of the chain-forming sea-ice diatom Melosira and from an unidentified macrophyte collected from the Eastern Antarctic coastal zone. 16S rDNA sequence analysis indicated that the strains belonged to the genus Cellulophaga and showed greatest similarity to the species Cellulophaga baltica (sequence similarity 97%). Phenotypic characteristics, DNA base composition and DNA-DNA hybridization values clearly separate the Antarctic strains from Cellulophaga baltica and other Cellulophaga species. Thus, the strains form a distinct and novel species and have the proposed name Cellulophaga algicola sp. nov. (type strain IC166T = ACAM 630T). In addition, it was recognized that the species Cytophaga uliginosa (ZoBell and Upham 1944) Reichenbach 1989, a species phylogenetically remote from the type species of the genus Cytophaga, possessed 16S rDNA sequences and phenotypic and chemotaxonomic traits similar to those of other Cellulophaga species. Thus, it was proposed that the species Cytophaga uliginosa be renamed as Cellulophaga uliginosa comb. nov.  (+info)

Biomolecules | Free Full-Text | Glycobiology Aspects of the Periodontal Pathogen Tannerella forsythia | HTMLBiomolecules | Free Full-Text | Glycobiology Aspects of the Periodontal Pathogen Tannerella forsythia | HTML
Glycobiology is important for the periodontal pathogen Tannerella forsythia, affecting the bacteriums cellular integrity, its life-style, and virulence potential. The bacterium possesses a unique Gram-negative cell envelope with a glycosylated surface (S-) layer as outermost decoration that is proposed to be anchored via a rough lipopolysaccharide. The S-layer glycan has the structure 4‑MeO-b-ManpNAcCONH2-(1→3)-[Pse5Am7Gc-(2→4)-]-b-ManpNAcA-(1→4)-[4-MeO-a-Galp-(1→2)-]-a-Fucp-(1→4)-[-a-Xylp-(1→3)-]-b-GlcpA-(1→3)-[-b-Digp-(1→2)-]-a-Galp and is linked to distinct serine and threonine residues within the D(S/T)(A/I/L/M/T/V) amino acid motif. Also several other Tannerella proteins are modified with the S‑layer oligosaccharide, indicating the presence of a general O‑glycosylation system. Protein O‑glycosylation impacts the life-style of T. forsythia since truncated S-layer glycans present in a defined mutant favor biofilm formation. While the S‑layer has also been shown to be a
http://www.mdpi.com/2218-273X/2/4/467/htm
Sediminibacterium salmoneum gen. nov., sp. nov., a member of the phylum Bacteroidetes isolated from sediment of a eutrophic...Sediminibacterium salmoneum gen. nov., sp. nov., a member of the phylum Bacteroidetes isolated from sediment of a eutrophic...
Strain NJ-44T, isolated from sediment of the eutrophic Guanting Reservoir in Beijing (China), was subjected to a taxonomic study using a polyphasic approach. The strain was aerobic, with salmon-pink-pigmented colonies on R2A agar. Cells were single, Gram-negative rods, motile by gliding. Phylogenetic analysis based on the 16S rRNA gene sequence showed that strain NJ-44T belonged to the phylum Bacteroidetes, with Terrimonas ferruginea ATCC 13524T (90.8 % similarity), Terrimonas lutea DYT (90.5 %) and Niabella aurantiaca R2A15-11T (89.1 %) as its closest relatives. Strain NJ-44T was clearly differentiated from members of the genera Terrimonas and Niabella in its DNA G+C content (40.6 mol%) and its major fatty acids, iso-C15 : 1 G, iso-C15 : 0, anteiso-C15 : 0, iso-C16 : 0 3-OH, iso-C17 : 0 3-OH, anteiso-C15 : 1 A and iso-C15 : 0 3-OH. It is proposed that strain NJ-44T represents a novel genus and species, named Sediminibacterium salmoneum gen. nov., sp. nov. The type strain of Sediminibacterium salmoneum
https://www.microbiologyresearch.org/content/journal/ijsem/10.1099/ijs.0.65514-0
Characterization of a sialate O-acetyl esterase (NanS) from the oral pathogen Tannerella forsythia that enhances sialic acid...Characterization of a sialate O-acetyl esterase (NanS) from the oral pathogen Tannerella forsythia that enhances sialic acid...
Tannerella forsythia, a Gram-negative member of the Bacteroidetes has evolved to harvest and utilize sialic acid.. The most common sialic acid in humans is a mono-N-acetylated version termed Neu5Ac. Many bacteria are known to access sialic acid using sialidase enzymes. However, in humans a high proportion of sialic acid contains a second acetyl group attached via an O- group i.e. chiefly O-acetylated Neu5,9Ac2 or Neu5,4Ac2. This diacetylated sialic acid is not cleaved efficiently by many sialidases and in order to access diacetylated sialic acid, some organisms produce sialate-O-acetylesterases that catalyse removal of the second acetyl group. In this study we performed bioinformatic and biochemical characterization of a putative sialate-O-acetylesterase from T. forsythia (NanS), which contains two putative SGNH-hydrolase domains related to sialate-O-acetylesterases from a range of organisms. Purification of recombinant NanS revealed an esterase that has activity against Neu5,9Ac2 and its ...
http://www.biochemj.org/content/early/2015/09/16/BJ20150388
KEGG PATHWAY: Ubiquinone and other terpenoid-quinone biosynthesis - Candidatus Amoebophilus asiaticus
Ubiquinone (UQ), also called coenzyme Q, and plastoquinone (PQ) are electron carriers in oxidative phosphorylation and photosynthesis, respectively. The quinoid nucleus of ubiquinone is derived from the shikimate pathway; 4-hydroxybenzoate is directly formed from chorismate in bacteria, while it can be formed from either chorismate or tyrosine in yeast. The following biosynthesis of terpenoid moiety involves reactions of prenylation, decarboxylation, and three hydroxylations alternating with three methylations. The order of these reactions are somewhat different between bacteria and yeast. Phylloquinone (vitamin K1), menaquinone (vitamin K2), and tocopherol (vitamin E) are fat-soluble vitamins. Phylloquinone is a compound present in all photosynthetic plants serving as a cofactor for photosystem I-mediated electron transport. Menaquinone is an obligatory component of the electron-transfer pathway in bacteria ...
http://www.genome.jp/kegg-bin/show_pathway?aas00130
Bacteroidetes - WikipediaBacteroidetes - Wikipedia
In the gastrointestinal microbiota Bacteroidetes have a very broad metabolic potential and are regarded as one of the most stable part of gastrointestinal microflora. Reduced abundance of the Bacteroidetes in some cases is associated with obesity and irritable bowel syndrome. This bacterial group appears to be enriched in patients suffering from type 1 and type 2 diabetes.[1] Bacteroides spp. in contrast to Prevotella spp. were recently found to be enriched in the metagenomes of subjects with low gene richness that were associated with adiposity, insulin resistance and dyslipidaemia as well as an inflammatory phenotype. Bacteroidetes species that belong to classes Flavobacteriales and Sphingobacteriales are typical soil bacteria and can only occasionally detected in the gastrointestinal tract, except Capnocytophaga spp. and Sphingobacterium spp. that can be detected in the human oral cavity.[1] Bacteroidetes are not limited to gut microbiota, they colonize a variety of habitats on Earth.[4] For ...
https://en.wikipedia.org/wiki/Bacteroidetes
Terrimonas rhizosphaerae sp. nov., isolated from ginseng rhizosphere soil | Microbiology SocietyTerrimonas rhizosphaerae sp. nov., isolated from ginseng rhizosphere soil | Microbiology Society
The novel isolate belonging to the genus Terrimonas , designated CR94T, was isolated from rhizosphere soil of a ginseng field in Geumsan, Korea. Cells of strain CR94T were strictly aerobic, Gram-stain-negative, non-motile, non-filamentous single rods. Growth was observed at 10-37 °C (optimum 28 °C) and at pH 4.0-10.0 (optimum pH 6.0). Phylogenetic analyses based on 16S rRNA gene sequences indicated that strain CR94T belonged to the genus Terrimonas , showing highest sequence similarity to Terrimonas lutea DYT (97.3 %), Terrimonas pekingensis QHT (97.1 %), Terrimonas aquatica RIB1-6T (95.6 %), Terrimonas rubra M-8T (94.7 %) and Terrimonas ferruginea ATCC 13524T (93.8 %). DNA-DNA relatedness values between strain CR94T and T. lutea KACC 13047T, T. pekingensis KACC 18795T, T. ferruginea KACC 11310T and T. aquatica LMG 24825T were 30.5, 28.9, 17.8 and 13.5 %, respectively. The DNA G+C content was 46.5 mol% and the major respiratory quinone was menaquinone-7 (MK-7). The major cellular fatty
https://www.microbiologyresearch.org/content/journal/ijsem/10.1099/ijsem.0.001639
Association between body mass index and Firmicutes/Bacteroidetes ratio in an adult Ukrainian population | BMC Microbiology |...Association between body mass index and Firmicutes/Bacteroidetes ratio in an adult Ukrainian population | BMC Microbiology |...
Metagenomic studies confirm that obesity is associated with a composition of gut microbiota. There are some controversies, however, about the composition of gut microbial communities in obese individuals in different populations. To examine the association between body mass index and microbiota composition in Ukrainian population, fecal concentrations of Bacteroidetes, Firmicutes, Actinobacteria and Firmicutes/Bacteroidetes (F/B) ratio were analyzed in 61 adult individuals. The relative abundance of Actinobacteria was small (5-7%) and comparable in different BMI categories. The content of Firmicutes was gradually increased while the content of Bacteroidetes was decreased with increasing body mass index (BMI). The F/B ratio also raised with increasing BMI. In an unadjusted logistic regression model, F/B ratio was significantly associated with BMI (OR = 1.23, 95% CI 1,09-1,38). This association continued to be significant after adjusting for confounders such as age, sex, tobacco smoking and physical
https://0-bmcmicrobiol-biomedcentral-com.brum.beds.ac.uk/articles/10.1186/s12866-017-1027-1
Identifying human and livestock sources of fecal contamination in Kenya with host-specific Bacteroidales assays.
Microbial source tracking to distinguish between human, livestock and wildlife fecal pollution using molecular techniques is a rapidly evolving approach in many developed countries, but has not previously been applied on the African continent. DNA extracts from cow, donkey, and human fecal specimens and raw domestic sewage samples collected in Kenya were tested against five existing quantitative PCR assays designed to detect universal (2), human-specific (2), and cow-specific (1) fecal Bacteroidales genetic markers. Water samples from the River Njoro in Kenya were evaluated using the five tested Bacteroidales markers and a multi-species assay for Cryptosporidium in a preliminary exploration of fecal pollution sources and health risks in this watershed. Diagnostic sensitivity on the validation set varied from 18 to 100% for the five assays while diagnostic specificity was 100%. Of the 2 universal assays, Total Bacteroidales [Dick, L.K, Field, K.G., 2004. Rapid estimation of numbers of fecal ...
http://erepository.uonbi.ac.ke:8080/xmlui/handle/11295/58009
Polysaccharide utilization loci and nutritional specialization in a dominant group of butyrate-producing human colonic...Polysaccharide utilization loci and nutritional specialization in a dominant group of butyrate-producing human colonic...
Sheridan , P O , Martin , J C , Lawley , T D , Browne , H P , Harris , H M B , Bernalier-Donadille , A , Duncan , S H , OToole , P W , Scott , K P & Flint , H J 2016 , Polysaccharide utilization loci and nutritional specialization in a dominant group of butyrate-producing human colonic Firmicutes Microbial Genomics , vol 2 , no. 2 , 43 , pp. 1-16 . DOI: 10.1099/mgen. ...
http://aura.abdn.ac.uk/handle/2164/5930
Bacteroidetes - Wikipedia, a enciclopedia libreBacteroidetes - Wikipedia, a enciclopedia libre
As Bacteroidetes ou bacterioidetas son un filo de bacterias composto por tres grandes clases de bacterias gramnegativas, non formadoras de esporas, anaeróbicas, e con forma de bacilos, que están amplamente distribuídas no ambiente, e que aarecen no solo, sedimentos, mares e nos intestinos e pel dos animais. Con diferenza, a clase Bacteroidia é a mellor estudada deste filo, e inclúe os xéneros Bacteroides (un organismo abundante nas feces dos animais de sangue quente, incluídos os humanos), e Porphyromonas, que habitan na cavidade bucal humana. A clase actual Bacteroidia antes foi chamada formalmente Bacteroidetes xa que ata hai pouco era a única clase do filo (nese caso coinciden os nomes do filo e a clase), pero o nome foi cambiado no cuarto volume do Bergeys Manual of Systematic Bacteriology.[1] Membros do xénero Bacteroides son patóxenos oportunistas. Os membros das outras dúas clases raramente son patóxenos para os humanos. O investigador Jeffrey Gordon e os seus colegas ...
https://gl.wikipedia.org/wiki/Bacteroidetes
Gliding Motility and Por Secretion System Genes Are Widespread among Members of the Phylum Bacteroidetes | Journal of...Gliding Motility and Por Secretion System Genes Are Widespread among Members of the Phylum Bacteroidetes | Journal of...
C. atlanticus, G. forsetii, and R. biformata are marine bacteria that are thought to play important roles in the digestion of macromolecules (43-45). As with other marine bacteroidetes, these bacteria are probably enriched on surfaces such as algal cells or organic detritus particles known as marine snow, and the ability to glide over these surfaces may be important for their survival (46). R. anatipestifer is an important poultry pathogen (47), and motility may play a role in pathogenesis. P. propionicigenes, which was isolated from an anoxic rice field (48), has not been studied extensively, and the importance of gliding motility in its lifestyle is unclear.. In addition to the 22 finished genome sequences for members of the classes Flavobacteriia, Cytophagia, and Sphingobacteriia described above, draft genome sequences were available for another 27 members of these classes (see Table S3 in the supplemental material). We analyzed these and determined that all contained the 11 core gliding ...
https://jb.asm.org/content/195/2/270
CAZy - Bacteria
Lineage: cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidetes; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes ...
http://www.cazy.org/b2189.html
Freezing fecal samples prior to DNA extraction affects the Firmicutes to Bacteroidetes ratio determined by downstream...Freezing fecal samples prior to DNA extraction affects the Firmicutes to Bacteroidetes ratio determined by downstream...
TY - JOUR. T1 - Freezing fecal samples prior to DNA extraction affects the Firmicutes to Bacteroidetes ratio determined by downstream quantitative PCR analysis. AU - Bahl,Martin Iain. AU - Bergström,Anders. AU - Licht,Tine Rask. PY - 2012. Y1 - 2012. N2 - Freezing stool samples prior to DNA extraction and downstream analysis is widely used in metagenomic studies of the human microbiota but may affect the inferred community composition. In this study, DNA was extracted either directly or following freeze storage of three homogenized human fecal samples using three different extraction methods. No consistent differences were observed in DNA yields between extractions on fresh and frozen samples; however, differences were observed between extraction methods. Quantitative PCRanalysis was subsequently performed on all DNA samples using six different primer pairs targeting 16S rRNA genes of significant bacterial groups, and the community composition was evaluated by comparing specific ratios of the ...
http://orbit.dtu.dk/en/publications/freezing-fecal-samples-prior-to-dna-extraction-affects-the-firmicutes-to-bacteroidetes-ratio-determined-by-downstream-quantitative-pcr-analysis
CAZy - Bacteria
Lineage: cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidetes; unclassified Bacteroidetes; unclassified Bacteroidetes (miscellaneous ...
http://www.cazy.org/b5833.html
UniProt/TrEMBL: A0A142HPY3 9SPHI
ID A0A142HPY3_9SPHI Unreviewed; 914 AA. AC A0A142HPY3; DT 08-JUN-2016, integrated into UniProtKB/TrEMBL. DT 08-JUN-2016, sequence version 1. DT 07-JUN-2017, entry version 8. DE SubName: Full=DNA ligase {ECO:0000313,EMBL:AMR30941.1}; GN ORFNames=A0256_05625 {ECO:0000313,EMBL:AMR30941.1}; OS Mucilaginibacter sp. PAMC 26640. OC Bacteria; Bacteroidetes; Sphingobacteriia; Sphingobacteriales; OC Sphingobacteriaceae; Mucilaginibacter. OX NCBI_TaxID=1300914 {ECO:0000313,EMBL:AMR30941.1, ECO:0000313,Proteomes:UP000073092}; RN [1] {ECO:0000313,EMBL:AMR30941.1, ECO:0000313,Proteomes:UP000073092} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=PAMC 26640 {ECO:0000313,EMBL:AMR30941.1, RC ECO:0000313,Proteomes:UP000073092}; RA Park H.; RT Mucilaginibacter sp. genome sequencing.; RL Submitted (MAR-2016) to the EMBL/GenBank/DDBJ databases. CC ----------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms CC ...
http://www.genome.jp/dbget-bin/www_bget?tr:A0A142HPY3_9SPHI
Avaliação da dinâmica de Bacteroidetes no processo de biodegradação de blenda polimérica...Avaliação da dinâmica de Bacteroidetes no processo de biodegradação de blenda polimérica...
Resíduos produzidos em atividades industriais podem trazer danos significativos ao ambiente, principalmente quando estes não são degradáveis (ou são dificilmente degradáveis) por processos naturais. Polímeros...
https://www.teses.usp.br/teses/disponiveis/11/11138/tde-14122015-110345/es.php
Elodie DRULA - AFMB UMR 7257
Dernières PublicationsPULDB: the expanded database of Polysaccharide Utilization Loci. (2018) Terrapon N, Lombard V, Drula E , Lapebie P, (...)
http://www.afmb.univ-mrs.fr/Elodie-Drula
Bernard HENRISSAT - AFMB UMR 7257
Dernières PublicationsDe novo assembly of the complex genome of Nippostrongylus brasiliensis using MinION long reads. (2018) Eccles D, Chandler J, (...)
http://www.afmb.univ-mrs.fr/Bernard-Henrissat
Elixa probioticElixa probiotic
anecdotal evidence exists that Elixa is increasing populations of Lactobacilli in the gut and decreases Firmicutes/Bacteroidetes ratio that has been directly related to weight loss (elevated in obese subjects). ...
http://www.aurametrix.com/topics/elixa-probiotic
Science Inventory | US EPAScience Inventory | US EPA
RYU, H., T. TRAN, M. W. WARE, B. Iker, S. GRIFFIN, A. EGOROV, T. Edge, N. Newmann, E. N. VILLEGAS, AND J. W. SANTO-DOMINGO. Application of leftover sample material from waterborne protozoa monitoring for the molecular detection of ,I,Bacteroidales,/I, and fecal source tracking markers. JOURNAL OF MICROBIOLOGICAL METHODS. Elsevier Science Ltd, New York, NY, 86(3):337-343, (2011 ...
https://cfpub.epa.gov/si/si_lab_search_results.cfm?fed_org_id=770&SIType=PR&TIMSType=&showCriteria=0&address=nerl/pubs.html&view=citation&personID=58391&role=Author&sortBy=pubDateYear&count=100&dateBeginPublishedPresented=
PSCA Target InfoPSCA Target Info
SEQUENCE amino acids 424 aa >ZP_02031795.1 gi,154492169,ref,ZP_02031795.1, hypothetical protein PARMER_01801 [Parabacteroides merdae ATCC 43184 MKMRVYSLLFMMLFALSIGANAQVKFFTDVNSKQIKTLQVKVAGELISEPYIALGGEEQI EINFDGLGSGYTRYAYNVVHCNADWTQSQLSPIEYMNGFQGTTIDDFANSIGTTTQYSNY RLLLPNDDVQFKVSGNYAIQVYNEDTPDQIIFTACFSVVEPVVNISASVSGNTDIDTNQS HQQVSFNINNKNFPITYPQTDLKIFVYQDNRRDNAVTDLQPMSILENQISYTYNRNLIFP AGNEYRRMEFLSNKYNGMHVENISFHNPYYNVELMTDYRRDKGTYQYDQDQDGRFFIRCS DCNDPDTEADYYIVHFTLACDPLPDGSVYLNGELFNNVLDEKSKMGYNFETKQYEKAVLL KQGSYNYQYLFVPTGSSVGQTGPIEGNYYQTQNEYSIYVYYRPMGARYDRLIGVTTVRNE MQVF CDS cDNA 1275 bp 1 atgaaaatga gagtgtacag tttactattt atgatgcttt ttgccctttc catcggggca 60 61 aacgcacagg taaagttctt caccgatgtc aatagcaagc agataaaaac gcttcaggtg 120 121 aaagttgccg gagagttgat atccgaacct tacatagcgt tgggaggaga agagcaaatt 180 181 gaaatcaatt tcgacggttt ggggagtgga tacacacgat atgcctataa cgtggtgcat 240 241 tgcaacgccg actggacgca atcgcagttg agtccgatcg aatatatgaa tggtttccaa 300 301 ggaacaacaa tcgacgattt tgccaattcc atcgggacta ...
https://www.jcsg.org/prod/newscripts/psca/targetinfo.cgi?acc=ZP_02031795.1&start=23&end=424
Salinibacter ruber Anton et al. ATCC ® BAA-605D-5™Salinibacter ruber Anton et al. ATCC ® BAA-605D-5™
Salinibacter ruber ATCC ® BAA-605D-5™ Designation: Genomic DNA from Salinibacter ruber strain DSM 13855 TypeStrain=True Application:
https://www.atcc.org/en/Global/Products/D/A/0/9/BAA-605D-5.aspx?slp=1
Most recent papers in the journal Molecular Oral Microbiology | Read by QxMDMost recent papers in the journal Molecular Oral Microbiology | Read by QxMD
The oral pathogen Tannerella forsythia possesses a unique surface (S-) layer with a complex O-glycan containing a bacterial sialic acid mimic in the form of either pseudaminic acid or legionaminic acid at its terminal position. We hypothesize that different T. forsythia strains employ these stereoisomeric sugar acids for interacting with the immune system and resident host tissues in the periodontium. Here, we show how T. forsythia strains ATCC 43037 and UB4, displaying pseudaminic acid and legionaminic acid, respectively, and selected cell surface mutants of these strains, modulate the immune response in monocytes and human oral keratinocytes (HOK) using a multiplex immunoassay ...
https://www.readbyqxmd.com/journal/42887
Small RNAs Repress Expression of Polysaccharide Utilization Loci of Gut Bacteroides Species | Journal of BacteriologySmall RNAs Repress Expression of Polysaccharide Utilization Loci of Gut Bacteroides Species | Journal of Bacteriology
It has been known for decades that many human gut bacteria have the ability to utilize a wide variety of plant polysaccharides (PS) and animal glycans for their metabolism and growth (1, 2). The members of Bacteroides, a genus with numerous species abundant in the human colon, are especially adept at utilizing the vast array of PS and glycans that arrive to the colon from the diet or are present on the mucins overlying the epithelial layer. Early studies analyzing genes necessary for starch utilization in Bacteroides thetaiotaomicron led to the identification of the sus locus (3-6), the first characterized locus of a Bacteroides species encoding a cluster of genes necessary to utilize a complex carbohydrate. It was not until the publication of the first Bacteroides genome sequence in 2003 (7) that the vast number of these polysaccharide utilization loci (PUL), as they were named (8), was appreciated. The genome of the B. thetaiotaomicron type strain contains 88 PUL with an average of 10 genes ...
https://jb.asm.org/content/198/18/2396.long
The intestinal microbiome of fish under starvation | BMC Genomics | Full TextThe intestinal microbiome of fish under starvation | BMC Genomics | Full Text
Significantly more reads were assigned to the Bacteroidetes phylum in the experimental sample (36%) as compared to the control sample (8.2%). At the class level, Bacteroidia (1.3% in the control sample vs. 24.4% in the experimental sample) and Sphingobacteria (1.1% in the control sample vs. 7.8% in the experimental sample) contributed to higher percentages of the microbiota in the experimental sample than in the control sample. The significant elevation of Bacteroidetes in the intestinal community of the starved seabass sample is in agreement with some other studies [2, 34, 35] on dietary shifts. For example, in mice [34], fasting was associated with a significant increase in the proportional representation of the Bacteroidetes [from 20.6% (fed) to 42.3% (fasted)]. Bacteroides with a much larger genome size (e.g., Bacteroides fragilis Strain NCTC9343: 5,205,140 bp) are normally mutualistic in the animal gastrointestinal flora. A large part of the proteins made by the Bacteroides genome are able ...
https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-15-266
Exploring and exploiting plant biomass degradation by BacteroidetesExploring and exploiting plant biomass degradation by Bacteroidetes
Bacteroidetes bacteria have evolved to become excellent biomass degraders. They achieved this by applying carbohydrate-active enzymes (CAZymes) and organizing genes connected to the degradation of specific polysaccharides into discrete gene cassettes, so-called polysaccharide utilization loci (PULs). Consequently, CAZymes and PULs may hold the potential to improve biomass valorization processes in biorefineries and to advance our understanding of human and livestock gut health.|br /||br /|CAZymes are extremely diverse in activity and structure, and for some enzyme families only little is known to date. For example, certain carbohydrate esterases (CEs) combine multiple catalytic domains within one protein, resulting in multicatalytic enzyme architectures, and the properties of these have been little explored. In this thesis, I present biochemical data showcasing the existence of intramolecular synergy between the active domains of multicatalytic CEs (BoCE6-CE1). The observed intramolecular synergy
https://research.chalmers.se/publication/525171
Author: jinhui / Publication Year: 2019 / Subject: Firmicutes and Bacteroidetes / Text Availability: Citation in PubAg - PubAg...Author: jinhui / Publication Year: 2019 / Subject: Firmicutes and Bacteroidetes / Text Availability: Citation in PubAg - PubAg...
This study evaluated the effects of fucoidan from Acaudina molpadioides (Am-FUC) on modulation of the gut microbiota and improvement in insulin resistance in mice. Results showed that Am-FUC greatly alleviated insulin resistance and modified gut microbiota, involving Bacteroidetes and Firmicutes phylum. Am-FUC reducted serum and fecal lipopolysaccharide (LPS) concentrations and inhibited transcrip ...
https://pubag.nal.usda.gov/?f%5Bpublication_year_rev%5D%5B%5D=7981-2019&f%5Bsubject_term%5D%5B%5D=Firmicutes&f%5Bsubject_term%5D%5B%5D=Bacteroidetes&f%5Btext_availability%5D%5B%5D=Citation+in+PubAg&per_page=50&q=jinhui&search_field=author&sort=date-desc
The Human Microbiome in Overweight and Obesity: The Dawn of a New Era?
The human gut microbiome is a highly diverse microbial ecosystem of approximately 400 different species, with most of the species belonging to the phylum Bacteroidetes or Firmicutes. Each person has an unique composition of bacteria, and its also clear that subsets of the population have microbiomes that look more a like, as different diets promote the growth of certain species in the gut, and some health disorders are characterized by a specific microbial profile. By now its well established that obesity is associated with an obese microbiota that is quite different than the microbiota of a lean person (1,2).. The first studies looking into the microbiota in overweight and obesity found that obese individuals have a decreased Bacteroidetes/Firmicutes ratio, but recent findings show that this isnt always the case. Also, since both good and bad bugs belong to both of these major groups of bacteria, the ratio between Bacteroidetes and Firmicutes doesnt necessarily tell us much about the ...
http://darwinian-medicine.com/the-human-microbiome-in-overweight-and-obesity-the-dawn-of-a-new-era/
ASMscience | Type VI Secretion Systems and the Gut Microbiota
The human colonic microbiota is a dense ecosystem comprised of numerous microbes, including bacteria, phage, fungi, archaea, and protozoa, that compete for nutrients and space. Studies are beginning to reveal the antagonistic mechanisms that gut bacteria use to compete with other members of this ecosystem. In the healthy human colon, the majority of the Gram-negative bacteria are of the order Bacteroidales. Proteobacteria, such as Escherichia coli, are numerically fewer but confer important properties to the host, such as colonization resistance. Several enteric pathogens use type VI secretion systems (T6SSs) to antagonize symbiotic gut E. coli, facilitating colonization and disease progression. T6SS loci are also widely distributed in human gut Bacteroidales, which includes three predominant genera: Bacteroides, Parabacteroides, and Prevotella. There are three distinct genetic architectures of T6SS loci among the gut Bacteroidales, termed GA1, GA2, and GA3. GA1 and GA2 T6SS loci are contained on
https://www.asmscience.org/content/journal/microbiolspec/10.1128/microbiolspec.PSIB-0009-2018?term=10.1128%2Fmicrobiolspec.PSIB-0009-2018%5Bdoi%5D&dopt=Abstract&db=pubmed
A comparative study of culture-independent, library-independent genotypic methods of fecal source tracking on Environmental XPRTA comparative study of culture-independent, library-independent genotypic methods of fecal source tracking on Environmental XPRT
Article A comparative study of culture-independent, library-independent genotypic methods of fecal source tracking. Untitled Document Culture-independent fecal source tracking methods have many potential advantages over library-depende...
https://www.environmental-expert.com/articles/a-comparative-study-of-culture-independent-library-independent-genotypic-methods-of-fecal-source-tra-4578
View source for User:S4355920 - microbewiki
Name Bench ID Date MICR3004 ==Classification== ===Higher order taxa=== Bacteria - Bacteroidetes - Bacteroidia - Bacteroidales - Porphyromonadaceae - Porphyromonas - P. gingivalis ===Species=== Species: Porphyromonas gingivalis Strain: W88 ==Description and significance== Porphyromonas gingivalis is an obligately aerobic, gram-negative bacterium belonging to the phylum Bacteroidetes. Characterised by its rod shaped morphology, it is a non-spore bearing and non-motile bacterium most commonly inhabiting the oral cavity ,sup>[[#References,[2]]],/sup>. Recognised as an opportunistic pathogen, P. gingivalis is capable of living in commensal harmony with the host ,sup>[[#References,[5]]],/sup>. Termed as a pathobiont, the bacterium causes episodes of disease when a change in the ecological balance of the periodontal microenvironment transpires ,sup>[[#References,[5]]],/sup> ,sup>[[#References,[14]]],/sup>. Although the bacterium is capable of existing as a commensal organism, ...
https://microbewiki.kenyon.edu/index.php?title=User:S4355920&action=edit&oldid=124623
Difference between revisions of Gramella forsetii - microbewiki
Members of the Bacteroidetes, formerly known as the Cytophaga-Flavobacteria-Bacteroides (CFB) phylum, are among the major taxa of marine heterotrophic bacterioplankton frequently found on macroscopic organic matter particles (marine snow). In addition, they have been shown to also represent a significant part of free-living microbial assemblages in nutrient-rich microenvironments. Their abundance and distribution pattern in combination with enzymatic activity studies has led to the notion that organisms of this group are specialists for degradation of high molecular weight compounds in both the dissolved and particulate fraction of the marine organic matter pool, implying a major role of Bacteroidetes in the marine carbon cycle. Despite their ecological importance, comprehensive molecular data on organisms of this group have been scarce so far. Here we report on the first whole genome analysis of a marine Bacteroidetes representative, Gramella forsetii KT0803. Functional analysis of the ...
https://microbewiki.kenyon.edu/index.php?title=Gramella_forsetii&diff=14801&oldid=14772
WoRMS - World Register of Marine Species - Algoriphagus marincola (Yoon, Kang & Oh, 2004) Nedashkovskaya, Vancanneyt, Van...WoRMS - World Register of Marine Species - Algoriphagus marincola (Yoon, Kang & Oh, 2004) Nedashkovskaya, Vancanneyt, Van...
additional source Nedashkovskaya, O.I., Kim, S.B., Kwon, K.K.,Shin, D.S., Xuseong, L., Kim, S.-J., and Mikhailov, V.V. Proposal of Algoriphagus vanfongensis sp. nov., transfer of members of the genera Hongiella Yi and Chun 2004 emend. Nedashkovskaya et al. 2004 and Chimaereicella Tiago et al. 2006 to the genus Algoriphagus, and emended description of the genus Algoriphagus Bowman et al. 2003 emend. Nedashkovskaya et al. 2004. Int. J. Syst. Evol. Microbiol. (2007) 57:1988-1994. [details] ...
http://www.marinespecies.org/aphia.php?p=taxdetails&id=559883
Publications | Microbiology Department at UMass Amherst
Holmes DE, Nevin KP, Woodard TL, Peacock AD, Lovley DR. 2007. Prolixibacter bellariivorans gen. nov., sp. nov., a sugar-fermenting, psychrotolerant anaerobe of the phylum Bacteroidetes, isolated from a marine-sediment fuel cell.. Int J Syst Evol Microbiol. 57(Pt 4):701-7. ...
https://www.micro.umass.edu/faculty-and-research/publications?page=5&%3Bamp%3Bs=author&%3Bamp%3Bo=asc&%3Bamp%3Bf%5Bauthor%5D=331&%3Bf%5Bauthor%5D=251&f%5Bauthor%5D=221&s=title&o=asc
Publications | Microbiology Department at UMass Amherst
Holmes DE, Nevin KP, Woodard TL, Peacock AD, Lovley DR. 2007. Prolixibacter bellariivorans gen. nov., sp. nov., a sugar-fermenting, psychrotolerant anaerobe of the phylum Bacteroidetes, isolated from a marine-sediment fuel cell.. Int J Syst Evol Microbiol. 57(Pt 4):701-7. ...
http://www.micro.umass.edu/faculty-and-research/publications?s=year&%3Bf%5Bag%5D=P&%3Bf%5Bauthor%5D=664&%3Bo=asc&f%5Bauthor%5D=274&o=desc
Amoebophrya ceratii-species complex / Tripos muelleri #2 | AQUASYMBIOAmoebophrya ceratii-species complex / Tripos muelleri #2 | AQUASYMBIO
Tripos muelleri infected by Amoebophrya ceratii-like. Photo: Catharina Alves-de-Souza. Green: cytoplasm of the parasite stained by FISH. Red: nuclei stained by propidium iodide. Blue: Host theca stained by calcofluor. ...
http://aquasymbio.fr/en/amoebophrya-ceratii-species-complex-tripos-muelleri-2
FirmicutesFirmicutes
The largest group of bacteria but somewhat less diverse than the proteobacteria. Firmicutes play an important role in beer, wine, and cider spoilage and are present in greater numbers in obese individuals (vs Bacteroidetes). The group is typically divided into the Clostridia, which are anaerobic, the Bacilli, which are obligate or facultative aerobes, and the Mollicutes. It contains approximately 2475 species, 40% of which are aggregated in just 6 genera; Lactobacillus - 100 sp., Mycoplasma - 110 sp., Bacillus - 114 sp, Clostridium 146 sp and Streptomyces 509. The Firmicutes are all gram-positive bacteria unlike the Proteobacteria which are gram-negative. The Firmicutes are further divided according to their GC ratios. This is the ratio of Guanine and Cytosine to Guanine, Cytosine, Adenine and Thymine in the cell, thus a GC ratio = G+C divided by G+C+A+T times 100. Fermicutes are either High GC or Low GC. Each of these categories contains 3 major groups. ...
http://www.aurametrix.com/topics/firmicutes
Microbiology Society Journals | Chitinophaga qingshengii sp. nov., isolated from weathered rock surfaceMicrobiology Society Journals | Chitinophaga qingshengii sp. nov., isolated from weathered rock surface
A novel mineral-weathering bacterium was isolated from weathered rock (potassic trachyte) surfaces collected from Nanjing (Jiangsu, PR China). Cells of strain JN246T were Gram-stain-negative, rod-shaped and non-motile. Strain JN246T was aerobic, catalase- and oxidase-positive, and grew optimally at 28 °C and pH 7.0. On the basis of 16S rRNA gene sequence analysis, strain JN246T belonged to the genus Chitinophaga and the closest phylogenetic relatives were Chitinophaga eiseniae YC6729T (98.5 % 16S rRNA gene sequence similarity), Chitinophaga terrae KP01T (96.8 %), and Chitinophaga jiangningensis JN53T (96.3 %). The major respiratory quinone was MK-7 and the major polyamine was homospermidine. The major fatty acids were iso-C15 : 0, C16 : 1ω5c, C16 : 0 and iso-C17 : 0 3-OH. The polar lipid profile of strain JN246T consisted of phosphatidylethanolamine, unknown aminolipids and unknown lipids. The genomic DNA G+C content of strain JN246T was 48.8 mol%. Based on the low level of DNA-DNA relatedness of
http://ijs.microbiologyresearch.org/content/journal/ijsem/10.1099/ijs.0.070516-0
Population Dynamics, Biokinetics and Gaseous Nitrogen Production from Partial Nitrification Reactors Operated Under Oxygen...Population Dynamics, Biokinetics and Gaseous Nitrogen Production from Partial Nitrification Reactors Operated Under Oxygen...
Article Population Dynamics, Biokinetics and Gaseous Nitrogen Production from Partial Nitrification Reactors Operated Under Oxygen Limited Conditions. Biological nitrogen removal based on partial nitrification and denitrification via nitrite is a cos...
https://www.environmental-expert.com/articles/population-dynamics-biokinetics-and-gaseous-nitrogen-production-from-partial-nitrification-reactors--26877
Tannerella forsythia (Tanner et al.) Sakamoto et al. ATCC ® 43037DTannerella forsythia (Tanner et al.) Sakamoto et al. ATCC ® 43037D
Tannerella forsythia ATCC ® 43037D-5™ Designation: Genomic DNA from Tannerella forsythia strain FDC 338 TypeStrain=True Application:
https://www.atcc.org/Products/All/43037D-5.aspx?slp=1?p=1&rel=%7B0%7D
Tannerella forsythia Antibody (116BF1.2) - DSHBTannerella forsythia Antibody (116BF1.2) - DSHB
Monoclonal antibody against Tannerella forsythia, strain FDC 331 (OMZ 348) expressed by for use in Western Blot against Tannerella forsythia
http://dshb.biology.uiowa.edu/Tannerella-forsythia_2
Faecal bacterial and short-chain fatty acids signature in hypercholesterolemiaFaecal bacterial and short-chain fatty acids signature in hypercholesterolemia
from male volunteers with hypercholesterolemia (HC) and normocholesterolemia (NC) were determined by 16S rDNA sequencing, HPLC, GC and NMR, respectively. HC subjects were characterized by having lower relative abundance of Anaeroplasma (0.002% vs 0.219%, p-value = 0.026) and Haemophilus (0.041% vs 0.078%, p-value = 0.049), and higher of Odoribacter (0.51% vs 0.16%; p-value = 0.044). Correlation analysis revealed that Anaeroplasma and Haemophilus were associated to an unfavourable lipid profile: they correlated negatively to cholesterol and triglycerides related biomarkers and the ratio total to high density lipoprotein (HDL) cholesterol, and positively to HDL size. Odoribacter displayed an opposite behaviour. Faecal SCFAs profile revealed higher abundance of isobutyric (2.76% vs 0.82%, p-value = 0.049) and isovaleric acid (1.32% vs 0.06%, p-value = 0.016) in HC. Isobutyric acid correlated positively with Odoribacter and lipid parameters indicative of an unfavourable profile. BA profile did not ...
https://repositori.udl.cat/handle/10459.1/65826
Insects | Free Full-Text | Reduced Diversity in the Bacteriome of the Phytophagous Mite Brevipalpus yothersi (Acari:...Insects | Free Full-Text | Reduced Diversity in the Bacteriome of the Phytophagous Mite Brevipalpus yothersi (Acari:...
Tenuipalpidae comprises mites that transmit viruses to agriculturally important plants. Several tenuipalpid species present parthenogenesis, and in Brevipalpus yothersi, the endosymbiont Cardinium has been associated with female-only colonies. It is unclear what the bacterial composition of B. yothersi is, and how common Cardinium is in those microbiomes. We performed a comparative analysis of the bacteriomes in three populations of B. yothersi and three additional Tetranychoidea species using sequences from V4-fragment of 16S DNA. The bacteriomes were dominated by Bacteroidetes (especially Cardinium) and Proteobacteria, showing a remarkably low alpha diversity. Cardinium was present in about 22% of all sequences; however, it was not present in R. indica and T. evansi. In B. yothersi, the proportion of Cardinium was higher in adults than eggs, suggesting that proliferation of the bacteria could be the result of selective pressures from the host. This hypothesis was further supported because colonies of
http://www.mdpi.com/2075-4450/7/4/80
The gut microbiota and host health: a new clinical frontier | GutThe gut microbiota and host health: a new clinical frontier | Gut
Starting around 2004, the hallmark studies of Gordon et al demonstrated a potential relationship between the gut microbiome and development of an obese phenotype. An increase in relative abundance of Firmicutes and a proportional decrease in Bacteroidetes were associated with the microbiota of obese mice,23 which was confirmed in a human dietary intervention study demonstrating that weight loss of obese individuals (body mass index, BMI,30) was accompanied by an increase in the relative abundance of Bacteroidetes.24 Nevertheless, based on most human studies, the obesity-associated decrease in the ratio of Bacteroidetes to Firmicutes (B:F) remains controversial.24 ,25 This is likely due to heterogeneity among human subjects with respect to genotype and lifestyle. Recent studies have identified diet, especially fat, as a strong modulator of the microbiota, particularly in inbred and age-standardised laboratory animals. The sources of variation in the microbiota are mainly limited to the ...
http://gut.bmj.com/content/65/2/330.long
Obesity alters gut microb… - University of Gothenburg, SwedenObesity alters gut microb… - University of Gothenburg, Sweden
We have analyzed 5,088 bacterial 16S rRNA gene sequences from the distal intestinal (cecal) microbiota of genetically obese ob/ob mice, lean ob/+ and wild-type siblings, and their ob/+ mothers, all fed the same polysaccharide-rich diet. Although the majority of mouse gut species are unique, the mouse and human microbiota(s) are similar at the division (superkingdom) level, with Firmicutes and Bacteroidetes dominating. Microbial-community composition is inherited from mothers. However, compared with lean mice and regardless of kinship, ob/ob animals have a 50% reduction in the abundance of Bacteroidetes and a proportional increase in Firmicutes. These changes, which are division-wide, indicate that, in this model, obesity affects the diversity of the gut microbiota and suggest that intentional manipulation of community structure may be useful for regulating energy balance in obese individuals. The sequences reported in this paper have been deposited in the GenBank database [accession nos. DQ ...
https://www.gu.se/english/research/publication/?publicationId=54438
Plus itPlus it
Dietary supplementation of an HFD with GP led to dramatic changes in gut microbial community structure, including a reduction in the ratio of Firmicutes to Bacteroidetes and a bloom of A. muciniphila. These changes may confer some degree of protection from the negative consequences of an HFD. HFD and high-fat, high-sugar diets have repeatedly been shown to increase the proportion of Firmicutes to Bacteroidetes (36), a microbial community structure that is sufficient to induce increased host body fat upon transplantation into germ-free mouse recipients (7,42). Furthermore, administration of A. muciniphila, but not heat-killed cells, to HFD-fed mice can reduce host adiposity, inflammatory markers, and insulin resistance (43). Similarly, consumption of oligofructose by ob/ob mice deficient for the leptin gene leads to a marked increase in A. muciniphila abundance and similar metabolic improvements (44). A. muciniphila increases in abundance after gastric bypass surgery in humans (45) and mice (42); ...
https://diabetes.diabetesjournals.org/content/64/8/2847
Decreased gut microbiota diversity, delayed Bacteroidetes colonisation and reduced Th1 responses in infants delivered by...Decreased gut microbiota diversity, delayed Bacteroidetes colonisation and reduced Th1 responses in infants delivered by...
Objective The early intestinal microbiota exerts important stimuli for immune development, and a reduced microbial exposure as well as caesarean section (CS) has been associated with the development of allergic disease. Here we address how microbiota development in infants is affected by mode of delivery, and relate differences in colonisation patterns to the maturation of a balanced Th1/Th2 immune response.. ...
http://gut.bmj.com/content/63/4/559
Evaluation of two library-independent microbial source tracking methods to identify sources of fecal contamination in french...Evaluation of two library-independent microbial source tracking methods to identify sources of fecal contamination in french...
In order to identify the origin of the fecal contamination observed in French estuaries, two library-independent microbial source tracking (MST) methods were selected: (i) Bacteroidales host-specific...
https://archimer.ifremer.fr/doc/00000/3535/
Tannerella forsythia is associated with increased levels of atherogenic low density lipoprotein and total cholesterol in...Tannerella forsythia is associated with increased levels of atherogenic low density lipoprotein and total cholesterol in...
RODERIC (Repositori dObjectes Digitals per a lEnsenyament la Recerca i la Cultura) es el repositorio institucional de la Universitat de València. Se concibe como una ventanilla única para el acceso y la difusión de la producción digital de la Universitat. RODERIC responde al compromiso de la Universitat con el movimiento de acceso abierto al conocimiento adquirido con su adhesión a la Declaración de Berlín (30 Septiembre de 2008).
http://roderic.uv.es/handle/10550/44844
Günthers Site - Photos of European Orchids - Epipactis muelleriGünthers Site - Photos of European Orchids - Epipactis muelleri
Fig. 4: Epipactis muelleri \ Müllers Ständelwurz / Muellers Helleborine (Schaden durch Trockenheit / damage from aridity ...
http://www.guenther-blaich.de/artseite.php?par=Epipactis+muelleri&abs=artlst&lan=x&wid=1920
obesity Archives - Keto Islandobesity Archives - Keto Island
A new study published September 26, 2017 from Zachary A. Costliow, Patrick H. Degnan at the University of Illinois points out that all gut microbes require thiamine, (Vitamin B1). They discovered that the gut microbe Bacteroidetes can make their own … Read moreThiamine Affects Gut Bacteria. ...
https://www.ketoisland.com/tag/obesity/
ObesityObesity
We have all heard the saying you are what you eat. While there is a lot of truth to that statement, it is becoming clear that it may need to be updated to you are what you and your gut bacteria eat. Research into the function of the 100 trillion bacteria that call our gastrointestinal tract home has been exploding over the past few years. We now know that they are not merely uninvited house guests but instead play active roles in our health as well as metabolic activity effecting our digestion, immune function, hormonal function and mood.. One area of research that has received much attention is the discovery that gut bacteria have an effect on the development of obesity, metabolic syndrome and type 2 diabetes. People with higher levels of bacteria in the Firmicutes family and lower levels of bacteria in the Bacteroidetes family seem to be more likely to be obese and are at an increased risk of developing diabetes and metabolic syndrome. The increased risk of diabetes and metabolic syndrome ...
http://www.drpeterknight.com/category/obesity/
Changes in the population of Lactobacillus spp, Firmicu | Open-iChanges in the population of Lactobacillus spp, Firmicu | Open-i
Changes in the population of Lactobacillus spp, Firmicutes and Bacteroidetes between the control and the experimental groups in chicks.Results were based on the
https://openi.nlm.nih.gov/detailedresult.php?img=PMC2864268_pone.0010463.g001&req=4
Presence of Bacteroidales as a Predictor of Pathogens in Surface Waters of the Central California CoastPresence of Bacteroidales as a Predictor of Pathogens in Surface Waters of the Central California Coast
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
https://www.growkudos.com/publications/10.1128%25252Faem.00635-10/reader
Future Market Africa : ESB Business SchoolFuture Market Africa : ESB Business School
By Sven Rottner and Simon Züfle. How can small and medium-sized enterprises (SMEs) gain a foothold in sub-Saharan Africa? Which approaches are particularly suitable? What local conditions need to be taken into account? These are the questions addressed by the research project Doing Business in Africa headed by Professor Philipp von Carlowitz. Expanding middle class and high economic growth. Wars, corruption and disease - these three Cs still dominate the public perception of Africa. However, the continent also holds great opportunities and future markets with its growing middle class, advancing urbanization, high economic growth in numerous countries, and increasing economic integration within the continental free trade area. The research project Doing Business in Africa (DBA) at Reutlingen Universitys ESB Business School takes up these topics. The project, launched mid-June, is part of the Africa research economics cluster and is carried out in cooperation with the Kiel Institute for ...
https://www.esb-business-school.de/en/school/news/news/2021/future-market-africa/
Flavobacterium akiainvivensFlavobacterium akiainvivens
Lineage( full ) cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidetes; Flavobacteriia; ...
https://en.wikipedia.org/wiki/Flavobacterium_akiainvivens
BacteroidotaBacteroidota
Bacteroidetes phyl. nov.". In Krieg NR, Staley JT, Brown DR, Hedlund BP, Paster BJ, Ward NL, Ludwig W, Whitman WB (eds.). ... "Bacteroidetes"". List of Prokaryotic names with Standing in Nomenclature (LPSN). Retrieved June 23, 2021. Krieg NR, Ludwig W, ... The class Bacteroidia was formerly called Bacteroidetes; as it was until recently the only class in the phylum, the name was ... The phylum Bacteroidota (synonym Bacteroidetes) is composed of three large classes of Gram-negative, nonsporeforming, anaerobic ...
https://en.wikipedia.org/wiki/Bacteroidota
SaprospiralesSaprospirales
Bacteroidetes phyl. nov.". In Krieg NR, Staley JT, Brown DR, Hedlund BP, Paster BJ, Ward NL, Ludwig W, Whitman WB (eds.). ... "Genome-Based Taxonomic Classification of Bacteroidetes". Front Microbiol. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC 5167729. ...
https://en.wikipedia.org/wiki/Saprospirales
CytophagalesCytophagales
in the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 63 (Pt 4): 1219-1228. doi: ... Subcommittee on the Taxonomy of Aerobic Bacteroidetes met to discuss taxonomic changes in 2017. Additionally, García-López et ... "Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes". Front Microbiol. 10: 2083. doi: ... "Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes". Frontiers in Microbiology. 10: 2083 ...
https://en.wikipedia.org/wiki/Cytophagales
SphingobacterialesSphingobacteriales
within the phylum Bacteroidetes; includes a microaerobic filamentous bacterium isolated from specimens from diseased rodent ... 4 (The Bacteroidetes, Spirochaetes, Tenericutes (Mollicutes), Acidobacteria, Fibrobacteres, Fusobacteria, Dictyoglomi, ...
https://en.wikipedia.org/wiki/Sphingobacteriales
Mooreia alkaloidigenaMooreia alkaloidigena
in the phylum Bacteroidetes". Int J Syst Evol Microbiol. 63 (Pt 4): 1219-1228. doi:10.1099/ijs.0.043752-0. PMC 3709535. PMID ...
https://en.wikipedia.org/wiki/Mooreia_alkaloidigena
FilobacteriumFilobacterium
within the phylum Bacteroidetes; includes a microaerobic filamentous bacterium isolated from specimens from diseased rodent ...
https://en.wikipedia.org/wiki/Filobacterium
CatalimonasCatalimonas
in the phylum Bacteroidetes". Int J Syst Evol Microbiol. 63 (Pt 4): 1219-1228. doi:10.1099/ijs.0.043752-0. PMC 3709535. PMID ...
https://en.wikipedia.org/wiki/Catalimonas
Catalinimonas alkaloidigenaCatalinimonas alkaloidigena
in the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 63 (Pt_4): 1219-1228. doi: ...
https://en.wikipedia.org/wiki/Catalinimonas_alkaloidigena
BalneolalesBalneolales
Munoz R, Rosselló-Móra R, Amann R. (2016). "Revised phylogeny of Bacteroidetes and proposal of sixteen new taxa and two new ... Revised phylogeny of Bacteroidetes and proposal of sixteen new taxa and two new combinations including Rhodothermaeota phyl. ... "Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes". Front Microbiol. 10: 2083. doi: ... "Genome-Based Taxonomic Classification of Bacteroidetes". Front Microbiol. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC 5167729. ...
https://en.wikipedia.org/wiki/Balneolales
MicroscillaceaeMicroscillaceae
"Genome-Based Taxonomic Classification of Bacteroidetes". Front Microbiol. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC 5167729. ...
https://en.wikipedia.org/wiki/Microscillaceae
Bacterial phylaBacterial phyla
... later renamed Bacteroidetes Bacteroides (Bacteroides, Fusobacterium) Flavobacterium group (Flavobacterium, Cytophaga, ... "Genome-Based Taxonomic Classification of Bacteroidetes". Frontiers in Microbiology. 7: 2003. doi:10.3389/fmicb.2016.02003. ISSN ...
https://en.wikipedia.org/wiki/Bacterial_phyla
OdoribacteraceaeOdoribacteraceae
Munoz, R; Rosselló-Móra, R; Amann, R (July 2016). "Revised phylogeny of Bacteroidetes and proposal of sixteen new taxa and two ... "Genome-Based Taxonomic Classification of Bacteroidetes". Frontiers in Microbiology. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC ...
https://en.wikipedia.org/wiki/Odoribacteraceae
LewinellaceaeLewinellaceae
"Genome-Based Taxonomic Classification of Bacteroidetes". Front Microbiol. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC 5167729. ...
https://en.wikipedia.org/wiki/Lewinellaceae
BernardetiaceaeBernardetiaceae
"Genome-Based Taxonomic Classification of Bacteroidetes". Front Microbiol. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC 5167729. ...
https://en.wikipedia.org/wiki/Bernardetiaceae
Thermoflexibacter ruberThermoflexibacter ruber
"Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes". Front Microbiol. 10: 2083. doi: ... "Genome-Based Taxonomic Classification of Bacteroidetes". Front Microbiol. 7: 2003. doi:10.3389/fmicb.2016.02003. PMC 5167729. ...
https://en.wikipedia.org/wiki/Thermoflexibacter_ruber
PrevotellaceaePrevotellaceae
"Genome-Based Taxonomic Classification of Bacteroidetes". Frontiers in Microbiology. 7. doi:10.3389/fmicb.2016.02003. ISSN 1664- ...
https://en.wikipedia.org/wiki/Prevotellaceae
FulvivirgaFulvivirga
nov., a novel member of the phylum Bacteroidetes isolated from seawater in a mussel farm". International Journal of Systematic ... nov., a member of the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 62 (Pt 9): 2213 ...
https://en.wikipedia.org/wiki/Fulvivirga
Fulvivirga imtechensisFulvivirga imtechensis
nov., a member of the phylum Bacteroidetes". International Journal of Systematic and Evolutionary Microbiology. 62 (Pt 9): 2213 ...
https://en.wikipedia.org/wiki/Fulvivirga_imtechensis
Sphingobacterium thermophilumSphingobacterium thermophilum
nov., of the phylum Bacteroidetes, isolated from compost". International Journal of Systematic and Evolutionary Microbiology. ...
https://en.wikipedia.org/wiki/Sphingobacterium_thermophilum
Bacterioplankton counting methodsBacterioplankton counting methods
In this early succession stage, members of the class Flavobacteria (Bacteroidetes) are typically the dominant components of the ... "Ecology of marine Bacteroidetes: a comparative genomics approach". The ISME Journal. 7 (5): 1026-37. doi:10.1038/ismej.2012.169 ...
https://en.wikipedia.org/wiki/Bacterioplankton_counting_methods
SediminitomixSediminitomix
nov., of the phylum Bacteroidetes, isolated from marine sediment". International Journal of Systematic and Evolutionary ...
https://en.wikipedia.org/wiki/Sediminitomix
Sediminitomix flavaSediminitomix flava
nov., of the phylum Bacteroidetes, isolated from marine sediment". International Journal of Systematic and Evolutionary ...
https://en.wikipedia.org/wiki/Sediminitomix_flava
Labilibaculum filiformeLabilibaculum filiforme
nov., Novel Bacteroidetes Isolated from Subsurface Sediments of the Baltic Sea". Frontiers in Microbiology. 8: 2614. doi: ...
https://en.wikipedia.org/wiki/Labilibaculum_filiforme
Echinicola vietnamensisEchinicola vietnamensis
nov., a member of the phylum Bacteroidetes isolated from seawater". International Journal of Systematic and Evolutionary ...
https://en.wikipedia.org/wiki/Echinicola_vietnamensis
Nafulsella turpanensisNafulsella turpanensis
nov., a member of the phylum Bacteroidetes isolated from soil". International Journal of Systematic and Evolutionary ...
https://en.wikipedia.org/wiki/Nafulsella_turpanensis
Lonar LakeLonar Lake
nov., an alkaliphilic bacterium of the family 'Cyclobacteriaceae', phylum Bacteroidetes. Int J Syst Evol Microbiol 60: 2320- ... Cyanobacteria and Bacteroidetes, and endolithic archaea belonging to the phyla Thaumarchaeota and Euryarchaeota were detected ...
https://en.wikipedia.org/wiki/Lonar_Lake
NafulsellaNafulsella
nov., a member of the phylum Bacteroidetes isolated from soil". International Journal of Systematic and Evolutionary ...
https://en.wikipedia.org/wiki/Nafulsella
EchinicolaEchinicola
nov., a member of the phylum Bacteroidetes isolated from seawater". International Journal of Systematic and Evolutionary ...
https://en.wikipedia.org/wiki/Echinicola
EmticiciaEmticicia
nov., a new member of the family 'Flexibacteraceae', phylum Bacteroidetes". International Journal of Systematic and ...
https://en.wikipedia.org/wiki/Emticicia
Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of BacteroidetesAnalysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes
Bacteroidetes,/i,, there remains a need to further clarify taxonomic relationships within a diverse assemblage that includes ... Analysis of 1,000 Type-Strain Genomes Improves Taxonomic Classification of Bacteroidetes Front Microbiol. 2019 Sep 23;10:2083. ... Bacteroidetes classification has proved to be difficult, not least when taxonomic decisions rested heavily on interpretation of ... Here, draft genome sequences of a greatly enlarged collection of genomes of more than 1,000 Bacteroidetes and outgroup type ...
https://pubmed.ncbi.nlm.nih.gov/31608019/
Thermoflavifilum aggregans gen. nov., sp. nov., a thermophilic and slightly halophilic filamentous bacterium from the phylum...Thermoflavifilum aggregans gen. nov., sp. nov., a thermophilic and slightly halophilic filamentous bacterium from the phylum...
aminolipid derivative, article, bacterial strain, Bacterial Typing Techniques, Bacteroidetes, Base Composition, Chitinophaga ... nov., a thermophilic and slightly halophilic filamentous bacterium from the phylum Bacteroidetes. ... of the phylum Bacteroidetes, with the most closely related cultivated strain, Chitinophaga pinensis UQM 2034T, having 87.6 % ... position and the phenotypic characteristics separate strain P373T from all other members of the phylum Bacteroidetes and ...
https://www.callaghaninnovation.govt.nz/thermoflavifilum-aggregans-gen-nov-sp-nov-thermophilic-and-slightly-halophilic-filamentous-bacterium
Bacteroidetes Are Gram-Negative Obligate AnaerobesBacteroidetes Are Gram-Negative Obligate Anaerobes
The physician may result of resistance in the bacteroidetes are obligate anaerobes are obtained. Mostly are reported in ... Consult appropriate site under uv light red with sterile fluid of which emphasizes the bacteroidetes are two of complications. ... niches and early months of the genus fusobacterium and resilience of practicing researchers from around the bacteroidetes are ... Obligate anaerobic Gram-negative rod-shaped bacteria within the Bacteroidaceae family Kingdom Bacteria Phylum Bacteroidetes ...
https://spiritasjeff.com/qkoy31of-this.aspx
Poroelastic references (Dataset) | DOE Data ExplorerPoroelastic references (Dataset) | DOE Data Explorer
The U.S. Department of Energys Office of Scientific and Technical Information
https://www.osti.gov/dataexplorer/biblio/dataset/1169009
Browse Articles | The ISME JournalBrowse Articles | The ISME Journal
Marine bacteroidetes use a conserved enzymatic cascade to digest diatom β-mannan *Irena Beidler ...
https://www.nature.com/ismej/articles?error=cookies_not_supported&code=6f06db03-9e34-483e-b0d4-0647c04370b1
Bacterial Fats and not Just Dietary Fats Cause Heart DiseaseBacterial Fats and not Just Dietary Fats Cause Heart Disease
Bacteroidetes which usually harbor in the oral cavity and gastrointestinal tract release lipids which trigger inflammation. ... Bacteroidetes That Make Fats Cause Heart Disease. Bacteroidetes are bacteria that make distinctive fats with unusual fatty ... So the Bacteroidetes lipids have a double effect on the blood vessels: *First, the immune system sees them as a signal of ... Usually Bacteroidetes bacteria harbor in the mouth and does not infect the blood vessels. No matter where they are located, the ...
https://www.medindia.net/news/healthinfocus/bacterial-fats-and-not-just-dietary-fats-cause-heart-disease-174309-1.htm
The Bacteroidetes Q-Rule: Pyroglutamate in Signal Peptidase I Substrates - IBB PAS RepositoryThe Bacteroidetes Q-Rule: Pyroglutamate in Signal Peptidase I Substrates - IBB PAS Repository
In Bacteroidetes, but not the entire FCB group or related phyla, signal peptide cleavage exposes N-terminal glutamine residues ... Bacteroidetes feature prominently in the human microbiome, as major colonizers of the gut and clinically relevant pathogens ... Here, we reveal a new Bacteroidetes specific feature in the otherwise widely conserved Sec/SPI (Sec translocase/signal ... Reanalysis of published mass spectrometry data for five Bacteroidetes species shows that the newly exposed glutamines are ...
http://eprints.ibb.waw.pl/1786/
The Ice Diet | NutritionFacts.orgThe Ice Diet | NutritionFacts.org
The reference to phytonutrients altering gut flora was an allusion to my previous video, Tipping Firmicutes to Bacteroidetes. ...
https://nutritionfacts.org/video/the-ice-diet/
M. Czjzek | Semantic ScholarM. Czjzek | Semantic Scholar
Environmental and Gut Bacteroidetes: The Food Connection. *F. Thomas, J. Hehemann, É. Rebuffet, M. Czjzek, G. Michel ... This review presents the current knowledge on the role and mechanisms of polysaccharide degradation by Bacteroidetes in their ...
https://www.semanticscholar.org/author/M.-Czjzek/6571937
Role of Gut Microbiota in HBV Disease Progression and TreatmentRole of Gut Microbiota in HBV Disease Progression and Treatment
Higher Bacteroidetes/firmicutes ratio meant a higher burden of LPS exposure. 48. HBV (n =23),. CHB (n =28),. LC (n = 25),. vs. ... Firmicutes/Bacteroidetes ratio increase is an independent predictor for CHB cirrhosis. • Veillonella is positively correlated ...
https://www.medscape.com/viewarticle/968056
Nutrients | Free Full-Text | Food Components and Dietary Habits: Keys for a Healthy Gut Microbiota CompositionNutrients | Free Full-Text | Food Components and Dietary Habits: Keys for a Healthy Gut Microbiota Composition
and Bacteroidetes. Vandeputte et al. [56] assessed the effects of inulin consumption on stool frequency in healthy adults with ... Bacteroidetes consists of predominant genera such as Bacteroides and Prevotella. The Actinobacteria phylum is proportionally ... Several animal studies [68,69] described a decrease in Bacteroidetes and an increase in Firmicutes and Proteobacteria in mice ... This evidence suggests that an HGD and/or HFrD can shape the gut microbiota, increasing the Firmicutes-to-Bacteroidetes ratio ...
https://www.mdpi.com/2072-6643/11/10/2393/htm
Advanced Search Results - Public Health Image Library(PHIL)Advanced Search Results - Public Health Image Library(PHIL)
Categories: Bacteroidetes Image Types: Photo, Illustrations, Video, Color, Black&White, PublicDomain, CopyrightRestricted 47 ...
https://phil.cdc.gov/AdvancedSearchResults.aspx?Search=Bacteroidetes&parentid=3939&catid=41577
Cultivated single-stranded DNA phages that infect marine bacteroidetes prove difficult to detect with DNA-binding stains -...
Dive into the research topics of Cultivated single-stranded DNA phages that infect marine bacteroidetes prove difficult to ... Cultivated single-stranded DNA phages that infect marine bacteroidetes prove difficult to detect with DNA-binding stains. ...
https://experts.arizona.edu/en/publications/cultivated-single-stranded-dna-phages-that-infect-marine-bacteroi/fingerprints/
Frontiers | Physicochemical Drivers of Microbial Community Structure in Sediments of Lake Hazen, Nunavut, CanadaFrontiers | Physicochemical Drivers of Microbial Community Structure in Sediments of Lake Hazen, Nunavut, Canada
High-throughput amplicon sequencing of the 16S rRNA gene uncovered a community dominated by Proteobacteria, Bacteroidetes, and ... High-throughput amplicon sequencing of the 16S rRNA gene uncovered a community dominated by Proteobacteria, Bacteroidetes, and ... Thomas, F., Hehemann, J.-H., Rebuffet, E., Czjzek, M., and Michel, G. (2011). Environmental and gut bacteroidetes: the food ... High-throughput amplicon sequencing of the 16S rRNA gene uncovered a community dominated by Proteobacteria, Bacteroidetes, and ...
https://www.frontiersin.org/articles/10.3389/fmicb.2018.01138/full
MicrobiologyMicrobiology
The sialate O-acetylesterase EstA from gut Bacteroidetes species enables sialidase-mediated cross-species foraging of 9-O- ...
https://www.jbc.org/Microbiology?startPage=&KeywordRaw=Escherichia%20coli%20
View source for Stenothermobacter spongiae - microbewiki
Bacteroidetes; Flavobacteriia; Flavobacteriaceae; Nonlabens (1). ===Species=== ,I>Stenothermobacter spongiae,/I> ===Strain=== ...
https://microbewiki.kenyon.edu/index.php?title=Stenothermobacter_spongiae&action=edit
Dubow, Michael (19..-....). [WorldCat Identities]Dubow, Michael (19..-....). [WorldCat Identities]
The most abundant bacterial phyla belonged to the Bacteroidetes, Proteobacteria and Firmicutes phyla that were different ... Les phylums prédominants sont les Proteobacteria, Actinobacteria, Bacteroidetes et Gemmatimonadetes. Les genres les plus ... Members belonging to the Proteobacteria, Bacteroidetes, Chloroflexi, Firmicutes, Acidobacteria and Actinobacteria phyla were ...
http://worldcat.org/identities/viaf-197208349/
Liver Disease and the Gut MicrobiomeLiver Disease and the Gut Microbiome
A reduction in Bacteroidetes populations with an increase in Firmicutes species may be the cause,[43] although human studies ... with a lower proportion of Bacteroidetes and a higher proportion of Firmicutes populations in their microbiome.[5] Whether ... associated with a microbiome containing increased Bacteroidetes and reduced quantities of Firmicutes. ... patients with NAFLD have lower quantities of Firmicutes species compared with controls with similar quantities of Bacteroidetes ...
https://www.medscape.com/viewarticle/875047_2
modernmodern
Bacteroidetes Ratio so Important?. Until … Read More Health & LifestyleDestroying, Gut, lifestyle, Microbiome, modern What Is ...
https://www.fsa-sky.org/tag/modern
TCDB » SEARCHTCDB » SEARCH
Bacteroidetes/Chlorobi group. TonB receptor of Pedobacter heparinus. 1.B.14.6.8. Putative OMR (DUF4480) of 709 aas and one N- ...
https://tcdb.org/search/result.php?tc=1.B.14.4
Volume 68, Issue 2 | Microbiology SocietyVolume 68, Issue 2 | Microbiology Society
Bacteroidetes * Nemorella caseinilytica gen. nov., sp. nov., isolated from forest soil Dhiraj Kumar Chaudhary, Ram Hari Dahal ... strains J116-2T and J116-1 formed a distinct lineage within the family Chitinophagaceae of the phylum Bacteroidetes and were ... the phylum Bacteroidetes , with highest sequence similarity to Polaribacter butkevichii KMM 3938T (99.3 %) and 93.3-98.6 % to ...
https://www.microbiologyresearch.org/content/journal/ijsem/68/2
PRIME PubMed | Intake of whole-grain and fiber-rich rye bread versus refined wheat bread does not differentiate intestinal...PRIME PubMed | Intake of whole-grain and fiber-rich rye bread versus refined wheat bread does not differentiate intestinal...
However, we detected a 37% decrease of Bacteroidetes (P , 0.05) in parallel to a 53% decrease in the alkylrecorsinol ... However, we detected a 37% decrease of Bacteroidetes (P , 0.05) in parallel to a 53% decrease in the alkylrecorsinol ...
https://www.unboundmedicine.com/medline/citation/23514765/Intake_of_whole_grain_and_fiber_rich_rye_bread_versus_refined_wheat_bread_does_not_differentiate_intestinal_microbiota_composition_in_Finnish_adults_with_metabolic_syndrome_
Speaker InformationSpeaker Information
For our experiments, we are attempting to quantify the abundance of firmicutes and bacteroidetes within the feces of our mice. ... This urbanization gradient is reflected in stool metagenomes and reveals a loss of Bacteroidetes, notably Prevotella copri, and ... hAPP-KI mice had significant increases in S24-7 (Bacteroidetes) and decreases in Allobaculum (Firmicutes) respectively. No ... While proportions of Actinobacteria, Bacteroidetes, and Proteobacteria declined with age, the opposite trend was observed with ...
https://www.niehs.nih.gov/news/events/pastmtg/2021/ieemhh_2021/speakers/index.cfm
Station and train surface microbiomes of Mexico Citys metro (subway/underground) | Scientific ReportsStation and train surface microbiomes of Mexico City's metro (subway/underground) | Scientific Reports
The main phyla detected were Actinobacteria, Firmicutes, Proteobacteria, Cyanobacteria, Bacteroidetes, Chloroflexi, ...
https://www.nature.com/articles/s41598-020-65643-4?error=cookies_not_supported&code=77e9cd9c-81ba-4453-a93d-862ebd14167e
CAZy - Bacteria
Lineage: cellular organisms; Bacteria; FCB group; Bacteroidetes/Chlorobi group; Bacteroidota; Bacteroidia; Bacteroidales; ...
http://www.cazy.org/b21456.html
Gut symbiotic microbes imprint intestinal immune cells with the innate receptor SLAMF4 which contributes to gut immune...Gut symbiotic microbes imprint intestinal immune cells with the innate receptor SLAMF4 which contributes to gut immune...
F) Faecal DNA analysed for proportions (normalised to total bacteria) of Bacteroidetes and Firmicutes by qPCR. Data displayed ... QPCR primers and conditions for Firmicutes, Bacteroidetes and all bacteria were described previously.30 The experimental set-up ... Development of a real-time PCR method for Firmicutes and Bacteroidetes in faeces and its application to quantify intestinal ... The common prophylactic therapy for bowel surgery is ineffective for clearing Bacteroidetes, the primary inducers of systemic ...
https://gut.bmj.com/content/67/5/847
Peripheral blood microbial signatures in COPD | bioRxivPeripheral blood microbial signatures in COPD | bioRxiv
Both Bacteroidetes and Proteobacteria have been identified in lung tissue (14,26,47,48), with Bacteroidetes relative abundance ... Bacteroidetes and Proteobacteria. We observed significant associations between Bacteroidetes inferred abundance and lymphocyte ... However, the neutrophil-percentage finding for Proteobacteria, and the Bacteroidetes results for percent emphysema and lung ... At the phylum level, we identified Proteobacteria, Actinobacteria, Firmicutes, and Bacteroidetes. Once believed sterile, ...
https://www.biorxiv.org/content/10.1101/2020.05.31.126367v1.full
BacteriaProteobacteriaPhylumFirmicutes to BacteroidetesPhylaRatioSpeciesBacterialObeseGenomesTaxonomicMarineMicrobiomeLactobacillusMiceHumanSampleActinobacteriaRatioAbundanceMicrobiotaBacteroidesPrevotellaSpeciesProportionFecalCyanobacteriaPhylum levelObesityRatiosFusobacteriaBacteroidotaLactobacillusGram-positiveBacteria calledDecreasePopulationsDifferencesSignificantlyOrderLevelsFewer
Bacteria7
  • Although considerable progress has been made in recent years regarding the classification of bacteria assigned to the phylum Bacteroidetes , there remains a need to further clarify taxonomic relationships within a diverse assemblage that includes organisms of clinical, piscicultural, and ecological importance. (nih.gov)
  • Bacteroidetes, a type of bacteria found in the oral cavity and gastrointestinal tract synthesize lipids which have a different chemical structure and composition. (medindia.net)
  • Bacteroidetes are bacteria that make distinctive fats with unusual fatty acids with branched chains and odd numbers of carbons. (medindia.net)
  • Usually Bacteroidetes bacteria harbor in the mouth and does not infect the blood vessels. (medindia.net)
  • This review presents the current knowledge on the role and mechanisms of polysaccharide degradation by Bacteroidetes in their respective habitats and addresses the potential links between gut and environmental bacteria through food consumption. (semanticscholar.org)
  • The kinds of bacteria in our gastrointestinal tract fall into five main phyla: Bacteroidetes, Firmicutes, Actinobacteria, Proteobacteria and Verrucomicrobia. (xshotpix.com)
  • Higher pH can inhibit bacteria from the Bacteroidetes and Firmicutes phylas [6]. (juniperpublishers.com)
Proteobacteria5
  • High-throughput amplicon sequencing of the 16S rRNA gene uncovered a community dominated by Proteobacteria, Bacteroidetes, and Chloroflexi, similar to those found in other cold and oligotrophic lake sediments. (frontiersin.org)
  • Results The four phyla with highest abundance across all subjects were Proteobacteria, Actinobacteria, Firmicutes and Bacteroidetes. (biorxiv.org)
  • After donor-feces infusion, patients showed increased fecal bacterial diversity, similar to that in healthy donors, with an increase in Bacteroidetes species and clostridium clusters IV and XIVa and a decrease in Proteobacteria species. (nejm.org)
  • Upon analyzing the animals' gut microbiome composition, the research team found that Proteobacteria and Bacteroidetes remained in the system following antibiotic treatment in Western diet-fed deficient male mice. (naturalnews.com)
  • 0.05) the RA of Firmicutes and Bacteroidetes and enhanced Proteobacteria . (researchsquare.com)
Phylum3
  • We directly detected the causative pathogenic bacterial species in both samples belonged to the phylum microbe in a clinical human sample (diarrheic feces) by Bacteroidetes, the normal fl ora of the human intestine. (cdc.gov)
  • Certain soluble polysaccharides match with bacteroidetes (phylum). (bakingbusiness.com)
  • The genus Tenacibaculum belongs to the family Flavobacteriaceae within the phylum Bacteroidetes . (beilstein-journals.org)
Firmicutes to Bacteroidetes2
  • Microbial diversity (alpha- and beta diversity) will be assessed, as well as the Firmicutes to Bacteroidetes ratio. (usda.gov)
  • The ratio of firmicutes to bacteroidetes consistently decreased in RG-fed rats and increased for HF-fed rats over the 24 wk period. (cdc.gov)
Phyla2
  • In Bacteroidetes, but not the entire FCB group or related phyla, signal peptide cleavage exposes N-terminal glutamine residues in most SPI substrates. (waw.pl)
  • We detected no evident trend in the distribution of the predominant bacterial phyla, Bacteroidetes and Firmicutes. (ias.ac.in)
Ratio3
  • Why Is the Firmicutes vs. Bacteroidetes Ratio so Important? (fsa-sky.org)
  • Centrifugation and consequent filtration of rumen fluid subjected to the eDNA isolation procedure considerably changed the ratio of molecular operational taxonomic units (MOTUs) of Bacteroidetes and Firmicutes. (elsevier.com)
  • The propensity of obese humans and mice have a higher Firmicutes/ Bacteroidetes ratio [4]. (juniperpublishers.com)
Species2
  • Reanalysis of published mass spectrometry data for five Bacteroidetes species shows that the newly exposed glutamines are cyclized to pyroglutamate (also termed 5-oxoproline) residues. (waw.pl)
  • A number of the species in this group are defined as obesity-related, which includes Firmicutes and Bacteroidetes. (juniperpublishers.com)
Bacterial1
  • Lipids from the Bacteroidetes signals bacterial invasion and they can easily pass through cell membranes and accumulate in the atheroma. (medindia.net)
Obese1
  • [ 38 , 39 ] Greater enzymatic activity for carbohydrate metabolism and increased availability of short-chain fatty acids as energy have been noted in obese patients, with a lower proportion of Bacteroidetes and a higher proportion of Firmicutes populations in their microbiome. (medscape.com)
Genomes1
  • Here, draft genome sequences of a greatly enlarged collection of genomes of more than 1,000 Bacteroidetes and outgroup type strains were used to infer phylogenetic trees from genome-scale data using the principles drawn from phylogenetic systematics. (nih.gov)
Taxonomic1
  • Bacteroidetes classification has proved to be difficult, not least when taxonomic decisions rested heavily on interpretation of poorly resolved 16S rRNA gene trees and a limited number of phenotypic features. (nih.gov)
Marine1
  • nov., two novel Bacteroidetes isolated from the marine sediment. (bvsalud.org)
Microbiome1
  • Bacteroidetes feature prominently in the human microbiome, as major colonizers of the gut and clinically relevant pathogens elsewhere. (waw.pl)
Lactobacillus1
  • Mikrobiota jelitowa pacjentów cierpiących na depresję charakteryzowała się niższą liczebnością bakterii z typu Firmicutes, do którego należą bakterie kwasu mlekowego z rodzaju Lactobacillus , oraz wyższą liczebnością bakterii z typu Bacteroidetes, w którym wyróżnia się niekorzystne bakterie oportunistyczne [Liu i wsp. (ekosynbiotyk.pl)
Mice1
  • In lean mice, they discovered that they contain low amounts of Bacteroidetes and high amounts of Firmicutes. (ipl.org)
Human1
  • The marked chemical differences between the human body's native lipids and the Bacteroidetes lipids may be the reason they cause disease, suggests Nichols. (medindia.net)
Sample1
  • Deep sequencing analysis of iDNA samples revealed the prevalence of Bacteroidetes and similarity of samples frozen with and without cryoprotectants, which differed from sample stored with ethanol at room temperature. (elsevier.com)
Actinobacteria14
  • Results also showed a higher percentage relative abundance (%RA) of phyla Actinobacteria ( P = .027), lower Bacteroidetes ( P = .004), and similar Firmicutes and Proteobacteria in the PCOS group compared with the non-PCOS group. (medscape.com)
  • For instance, a study reported that fish skin were rich in Firmicutes and Actinobacteria, whereas the gills were dominated by Proteobacteria and Bacteroidetes which may be related to the gas exchange process of fish ( 2 ). (frontiersin.org)
  • Firmicutes , Actinobacteria , Proteobacteria and Bacteroidetes are the main bacteria in phylum level with the content of 75.39%,14.63%,5.69% and 2.42% in abundance. (researchsquare.com)
  • Experiments conducted in the absence of oxygen (anaerobiosis) led to the isolation of bacteria pertaining to four phyla (83% Firmicutes , 15% Actinobacteria , 1% Proteobacteria and 0.5% Bacteroidetes , whereas those conducted in the presence of oxygen (aerobiosis) led to the isolation of bacteria affiliated to two phyla only (90% Firmicutes and 10% Proteobacteria ). (biomedcentral.com)
  • The main phyla identified in the wastewater were Proteobacteria, Bacteroidetes, Chloroflexi, Planctomycetes and Actinobacteria. (csic.es)
  • When it comes to fecal samples, these methods tend to over-represent the abundance of Bacteroidetes and Proteobacteria and underestimate the abundance of Firmicutes and Actinobacteria (Figure 2). (zymoresearch.com)
  • Bacterial community analysis indicated a higher diversity with representatives belonging to Proteobacteria, Actinobacteria and Bacteroidetes. (uib.no)
  • Probe intensities were higher for Firmicutes, Proteobacteria, and Actinobacteria in the patients with CDAD, compared with controls, whereas probe intensities for Bacteroidetes were lower. (arctichealth.org)
  • A total of 5/7 phyla with relative frequencies were identified above 0.1% (Actinobacteria, Bacteroidetes, Firmicutes, Proteobacteria, Verrucomicrobia). (elsevier.com)
  • Actinobacteria, Bacteroidetes, Firmicutes and Proteobacteria were highly represented-consistent with the American Gut Project. (nih.gov)
  • The predominant phyla present in both indoor and outdoor cats were Firmicutes, Bacteroidetes, Actinobacteria, and Proteobacteria . (wmich.edu)
  • In receiving waters and reference lakes, Bacteroidetes, Actinobacteria, Planctomycetes, and Verrucomicrobia were more prevalent.Wastewater is known to be a hotspot for antibiotic resistance gene (ARG) dissemination and evolution. (uwaterloo.ca)
  • Bacteroidetes, Firmicutes and Actinobacteria were the three dominant phyla and Prevotella ruminicola was the most abundant species. (udl.cat)
  • Four races - aka bacterial phyla Firmicutes , Bacteroidetes , Proteobacteria , and Actinobacteria - account for the majority of bacterial nations present in the human gut (Khanna and Tosh, 2014 ). (weebly.com)
Ratio14
  • What does it mean if your Firmicutes:Bacteroidetes Ratio result is too high? (healthmatters.io)
  • The one with the higher ratio of Firmicutes to Bacteroidetes will absorb more calories than the other and be more apt to gain weight while eating the exact same diet . (qgenics.com)
  • We observed that the ratio of Firmicutes to Bacteroidetes evolves during different life stages. (beds.ac.uk)
  • In general terms the Firmicutes to Bacteroidetes ratio is regarded to be of significant relevance in human gut microbiota composition [ 7 ]. (beds.ac.uk)
  • In obese humans, the ratio of bacteroidetes to firmicutes in particular was shifted in favour of firmicutes. (akademien-schweiz.ch)
  • Analysis of intestinal bacterial flora showed a significant decrease the ratio of Firmiscutes / Bacteroidetes in constipation group due to intake of malted-rice amazake. (researchgate.net)
  • Coarse, but not finely ground, dietary fibre increases intestinal Firmicutes/Bacteroidetes ratio and reduces diarrhoea induced by experimental infection in piglets. (teagasc.ie)
  • All treatments increased microbial diversity, the Firmicutes/Bacteroidetes ratio, and the abundance of the genus Blautia in fecal samples. (unl.edu)
  • The ratio of firmicutes to bacteroidetes consistently decreased in RG-fed rats and increased for HF-fed rats over the 24 wk period. (cdc.gov)
  • The Firmicutes/Bacteroidetes ratio was higher after touching inoculant-enriched compared to non-enriched sand materials. (helsinki.fi)
  • The ratio of Bacteroidetes to Firmicutes bacteria is considered a biomarker for obesity. (naturecity.com)
  • Fecal analyses demonstrated a shift from a dominance of Firmicutes to Bacteroidetes phylum in the b1/2-ARs KO chimera, resulting in a reduction in Firmicutes/Bacteroidetes ratio. (nih.gov)
  • However, the Firmicutes to Bacteroidetes (F/B) ratio was significantly lower in the b1/2-ARs KO chimera compared to the C57 control chimera. (nih.gov)
  • B) The decreased F/B ratio is attributed to the significant expansion of Bacteroidetes and contraction of Firmicutes. (nih.gov)
Abundance9
  • White women (n = 10) had greater abundance of Firmicutes (23 ± 0.15 vs. 16% ± 0.75, p = 0.007) and Bacteroidetes (24 ± 0.14 vs. 19% ± 0.68, p = 0.015) compared with non-White women (n = 6). (nih.gov)
  • In the 11 paired specimens, Bacteroidetes increased in abundance from baseline to follow-up. (nih.gov)
  • In the SAP group, the abundance of Bacteroidetes and Firmicutes was decreased, and there was a higher proportion of Proteobacteria at the phylum level. (medscimonit.com)
  • [ 13 , 14 ] At 2 weeks, babies later diagnosed with colic had significantly less microbial diversity and stability than their healthy counterparts, as well as more than twice the abundance of proteobacteria and significantly reduced levels of Bacteroidetes. (medscape.com)
  • All three TRP-KO models have reduced microbial diversity, harbor higher abundance of Bacteroidetes, and reduced proportion of Firmicutes. (preprints.org)
  • while A1V1dKO mice exhibit higher Bacteroidetes, Bacteroides and S24-7 and lower Firmicutes, Ruminococcaceae, Oscillospira, Lactobacillus and Sutterella abundance. (preprints.org)
  • Sequencing of 16S ribosomal RNA genes revealed a relative abundance of Bacteroidetes and Verrucomicrobia bacteria in mice fed alcohol compared with a relative predominance of Firmicutes bacteria in control mice. (jcvi.org)
  • higher abundance of #Bacteroidetes . (metabiom.org)
  • A decreased abundance of the Bacteroidetes and Ruminococcaceae as well as an increased abundance of Lactobacillaceae and Veillonellaceae and Dorea were the most frequently reported changes among NAFLD patients in 4/13, 5/13, 4/13, 2/13, and 3/13 studies, respectively. (uni-frankfurt.de)
Microbiota7
  • Piceatannol altered the composition of the gut microbiota by increasing Firmicutes and Lactobacillus and decreasing Bacteroidetes. (liquid-nutrition-vitamins.com)
  • C. leptum and C. coccoides species were highly represented in the microbiota of infants, while elderly subjects exhibited high levels of E. coli and Bacteroidetes . (beds.ac.uk)
  • Principal microbiota shifts during exacerbation were in either Proteobacteria , Firmicutes or Bacteroidetes . (plos.org)
  • Bacteroidetes are nonendospore-forming anaerobes with bile resistance, accounting for more than 25% of gastrointestinal microbiota [13-15]. (atpase-signaling.com)
  • In addition, Bacteroidetes help maintain the balance in gastrointestinal microbiota [17, 19]. (atpase-signaling.com)
  • Microbiota tends to become diverse with the appearance of the supremacy of Bacteroidetes and Firmicutes that resemble the adult microbiota. (byjus.com)
  • According to a review in Clinical Gastroenterology and Hepatology, "Treating Clostridium difficile Infection with Fecal Microbiota Transplantation," published by Johan Bakken and colleagues, in August 2011, fecal transplantation corrects the abnormal microbial milieu (deficient in members of the Bacteroidetes phylum ) and restores a healthy gut flora with a composition resembling that of the fecal donor. (careandcost.com)
Bacteroides1
  • The second most common were Bacteroidetes species (primarily in the Bacteroides genus), which help us mammals digest food. (wesa.fm)
Prevotella2
  • The results supported previous notions that RG-I is metabolized by a distinct bacterial consortium which includes Bacteroidetes, Prevotella, and Bifidobacterium species. (nutraceuticalsworld.com)
  • Structure-Function Analysis of a Mixed-linkage beta-Glucanase/Xyloglucanase from the Key Ruminal Bacteroidetes Prevotella bryantii B14. (nih.gov)
Species4
  • We directly detected the causative pathogenic bacterial species in both samples belonged to the phylum microbe in a clinical human sample (diarrheic feces) by Bacteroidetes, the normal fl ora of the human intestine. (cdc.gov)
  • The bacteria endowed with this talent are species of Sa-pro-spira , gliding members of the phylum Bacteroidetes. (asmblog.org)
  • Certain species of bacteria, like the Bacteroidetes, are present in samples taken during the dry seasons, but their levels declined significantly during the wet season. (taconic.com)
  • But losing weight is not as easy as nourishing Bacteroidetes and eradicating Firmicutes , as each of these groups contains thousands of species with different roles in the gut. (weebly.com)
Proportion2
  • Gordon's team also found that dieting increased the relative proportion of bacteroidetes. (akademien-schweiz.ch)
  • At the conclusion of the study, the researchers noted a 37% increase in the proportion of Bacteroidetes bacteria relative to Firmicutes bacteria after broccoli consumption. (naturecity.com)
Fecal3
  • Human obesity has been associated with reduced proportions of Bacteroidetes , and correspondingly increased abundances of Firmicutes in fecal samples. (horsetalk.co.nz)
  • We will use Bacteroidetes as indicator organisms for fecal contamination because of differences between the types of Bacteroidetes found in different hosts (humans, poultry, swine, and ruminants). (usda.gov)
  • The fecal microbiome was enriched in Bacteroidetes but depleted of Firmicutes. (bioblast.at)
Cyanobacteria1
  • Specific bacteria, such as ones from Cyanobacteria and Bacteroidetes, were more abundant in the house dust of residents with asthma, atopy, or hay fever. (nih.gov)
Phylum level1
  • At the phylum level, Bacteroidetes and Firmicutes showed the most difference between groups of varying severities of autism. (nih.gov)
Obesity1
  • Of the many types of anaerobes, the two that are most directly involved with obesity are the Bacteroidetes and Firmicutes. (qgenics.com)
Ratios4
  • Imagine two identical twins eating exactly 2,000 calories, but with different ratios of Bacteroidetes to Firmicutes. (qgenics.com)
  • 2010. Bacteroidetes/Firmicutes Ratios in Mus musculus are Affected by Saturation of Dietary Fatty Acids. (swarthmore.edu)
  • Well, bacteria in the Firmicutes and Bacteroidetes families make up around 90 percent of all bacteria in our gut, so changes in their ratios can have a big effect on our health. (mindbodygreen.com)
  • Gutright Daily is a great tasting Modbiotic formula crafted from groups of natural polyphenols to help promote healthy gut bug ratios by supporting healthy firmicutes to bacteroidetes ratios. (australiansportsnutrition.com.au)
Fusobacteria1
  • In dementia7, distinct pattern difference were noted (Fig. 3) with a decrease in Fusobacteria and an increase with Bacteroidetes . (oralhealthgroup.com)
Bacteroidota1
  • Many members of the phylum Bacteroidota (formerly called Bacteroidetes) adhere to and move on solid surfaces. (bvsalud.org)
Lactobacillus1
  • The counts of major bacterial groups Clostridium leptum, Clostridium coccoides , Bacteroidetes, Bifidobacterium, Lactobacillus and Escherichia coli were assessed by quantitative PCR (qPCR). (beds.ac.uk)
Gram-positive2
  • Bacteroidetes and Proteobacteria), but not tougher Gram-positive organisms (e.g. yeasts and spores). (zymoresearch.com)
  • Typically ~60% of the bacteria present in the human gut are either gram positive Bacteroidetes or gram negative Firmicutes ( 2005 ). (weebly.com)
Bacteria called2
  • Additionally, two separate studies detected 90% more of a healthy bacteria called bacteroidetes in lean people than in obese people. (spiritualityhealth.com)
  • Specifically, people who struggle with weight issues seem to have more of a type of bacteria called Firmicutes, while lean individuals have more Bacteroidetes. (mindbodygreen.com)
Decrease1
  • These changes have significant implications for energy homeostasis, as a 20% increase in Firmicutes and a corresponding 20% decrease in Bacteroidetes is estimated to provide an additional 150 kcal of energy per day to an adult human ( 2011 ). (weebly.com)
Populations1
  • These bacterial populations included members of the phylum Bacteroidetes , which serve as microbial conduits for fresh plant-derived carbon to reach deeper soil layers. (naturalnews.com)
Differences1
  • Data on Bacteroidetes (inversely related to triglycerides and LDL and directly related to HDL levels) and on Firmicutes (opposite trend) relative abundances suggest no differences among the three conditions. (elsevier.com)
Significantly1
  • After epidemiologic factors were controlled for, only Bacteroidetes and Firmicutes remained significantly and independently associated with development of CDAD. (arctichealth.org)
Order1
Levels4
  • Bacteroidetes was found at high levels in the severely autistic group, while Firmicutes were more predominant in the control group. (nih.gov)
  • In mouse studies, CLA increased levels of Bacteroidetes and Akkermansia muciniphila ( 5 ). (hackyourgut.com)
  • In particular, walking increases levels of the phylum Bacteroidetes. (womensfitness.co.uk)
  • 12] found no marked difference in Bacteroidetes levels between obese and normal weight subjects. (atpase-signaling.com)
Fewer1
  • So, if you want to be firm and cute, you want more Bacteroidetes, and fewer Firmicutes. (qgenics.com)
Bacterial Fats and not Just Dietary Fats Cause Heart Disease
Bacterial Fats and not Just Dietary Fats Cause Heart Disease (medindia.net)
Insects | Free Full-Text | Insect Sex Determination Manipulated by Their Endosymbionts: Incidences, Mechanisms and Implications
Insects | Free Full-Text | Insect Sex Determination Manipulated by Their Endosymbionts: Incidences, Mechanisms and Implications (mdpi.com)
The Ice Diet | NutritionFacts.org
The Ice Diet | NutritionFacts.org (nutritionfacts.org)
M. Czjzek | Semantic Scholar
M. Czjzek | Semantic Scholar (semanticscholar.org)
Light-entrained and brain-tuned circadian circuits regulate ILC3s and gut homeostasis | Nature
Light-entrained and brain-tuned circadian circuits regulate ILC3s and gut homeostasis | Nature (nature.com)
Nutrients | Free Full-Text | Food Components and Dietary Habits: Keys for a Healthy Gut Microbiota Composition
Nutrients | Free Full-Text | Food Components and Dietary Habits: Keys for a Healthy Gut Microbiota Composition (mdpi.com)
Gut Microbiota Modulate CD8 T Cell Responses to Influence Colitis-Associated Tumorigenesis: Cell Reports
Gut Microbiota Modulate CD8 T Cell Responses to Influence Colitis-Associated Tumorigenesis: Cell Reports (cell.com)
Genes | Free Full-Text | Ecology and Evolution of the Human Microbiota: Fire, Farming and Antibiotics
Genes | Free Full-Text | Ecology and Evolution of the Human Microbiota: Fire, Farming and Antibiotics (mdpi.com)
Frontiers | Physicochemical Drivers of Microbial Community Structure in Sediments of Lake Hazen, Nunavut, Canada
Frontiers | Physicochemical Drivers of Microbial Community Structure in Sediments of Lake Hazen, Nunavut, Canada (frontiersin.org)
Frontiers | Soy Protein Alleviates Malnutrition in Weaning Rats by Regulating Gut Microbiota Composition and Serum Metabolites
Frontiers | Soy Protein Alleviates Malnutrition in Weaning Rats by Regulating Gut Microbiota Composition and Serum Metabolites (frontiersin.org)
Santé mentale : l'importance de l'axe intestin-cerveau
Santé mentale : l'importance de l'axe intestin-cerveau (medscape.com)
Frontiers | Inulin Exerts Beneficial Effects on Non-Alcoholic Fatty Liver Disease via Modulating gut Microbiome and Suppressing...
Frontiers | Inulin Exerts Beneficial Effects on Non-Alcoholic Fatty Liver Disease via Modulating gut Microbiome and Suppressing... (frontiersin.org)
View source for Stenothermobacter spongiae - microbewiki
View source for Stenothermobacter spongiae - microbewiki (microbewiki.kenyon.edu)
Dubow, Michael (19..-....). [WorldCat Identities]
Dubow, Michael (19..-....). [WorldCat Identities] (worldcat.org)
Genes | Special Issue : Diabetes, Obesity and the Gut Microbiome
Genes | Special Issue : Diabetes, Obesity and the Gut Microbiome (mdpi.com)
Frontiers | Cobalamin (Vitamin B12) Induced a Shift in Microbial Composition and Metabolic Activity in an in vitro Colon...
Frontiers | Cobalamin (Vitamin B12) Induced a Shift in Microbial Composition and Metabolic Activity in an in vitro Colon... (frontiersin.org)
Modern
Modern (fsa-sky.org)
Liver Disease and the Gut Microbiome
Liver Disease and the Gut Microbiome (medscape.com)
Alistipes finegoldii in Blood Cultures from Colon Cancer Patients - Volume 13, Number 8-August 2007 - Emerging Infectious...
Alistipes finegoldii in Blood Cultures from Colon Cancer Patients - Volume 13, Number 8-August 2007 - Emerging Infectious... (wwwnc.cdc.gov)
Volume 68, Issue 2 | Microbiology Society
Volume 68, Issue 2 | Microbiology Society (microbiologyresearch.org)
PRIME PubMed | Intake of whole-grain and fiber-rich rye bread versus refined wheat bread does not differentiate intestinal...
PRIME PubMed | Intake of whole-grain and fiber-rich rye bread versus refined wheat bread does not differentiate intestinal... (unboundmedicine.com)
Frontiers | A Comparative Analysis of Ash Leaf-Colonizing Bacterial Communities Identifies Putative Antagonists of...
Frontiers | A Comparative Analysis of Ash Leaf-Colonizing Bacterial Communities Identifies Putative Antagonists of... (frontiersin.org)
The biofilm matrix: multitasking in a shared space | Nature Reviews Microbiology
The biofilm matrix: multitasking in a shared space | Nature Reviews Microbiology (nature.com)
Station and train surface microbiomes of Mexico City's metro (subway/underground) | Scientific Reports
Station and train surface microbiomes of Mexico City's metro (subway/underground) | Scientific Reports (nature.com)
Gut symbiotic microbes imprint intestinal immune cells with the innate receptor SLAMF4 which contributes to gut immune...
Gut symbiotic microbes imprint intestinal immune cells with the innate receptor SLAMF4 which contributes to gut immune... (gut.bmj.com)
Peripheral blood microbial signatures in COPD | bioRxiv
Peripheral blood microbial signatures in COPD | bioRxiv (biorxiv.org)
Metagenomic Diagnosis of Bacterial Infections - Volume 14, Number 11-November 2008 - Emerging Infectious Diseases journal - CDC
Metagenomic Diagnosis of Bacterial Infections - Volume 14, Number 11-November 2008 - Emerging Infectious Diseases journal - CDC (wwwnc.cdc.gov)
Frontiers | Scrophularia striata Extract Supports Rumen Fermentation and Improves Microbial Diversity in vitro Compared to...
Frontiers | Scrophularia striata Extract Supports Rumen Fermentation and Improves Microbial Diversity in vitro Compared to... (frontiersin.org)
Cultivation of common bacterial species and strains from human skin, oral, and gut microbiota | BMC Microbiology | Full Text
Cultivation of common bacterial species and strains from human skin, oral, and gut microbiota | BMC Microbiology | Full Text (bmcmicrobiol.biomedcentral.com)