A genus of gram-negative, anaerobic, rod-shaped bacteria. Its organisms are normal inhabitants of the oral, respiratory, intestinal, and urogenital cavities of humans, animals, and insects. Some species may be pathogenic.
Gram-negative bacteria occurring in the lower intestinal tracts of man and other animals. It is the most common species of anaerobic bacteria isolated from human soft tissue infections.
Infections with bacteria of the genus BACTEROIDES.
A species of gram-negative, anaerobic, rod-shaped bacteria originally classified within the BACTEROIDES genus. This bacterium has been isolated from the mouth, urine, feces, and infections of the mouth, soft tissue, respiratory tract, urogenital tract, and intestinal tract. It is pathogenic, but usually in association with other kinds of organisms.
A genus of gram-negative, anaerobic, rod-shaped bacteria found in cavities of humans and other animals. No endospores are formed. Some species are pathogenic and occur in various purulent or gangrenous infections.
A genus of gram-negative, anaerobic, nonsporeforming, nonmotile rods. Organisms of this genus had originally been classified as members of the BACTEROIDES genus but overwhelming biochemical and chemical findings in 1990 indicated the need to separate them from other Bacteroides species, and hence, this new genus was established.
An antibacterial agent that is a semisynthetic analog of LINCOMYCIN.
A disease of the horny parts and of the adjacent soft structures of the feet of cattle, swine, and sheep. It is usually caused by Corynebacterium pyogenes or Bacteroides nodosus (see DICHELOBACTER NODOSUS). It is also known as interdigital necrobacillosis. (From Black's Veterinary Dictionary, 18th ed)
The complete absence, or (loosely) the paucity, of gaseous or dissolved elemental oxygen in a given place or environment. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
A semisynthetic cephamycin antibiotic resistant to beta-lactamase.
Excrement from the INTESTINES, containing unabsorbed solids, waste products, secretions, and BACTERIA of the DIGESTIVE SYSTEM.
Deoxyribonucleic acid that makes up the genetic material of bacteria.
Accumulation of purulent material in tissues, organs, or circumscribed spaces, usually associated with signs of infection.
A genus of gram-negative, anaerobic, nonsporeforming, nonmotile rods or coccobacilli. Organisms in this genus had originally been classified as members of the BACTEROIDES genus but overwhelming biochemical and chemical findings indicated the need to separate them from other Bacteroides species, and hence, this new genus was created.
One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.
A family of gram-negative bacteria found primarily in the intestinal tracts and mucous membranes of warm-blooded animals. Its organisms are sometimes pathogenic.
Any tests that demonstrate the relative efficacy of different chemotherapeutic agents against specific microorganisms (i.e., bacteria, fungi, viruses).
A parasexual process in BACTERIA; ALGAE; FUNGI; and ciliate EUKARYOTA for achieving exchange of chromosome material during fusion of two cells. In bacteria, this is a uni-directional transfer of genetic material; in protozoa it is a bi-directional exchange. In algae and fungi, it is a form of sexual reproduction, with the union of male and female gametes.
A genus of gram-positive, anaerobic, coccoid bacteria that is part of the normal flora of humans. Its organisms are opportunistic pathogens causing bacteremias and soft tissue infections.
A large group of anaerobic bacteria which show up as pink (negative) when treated by the Gram-staining method.
A nitroimidazole used to treat AMEBIASIS; VAGINITIS; TRICHOMONAS INFECTIONS; GIARDIASIS; ANAEROBIC BACTERIA; and TREPONEMAL INFECTIONS. It has also been proposed as a radiation sensitizer for hypoxic cells. According to the Fourth Annual Report on Carcinogens (NTP 85-002, 1985, p133), this substance may reasonably be anticipated to be a carcinogen (Merck, 11th ed).
The ability of microorganisms, especially bacteria, to resist or to become tolerant to chemotherapeutic agents, antimicrobial agents, or antibiotics. This resistance may be acquired through gene mutation or foreign DNA in transmissible plasmids (R FACTORS).
Substances that reduce the growth or reproduction of BACTERIA.
The oval-shaped oral cavity located at the apex of the digestive tract and consisting of two parts: the vestibule and the oral cavity proper.
Nonsusceptibility of bacteria to the action of TETRACYCLINE which inhibits aminoacyl-tRNA binding to the 30S ribosomal subunit during protein synthesis.
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
A genus of motile or nonmotile gram-positive bacteria of the family Clostridiaceae. Many species have been identified with some being pathogenic. They occur in water, soil, and in the intestinal tract of humans and lower animals.
The restriction of a characteristic behavior, anatomical structure or physical system, such as immune response; metabolic response, or gene or gene variant to the members of one species. It refers to that property which differentiates one species from another but it is also used for phylogenetic levels higher or lower than the species.
Discrete segments of DNA which can excise and reintegrate to another site in the genome. Most are inactive, i.e., have not been found to exist outside the integrated state. DNA transposable elements include bacterial IS (insertion sequence) elements, Tn elements, the maize controlling elements Ac and Ds, Drosophila P, gypsy, and pogo elements, the human Tigger elements and the Tc and mariner elements which are found throughout the animal kingdom.
A naphthacene antibiotic that inhibits AMINO ACYL TRNA binding during protein synthesis.
A genus of gram-positive, rod-shaped bacteria found in cavities of man and animals, animal and plant products, infections of soft tissue, and soil. Some species may be pathogenic. No endospores are produced. The genus Eubacterium should not be confused with EUBACTERIA, one of the three domains of life.
A gram-negative gliding bacterium isolated from the oral cavity. It is a pathogen often causing PERIODONTITIS.
Animals not contaminated by or associated with any foreign organisms.
Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.
An antibiotic produced by Streptomyces lincolnensis var. lincolnensis. It has been used in the treatment of staphylococcal, streptococcal, and Bacteroides fragilis infections.
Oral tissue surrounding and attached to TEETH.
Inflammation and loss of connective tissues supporting or surrounding the teeth. This may involve any part of the PERIODONTIUM. Periodontitis is currently classified by disease progression (CHRONIC PERIODONTITIS; AGGRESSIVE PERIODONTITIS) instead of age of onset. (From 1999 International Workshop for a Classification of Periodontal Diseases and Conditions, American Academy of Periodontology)
The functional hereditary units of BACTERIA.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Proteins found in any species of bacterium.
An enzyme that catalyzes the hydrolysis of an alpha L-fucoside to yield an alcohol and L-fucose. Deficiency of this enzyme can cause FUCOSIDOSIS. EC 3.2.1.51.
The section of the alimentary canal from the STOMACH to the ANAL CANAL. It includes the LARGE INTESTINE and SMALL INTESTINE.
A rod-shaped, gram-positive, non-acid-fast, non-spore-forming, non-motile bacterium that is a genus of the family Bifidobacteriaceae, order Bifidobacteriales, class ACTINOBACTERIA. It inhabits the intestines and feces of humans as well as the human vagina.
Semisynthetic thienamycin that has a wide spectrum of antibacterial activity against gram-negative and gram-positive aerobic and anaerobic bacteria, including many multiresistant strains. It is stable to beta-lactamases. Clinical studies have demonstrated high efficacy in the treatment of infections of various body systems. Its effectiveness is enhanced when it is administered in combination with CILASTATIN, a renal dipeptidase inhibitor.
The blind sac or outpouching area of the LARGE INTESTINE that is below the entrance of the SMALL INTESTINE. It has a worm-like extension, the vermiform APPENDIX.
Enzymes found in many bacteria which catalyze the hydrolysis of the amide bond in the beta-lactam ring. Well known antibiotics destroyed by these enzymes are penicillins and cephalosporins.
A family of bacteria found in the mouth and intestinal and respiratory tracts of man and other animals as well as in the human female urogenital tract. Its organisms are also found in soil and on cereal grains.
Infections by bacteria, general or unspecified.
A film that attaches to teeth, often causing DENTAL CARIES and GINGIVITIS. It is composed of MUCINS, secreted from salivary glands, and microorganisms.
A genus of gram-negative, anaerobic cocci parasitic in the mouth and in the intestinal and respiratory tracts of man and other animals.
Naturally occurring family of beta-lactam cephalosporin-type antibiotics having a 7-methoxy group and possessing marked resistance to the action of beta-lactamases from gram-positive and gram-negative organisms.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
A pathologic process consisting in the formation of pus.
DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.
A bacteriostatic antibiotic macrolide produced by Streptomyces erythreus. Erythromycin A is considered its major active component. In sensitive organisms, it inhibits protein synthesis by binding to 50S ribosomal subunits. This binding process inhibits peptidyl transferase activity and interferes with translocation of amino acids during translation and assembly of proteins.
Enzymes which catalyze the elimination of delta-4,5-D-glucuronate residues from polysaccharides containing 1,4-beta-hexosaminyl and 1,3-beta-D-glucuronosyl or 1,3-alpha-L-iduronosyl linkages thereby bringing about depolymerization. EC 4.2.2.4 acts on chondroitin sulfate A and C as well as on dermatan sulfate and slowly on hyaluronate. EC 4.2.2.5 acts on chondroitin sulfate A and C.
A class of plasmids that transfer antibiotic resistance from one bacterium to another by conjugation.
Enzymes which catalyze the elimination of glucuronate residues from chondroitin A,B, and C or which catalyze the hydrolysis of sulfate groups of the 2-acetamido-2-deoxy-D-galactose 6-sulfate units of chondroitin sulfate. EC 4.2.2.-.
Bacteria which retain the crystal violet stain when treated by Gram's method.

The influence of a diet rich in wheat fibre on the human faecal flora. (1/1602)

The effect on the faecal flora of adding wheat fibre to a controlled diet in four healthy volunteers for a 3-week period has been observed. No change in the concentration of the bacteria in the bacterial groups counted was found, although there was a slight increase in total output associated with increased faecal weight. The predominant organisms in all subjects were non-sporing anaerobes, but the dominant species in each subject was different and was unaffected by changing the diet. Similarly, the concentration of faecal beta-glucuronidase detected in two subjects was unaltered and the concentration of clostridia able to dehydrogenate the steroid nucleus found in one subject was unaltered. It is suggested that the faecal microflora is not primarily controlled by the presence of undigested food residues in the large bowel.  (+info)

Simultaneous detection of Bacteroides forsythus and Prevotella intermedia by 16S rRNA gene-directed multiplex PCR. (2/1602)

In a 16S rRNA gene-directed multiplex PCR, Prevotella intermedia- and Bacteroides forsythus-specific reverse primers were combined with a single conserved forward primer. A 660-bp fragment and an 840-bp fragment that were specific for both species could be amplified simultaneously. A total of 152 clinical samples, subgingival plaque and swabs of three different oral mucosae, from 38 periodontitis patients were used for the evaluation.  (+info)

Characterization of bacteroides melaninogenicus. (3/1602)

Fifty-eight human isolates of Bacteroides melaninogenicus, 42 from a variety of clinical infections and the rest from normal flora, were studied for pigment production and ultraviolet light fluorescence and by forty biochemical and other tests, including end-product analysis by gas-liquid chromatography. In a number of instances, tests were repeated several times and the results were reproducible. Agar plate dilution susceptibility tests were also performed to 12 antimicrobial agents. These 58 strains could be reliably placed into three groups, corresponding to the three subspecies described, based on seven characteristics. These included acid production in peptone-yeast-glucose medium, production of n-butyric acid from peptone-yeast-glucose medium, esculin hydrolysis, starch hydrolysis, indole production, effect on milk, and lipase production. Production of hydrogen gas in peptone-yeast-fructose medium may be another distinguishing characteristic. In general there was not much difference in the susceptibility of the three groups to the various antimicrobial agents tested. Two strains had a minimal inhibitory concentration of penicillin G of 16 and 32 U/ml, respectively. Three strains did not produce a black pigment in spite of prolonged incubation on blood-containing media.  (+info)

Phylogenetic position of Chitinophaga pinensis in the Flexibacter-Bacteroides-Cytophaga phylum. (4/1602)

Comparison of the 16S rRNA gene sequence determined for Chitinophaga pinensis showed that this species is most closely related to Flexibacter filiformis in the Flexibacter-Bacteroides-Cytophaga phylum. These two chitinolytic bacteria, which are characterized by transformation into spherical bodies on ageing, belong to a strongly supported lineage that also includes Cytophaga arvensicola, Flavobacterium ferrugineum and Flexibacter sancti. The lineage is distinct from the microcyst-forming species Sporocytophaga myxococcoides.  (+info)

T cell specificity and cross reactivity towards enterobacteria, bacteroides, bifidobacterium, and antigens from resident intestinal flora in humans. (5/1602)

BACKGROUND: T cell responses to normal intestinal bacteria or their products may be important in the immunopathogenesis of chronic enterocolitis. AIMS: To investigate the T cell specificity and cross reactivity towards intestinal bacteria. PATIENTS/METHODS: T cell clones were isolated with phytohaemagglutinin from peripheral blood and biopsy specimens of inflamed and non-inflamed colon from five patients with inflammatory bowel disease (IBD) and two controls. T cell clones were restimulated with anaerobic Bacteroides and Bifidobacteria species, enterobacteria, and direct isolates of aerobic intestinal flora. T cell phenotype was analysed by single-cell immunocyte assay. RESULTS: Analysis of 96 T cell clones isolated from peripheral blood and biopsy specimens from two patients with IBD showed that both Bifidobacterium and Bacteroides species specifically stimulate proliferation of CD4+TCRalphabeta+ T cell clones from both sites and that cross reactivity exists between these anaerobic bacteria and different enterobacteria. Analysis of 210 T cell clones isolated from three patients with IBD and two controls showed that indigenous aerobic flora specifically stimulate T cell clones from peripheral blood and biopsy specimens from a foreign subject. Some of these flora specific T cell clones were cross reactive with defined enterobacteria. In addition, T cell clones stimulated by their own indigenous aerobic flora were identified in patients with IBD. CONCLUSION: Immune responses to antigens from the intestinal microflora involve a complex network of T cell specificities.  (+info)

Characterization of Bacteroides forsythus strains from cat and dog bite wounds in humans and comparison with monkey and human oral strains. (6/1602)

Bacteroides forsythus strains recovered from cat and dog bite wound infections in humans (n = 3), monkey oral strains (n = 3), and the human oral ATCC 43037 type strain were characterized by using phenotypic characteristics, enzymatic tests, whole cell fatty acid analysis, sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis, PCR fingerprinting, and 16S rDNA (genes coding for rRNA) sequencing. All three bite wound isolates grew on brucella agar supplemented with 5% sheep blood, vitamin K1, and hemin. These strains, unlike the ATCC strain and previously described monkey oral and human clinical strains, did not require N-acetylmuramic acid supplementation for growth as pure cultures. However, their phenotypic characteristics, except for catalase production, were similar to those of previously identified strains. PCR fingerprinting analysis showed differences in band patterns from the ATCC strain. Also, SDS-PAGE and whole cell fatty acid analysis indicated that the dog and cat bite wound strains were similar but not identical to the human B. forsythus ATCC 43037 type strain and the monkey oral strains. The rDNA sequence analysis indicated that the three bite wound isolates had 99.93% homology with each other and 98.9 and 99.22% homology with the human ATCC 43037 and monkey oral strains, respectively. These results suggest that there are host-specific variations within each group.  (+info)

Differential induction of colitis and gastritis in HLA-B27 transgenic rats selectively colonized with Bacteroides vulgatus or Escherichia coli. (7/1602)

Resident bacteria play an important role in initiating and perpetuating gastrointestinal inflammation. We previously demonstrated that six commensal bacteria including Bacteroides vulgatus caused more aggressive colitis and gastritis in HLA-B27 transgenic rats than did the other five bacteria without B. vulgatus. This study compared the degree of gastrointestinal inflammation in gnotobiotic HLA-B27 transgenic rats monoassociated with either B. vulgatus or Escherichia coli. Gnotobiotic transgenic rats raised in Trexler isolators were selectively colonized with either B. vulgatus or E. coli. Control rats were either germfree or colonized with six common commensal bacteria (Streptococcus faecium, E. coli, Streptococcus avium, Eubacterium contortum, Peptostreptococcus productus, and B. vulgatus [DESEP-B]). After 1 month, all the rats were killed and tissues were prepared for histologic and biochemical evaluation. Colitis induced by B. vulgatus monoassociation was almost equal to that in DESEP-B-colonized rats and was significantly more severe than E. coli-induced colitis, which was absent by histological testing and mild by colonic myeloperoxidase and interleukin-1beta concentration determinations. However, gastritis was detectable only in DESEP-B-associated rats. These studies suggest that not all resident bacteria have equal proinflammatory capabilities, since B. vulgatus alone is more active than E. coli alone in inducing colitis, and that colitis and gastritis result from different luminal bacterial stimuli.  (+info)

Anaerobic fecal bacteria of the baboon. (8/1602)

The predominant bacterial genera of baboon feces were enumerated and identified by established procedures. The predominant genera isolated were Lactobacillus, Eubacterium, Streptococcus, and Bacteroides.  (+info)

α-L-Arabinofuranosidase B25 (Bacteroides ovatus) [ME-ABFBO25] - High purity α-L-arabinofuranosidase (Bacteroides ovatus) for use in research, biochemical enzyme assays and in vitrodiagnostic analysis. EC 3.2.1.55 CAZy Family: GH43 CAS: 9067-74-7 non-reducing end alpha-L-arabinofuranosidase; alpha-L-arabinofuranoside non-reducing end alpha-L-arabinofuranosidase Recombinant. From Bacteroides ovatus. In 50% Glycerol. Specific activity: ~ 25 U/mg protein (on wheat arabinoxylan) at pH 6.5 and 40oC. Stability: | 4 years at -20oC.
It has been known for decades that many human gut bacteria have the ability to utilize a wide variety of plant polysaccharides (PS) and animal glycans for their metabolism and growth (1, 2). The members of Bacteroides, a genus with numerous species abundant in the human colon, are especially adept at utilizing the vast array of PS and glycans that arrive to the colon from the diet or are present on the mucins overlying the epithelial layer. Early studies analyzing genes necessary for starch utilization in Bacteroides thetaiotaomicron led to the identification of the sus locus (3-6), the first characterized locus of a Bacteroides species encoding a cluster of genes necessary to utilize a complex carbohydrate. It was not until the publication of the first Bacteroides genome sequence in 2003 (7) that the vast number of these polysaccharide utilization loci (PUL), as they were named (8), was appreciated. The genome of the B. thetaiotaomicron type strain contains 88 PUL with an average of 10 genes ...
Rutin and quercitrin are hydrolysed to quercetin, and robinin is hydrolysed to kaempferol, by faecal flora from healthy subjects. The enzymes required for these hydrolyses, namely alpha-rhamnosidase and beta-galactosidase, were produced by some strains of Bacteroides distasonis; other strains, however, synthesized beta-glucosidase. The last-named enzyme was also elaborated by Bacteroides uniformis and Bacteroides ovatus. All the enzymes were produced constitutively. A cell-free extract of B. distasonis containing beta-glucosidase displayed an enzymic activity of 1 mumol/10 min per 10 mg of protein. ...
Bacteroides spp. are dominant components of the phylum Bacteroidetes in the gut microbiota and prosper in glycan enriched environments. However, knowledge of the machinery of specific species isolated from humans (like Bacteroides uniformis) contributing to the utilization of dietary and endogenous sources of glycans and their byproducts is limited. We have used the cutting-edge nanopore-based technology to sequence the genome of B. uniformis CECT 7771, a human symbiont with a proven pre-clinical efficacy on metabolic and immune dysfunctions in obesity animal models. We have also used massive sequencing approaches to distinguish the genome expression patterns in response to carbon sources of different complexity during growth. At genome-wide level, our analyses globally demonstrate that B. uniformis strains exhibit an expanded glycolytic capability when compared with other Bacteroides species. Moreover, by studying the growth and whole-genome expression of B. uniformis CECT 7771 in response to different
TY - JOUR. T1 - An anaerobic bacterium, Bacteroides thetaiotaomicron, uses a consortium of enzymes to scavenge hydrogen peroxide. AU - Mishra, Surabhi. AU - Imlay, James A.. PY - 2013/12. Y1 - 2013/12. N2 - Summary: Obligate anaerobes are periodically exposed to oxygen, and it has been conjectured that on such occasions their low-potential biochemistry will predispose them to rapid ROS formation. We sought to identify scavenging enzymes that might protect the anaerobe Bacteroides thetaiotaomicron from the H2O2 that would be formed. Genetic analysis of eight candidate enzymes revealed that four of these scavenge H2O2in vivo: rubrerythrins 1 and 2, AhpCF, and catalase E. The rubrerythrins served as key peroxidases under anoxic conditions. However, they quickly lost activity upon aeration, and AhpCF and catalase were induced to compensate. The AhpCF is an NADH peroxidase that effectively degraded low micromolar levels of H2O2, while the catalytic cycle of catalase enabled it to quickly degrade ...
Define Bacteroides salivosus. Bacteroides salivosus synonyms, Bacteroides salivosus pronunciation, Bacteroides salivosus translation, English dictionary definition of Bacteroides salivosus. Noun 1. Bacteroides - type genus of Bacteroidaceae; genus of Gram-negative rodlike anaerobic bacteria producing no endospores and no pigment and living in...
S. Hsieh designed the project, performed experiments, and wrote the paper. N.T.P. generated the single CPS-expressing B. thetaiotaomicron mutants with and without GFP. D.L.D. generated the B. thetaiotaomicron Abs. S. Horvath processed the fecal colonization samples. G.S. performed the quick-freeze, deep-etch scanning electron microscopy. N.Z. assisted with peritoneal experiments. B.T.S. and B.Z. captured the india ink images. E.C.M., T.S.S., and P.M.A. guided the overall project design and assisted in data interpretation and writing of the manuscript. ...
Probiotic yogurts and pills promise better health, but the bacteria we ingest find a complex and challenging environment when they enter our gut. Food sources shift with every meal we eat, and the threat of pathogens is ever-present. In this competitive landscape, theres a clear winner already on the field: the genus Bacteroides makes up 30 percent of the bacteria in the human gut, the single most abundant genus.. Bacteroides are a successful bacterium in our gut microbiome. By offering metabolic capabilities that humans dont have, it helps us to obtain important nutrients. So why are Bacteroides so resilient? If we can understand their success, it will ultimately allow us to design probiotic formulations for human health and aid patients with an imbalance of gut bacteria, said Blanca Barquera, an associate professor of biological sciences at Rensselaer Polytechnic Institute and lead researcher on a new project investigating Bacteroides.. With support from a four-year $3 million grant from ...
382 aa; Sequence (Fasta) Identical sequences: Bacteroides vulgatus PC510: D4VC18; Bacteroides sp. 3_1_40A: E5UVJ4; Bacteroides sp. 4_3_47FAA: C6Z9F1; Bacteroides vulgatus: A6KX05; Bacteroides vulgatus str. 3975 RP4: A0A069SLD6 ...
Bacteroides coprosuis Whitehead et al. 2005 belongs to the genus Bacteroides, which is a member of the family Bacteroidaceae. Members of the genus Bacteroides in general are known as beneficial protectors of animal guts against pathogenic microorganisms, and as contributors to the degradation of complex molecules such as polysaccharides. B. coprosuis itself was isolated from a manure storage pit of a swine facility, but has not yet been found in an animal host. The species is of interest solely because of its isolated phylogenetic location. The genome of B. coprosuis is already the 5th sequenced type strain genome from the genus Bacteroides. The 2,991,798 bp long genome with its 2,461 protein-coding and 78 RNA genes and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.
Bacteroides ovatus ATCC ® 8483™ Designation: TypeStrain=True Application: Quality control strain for API and BBL products. Control strain for anaerobe identification.
Bacteroides ovatus ATCC ® 8483™ Designation: TypeStrain=True Application: Quality control strain for API and BBL products. Control strain for anaerobe identification.
Bacteroides is a genus of Gram-negative, rod-shaped bacteria. Bacteroides species are non-endospore-forming, anaerobes, and may either be motile or non-motile, depending on the species.[1] The DNA base composition is 40-48% GC. Unusual in bacterial organisms, Bacteroides membranes contain sphingolipids. They also contain meso-diaminopimelic acid in their peptidoglycan layer. Bacteroides are normally commensal, making up the most substantial portion of the mammalian gastrointestinal flora,[2] where they play a fundamental role in processing of complex molecules to simpler ones in the host intestine. As many as 1010-1011 cells per gram of human feces have been reported.[3] They can use simple sugars when available, but the main source of energy is polysaccharides from plant sources. ...
A molecular method, termed hierarchical oligonucleotide primer extension (HOPE), was used to determine the relative abundances of predominant Bacteroides spp. present in fecal microbiota and wastewaters. For this analysis, genomic DNA in feces of healthy human adults, bovines, and swine and in wastewaters was extracted and total bacterial 16S rRNA genes were PCR amplified and used as the DNA templates for HOPE. Nineteen oligonucleotide primers were designed to detect 14 Bacteroides spp. at different hierarchical levels (domain, order, cluster, and species) and were arranged into and used in six multiplex HOPE reaction mixtures. Results showed that species like B. vulgatus, B. thetaiotaomicron, B. caccae, B. uniformis, B. fragilis, B. eggerthii, and B. massiliensis could be individually detected in human feces at abundances corresponding to as little as 0.1% of PCR-amplified 16S rRNA genes. Minor species like B. pyogenes, B. salyersiae, and B. nordii were detected only collectively using a primer ...
Chondroitinase ABC is an enzyme from Bacteroides thetaiotaomicron that cleaves the endo-1,4-β-galactosaminic bonds between acetylgalactosamine and either glucuronic or i
In Ian Lipkin et al 2017 study, low bacteroides caccae was reported (on average). [Index to all posts on Study]. the elevated biotin level was due to an alteration in metabolism related to biotin synthesis by Bacteroides caccae in this mouse model. So low Vitamin B7 Fermentation of pectin and glucose, and activity of pectin-degrading enzymes in…
Accepted name: α-mannan endo-1,2-α-mannanase. Reaction: Hydrolysis of the terminal α-D-mannosyl-(1→3)-α-D-mannose disaccharide from α-D-mannosyl-(1→3)-α-D-mannosyl-(1→2)-α-D-mannosyl-(1→2)-α-D-mannosyl side chains in fungal cell wall α-mannans.. Systematic name: α-mannan glucosylmannohydrolase. Comments: The enzyme, characterized from the gut bacteria Bacteroides thetaiotaomicron and Bacteroides xylanisolvens, can also catalyse the reaction of EC 3.2.1.130, glycoprotein endo-α-1,2-mannosidase.. Links to other databases: BRENDA, EXPASY, KEGG, MetaCyc, CAS registry number: References:. 1. Hakki, Z., Thompson, A.J., Bellmaine, S., Speciale, G., Davies, G.J. and Williams, S.J. Structural and kinetic dissection of the endo-α-1,2-mannanase activity of bacterial GH99 glycoside hydrolases from Bacteroides spp. Chemistry 21 (2015) 1966-1977. [PMID: 25487964]. 2. Cuskin, F., Lowe, E.C., Temple, M.J., Zhu, Y., Cameron, E.A., Pudlo, N.A., Porter, N.T., Urs, K., Thompson, A.J., Cartmell, ...
Cooperative phenotypes are considered central to the functioning of microbial communities in many contexts, including communication via quorum sensing, biofilm formation, antibiotic resistance, and pathogenesis. The human intestine houses a dense and diverse microbial community critical to health, yet we know little about cooperation within this important ecosystem. Here we test experimentally for evolved cooperation within the Bacteroidales, the dominant Gram-negative bacteria of the human intestine. We show that during growth on certain dietary polysaccharides, the model member Bacteroides thetaiotaomicron exhibits only limited cooperation. Although this organism digests these polysaccharides extracellularly, mutants lacking this ability are outcompeted. In contrast, we discovered a dedicated cross-feeding enzyme system in the prominent gut symbiont Bacteroides ovatus, which digests polysaccharide at a cost to itself but at a benefit to another species. Using in vitro systems and gnotobiotic mouse
Bacteroides barnesiae has a size of 0.5-1.4 micrometer wide and 0.8-10.6 micrometer long that is completely anaerobic and grows at temperature of about 37C which does not require oxygen to survive. It has a cellular fatty acids including C15:0 and iso-C15:0 and in cultured media appears to be circular, raised and grayish-white colonies. Bacteroides barnesiae is predominantly found in gastrointestinal tract of humans as well as in vertebrate animals where bile is present. It gives benefits to the host if this bacterium strictly retained in the gut by hindering pathogenic microorganisms from forming colonies in the intestines. Bacteroides barnesiae play a basic role in the breakdown of polysaccharides a complex molecule into small molecules that is used by the bacterium as well as the host in order to utilize the nitrogenous substances and biotransformation of steroids and bile acids. Scientific classification: ...
Dernières PublicationsDietary pectic glycans are degraded by coordinated enzyme pathways in human colonic Bacteroides. (2018) Luis AS, Briggs J, (...)
Bacteroides barnesiae Lan et al. 2006 is a species of the genus Bacteroides, which belongs to the family Bacteroidaceae. Strain BL2T is of interest because it was isolated from the gut of a chicken and the growing awareness that the anaerobic microbiota of the caecum is of benefit for the host and may impact poultry farming. The 3,621,509 bp long genome with its 3,059 protein-coding and 97 RNA genes is a part of the Genomic Encyclopedia of Type Strains, Phase I: the one thousand microbial genomes (KMG) project.
Because conventional microflora are composed of diverse microbial societies, we asked whether single enteric bacterial species are sufficient to drive small intestinal RegIIIγ expression. As expected, a mixed microbial community recovered from a conventional mouse elicited a ∼20-fold increase in RegIIIγ expression when introduced into germ-free wild-type C57/b6 mice. In contrast, colonization with the Gram-negative symbiont Bacteroides thetaiotaomicron elicited only a 2.5-fold increase in expression, whereas the noninvasive Gram-positive L. innocua had no effect on RegIIIγ mRNA levels (Fig. 4C). These results indicate that neither organism alone was sufficient to stimulate RegIIIγ expression to conventional levels in wild-type mice. However, bacteria that are normally strictly compartmentalized in the intestinal lumen show increased mucosal adherence and invasion in mice that lack mucosal IgA (23). We therefore postulated that mucosal defenses such as secretory IgA might be sufficient to ...
Alpha-galactosidase is a glycoside hydrolase enzyme that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. It is encoded by the GLA ge
After several months the gut microbiomes between the two set of infants became more similar with one striking difference - the c-section babies had significantly lower levels of Bacteroides, a strain vital to human health.. Bacteroides are a key strain when it comes to health challenges modern societies face. A number of studies have shown Bacteroides levels are lower in people with obesity. Studies in both mice and humans show that when gut bacteria from thin subjects are transplanted into the colons of obese subjects, most subjects lose weight.. Bacteroides has also been linked with preventing anxiety, and boosting and regulating immunity to prevent inflammatory disorders. This may explain why people who were born via c-section are at increased risk for obesity and asthma.. The study is part of a larger Baby Biome study that is following thousands of newborns through childhood. ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class=publication>Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href=http://www.nrbook.com/b/bookcpdf.php>Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
Glycoside hydrolases of family GH76 are endo-acting α-mannanases. GH76 genes are found within bacteria and fungi. Bacterial GH76 enzymes cleave α-1,6-mannans, such as those found within the α-1,6-linked backbone of fungal mannoproteins and mycobacterial cell wall lipomannan and lipoarabinomannan. This family was originally created from the cloning and characterization of Aman6 from Bacillus circulans TN-31 [1], which appears to be the same enzyme as that characterized much earlier by Ballou and co-workers [2]. Aman6 degrades α-1,6-mannan to a mixture of the mannobiose and mannotriose [1]; mannotriose is the minimum substrate for the enzyme [2]. A possible GH76 enzyme has been detected within Mycobacterium smegmatis, which has the capacity to degrade α-1,6-mannooligosaccharides [3]. Additional characterized GH76 enzymes include several from Bacteroides thetaiotaomicron [4]. B. thetaiotaomicron expresses numerous GH76 enzymes. Several of these are found within polysaccharide utilization loci ...
Forty women supplied fecal samples for profiling, and magnetic resonance images were taken of their brains as they viewed images of individuals, activities or things that evoked emotional responses. The women were divided by their gut bacteria composition into two groups: 33 had more of a bacterium called Bacteroides; the remaining seven had more of the Prevotella bacteria. The Bacteroides group showed a greater thickness of the gray matter in the frontal cortex and insula, brain regions involved with the complex processing of information. They also had larger volumes of the hippocampus, a region involved in memory processing. The Prevotella group, by contrast, showed more connections between emotional, attentional and sensory brain regions and lower brain volumes in several regions, such as the hippocampus. This groups hippocampus was less active while the women were viewing negative images. They also rated higher levels of negative feelings such as anxiety, distress, and irritability after ...
Bacteroides, Bacterial Identification and Bacteria Treatment are considered an interesting alternative to the traditional indicator organisms such as E.coli
Bacteroides ovatus is a member of the human gut microbiota. The importance of this microbial consortium involves the degradation of complex dietary glycans mainly conferred by glycoside hydrolases. In this study we focus on one such catabolic glycoside hydrolase from B. ovatus. The enzyme, termed BoMan26A, is a -mannanase that takes part in the hydrolytic degradation of galactomannans. The crystal structure of BoMan26A has previously been determined to reveal a TIM-barrel like fold, but the relation between the protein structure and the mode of substrate processing has not yet been studied. Here we report residue-specific assignments for 95% of the 344 backbone amides of BoMan26A. The assignments form the basis for future studies of the relationship between substrate interactions and protein dynamics. In particular, the potential role of loops adjacent to glycan binding sites is of interest for such studies. ...
Intestinal worms continue to be bad news in most parts of the world, but theyve cohabited with humans for so long that they have evolved to interact with us in complex, even beneficial ways, as a new study published in Science on April 14 reminds us. Led by Deepshika Ramanan from New York University, a team of scientists from the US, Malaysia and Japan worked with mice which had a gene called Nod2 knocked out. Nod2-deficient mice are used as models of inflammatory bowel disease (IBD), a condition that is notably uncommon in developing nations but increasingly prevalent in developed nations.. The scientists found that a type of intestinal cell in the sick mice was defective and resulting in compromised mucus layers lining their guts. These changes in the guts environment caused normal bacterial populations in the gut to fluctuate. One species, Bacteroides vulgatus, was observed to thrive in these IBD mice. Interestingly, B. vulgatus has previously been found in humans with IBD. However, it is ...
General Information: This is the type strain for this organism and was isolated from the feces of a healthy adult. Common gastrointestinal bacterium. This group of microbes constitute the most abundant members of the intestinal microflora of mammals. Typically they are symbionts, but they can become opportunistic pathogens in the peritoneal (intra-abdominal) cavity. Breakdown of complex plant polysaccharides such as cellulose and hemicellulose and host-derived polysaccharides such as mucopolysaccharides is aided by the many enzymes these organisms produce. Bacteroides thetaiotaomicron is one of the two major Bacteroidesspecies found in the intestine. This organism has been used in studies on gut microflora composition and succession. ...
4HBR: Crystal structure of a putative periplasmic proteins (BACEGG_01429) from Bacteroides eggerthii DSM 20697 at 2.40 A resolution
[좌측부터 체질 1형 2형 3형] 1) 박테로이데스(Bacteroides) : 탄수화물을 분해하고 비타민 B2, B5, C, H를 만드는 것이 주된 기능이다. 박테리오데스 세균이 많은 속에 속하는 피실험자들 중에는 비만을 겪는 사...
While more hospitals say they meet stage 1 of the electronic health record incentive program, 53% say they still arent ready, finds study.
This investigation examined the ability of cells of Bacteroides melaninogenicus subsp. asaccharolyticus 381 to adhere to surfaces that might be important for its initial colonization of the mouth and its subsequent colonization in periodontal pockets. Of 48 asaccharolytic strains of B. melaninogenicus, 47 agglutinated human erythrocytes, whereas none of 20 fermentative strains, which included reference cultures of the subspecies intermedius and melaninogenicus, were active. Electron microscopy indicated that both asaccharolytic and fermentative strains possessed pili; hence, the presence of pili did not correlate with the hemagglutinating activities of B. melaninogenicus strains. Both asaccharolytic and fermentative B. melaninogenicus strains suspended in phosphate-buffered saline adhered in high numbers to buccal epithelial cells and to the surfaces of several gram-positive bacteria tested, including Actinomyces viscosus, A. naeslundii, A. israelii, Streptococcus sanguis, and S. mitis. B. ...
Various subspecies of Bacteroides melaninogenicus differ in their pigmentation. Subsp. asaccharolyticus produces protohaem almost exclusively, subsp. intermedicus both protohaem and a smaller proportion of protoporphyrin, and subsp. melaninogenicus mainly protoporphyrin with a trace of protohaem. As a consequence young colonies can be differentiated by their red fluorescence in u.v. light (365nm): subsp. asaccharolyticus does not fluoresce, subsp. intermedicus shows a limited fluorescence, and subsp. melaninogenicus shows a bright fluorescence. The pigments were isolated as the dimethyl esters of protohaemin and of protoporphyrin and identified by electronic spectroscopy, mass spectrometry and comparisons by t.l.c. Incorporation of delta-aminolaevulinate into these pigments was not detected, nor was porphobilinogen formation observed. Subsp. melaninogenicus grown in the presence of [14C]protohaemin formed [14C]protoporphyrin. This appears to represent a novel biological demetallation. ...
The results of a multicenter US survey using the National Committee for Clinical Laboratory Standards currently recommended methodology for measuring in vitro susceptibility of 2673 isolates of Bacteroides fragilis group species were compared from 1997 to 2000. The test panel consisted of 14 antibiotics: 3 carbapenems, 3 β-lactam-β-lactamase inhibitors, 3 cephamycins, 2 fluoroquinolones, clindamycin, chloramphenicol, and metronidazole. Declines in the geometric mean minimum inhibitory concentrations were seen with imipenem, meropenem, ampicillin-sulbactam, and the cephamycins. Increased geometric means were observed with the fluoroquinolones and were usually accompanied by an increase in resistance rates. Bacteroides distasonis shows the highest resistance rates among β-lactam antibiotics, whereas Bacteroides vulgatus shows the highest resistance levels among fluoroquinolones. B. fragilis shows the lowest resistance rates for all antibiotics. All strains were susceptible to chloramphenicol ...
Looking for online definition of Bacteroides capillosus in the Medical Dictionary? Bacteroides capillosus explanation free. What is Bacteroides capillosus? Meaning of Bacteroides capillosus medical term. What does Bacteroides capillosus mean?
We report the single-contig genome sequence of the anaerobic, mesophilic, cellulolytic bacterium, Bacteroides cellulosolvens. The bacterium produces a particularly elaborate cellulosome system, whereas the types of cohesin-dockerin interactions are opposite of other known cellulosome systems: cell-surface attachment is thus mediated via type-I interactions whereas enzymes are integrated via type-II interactions. ...
Electron microscopic studies of laboratory-passaged and animal-passaged isolates of Bacteroides fragilis showed significantly more capsular material around the latter. This observation correlated with increased survival of animal-passaged bacteria in rabbit intraperitoneal chambers and increased resistance to phagocytosis and opsonophagocytic killing by neutrophils. With an initial inoculum of 2.5 x 10(6) colony-forming units/ml, the number of bacteria surviving after incubation for 2 hr with neutrophils and pooled normal human serum was significantly (P less than 0.01) greater for animal-passaged than for laboratory-passaged bacteria. Neutrophil uptake of 14C-labeled animal-passaged and laboratory-passaged bacteria after incubation for 20 min was 45% and 63%, respectively (P less than 0.05). No significant difference in survival was found between animal-passaged and laboratory-passaged isolates of Bacteroides thetaiotaomicron. These findings suggest that on mechanism whereby the capsule of B. ...
Results One hundred and ninety six patients were recruited: 158 CRC patients, 24 adenoma patients and 14 normal colon controls (median age 70; range 35-90). Tumours were staged as 6 T0, 4 T1, 23 T2, 97 T3, 27 T4; 99 N0, 40 N1, 27 N2; 6 M1. No significant differences were seen in diversity or taxonomy between the UK and Czech cohorts. Adenoma and healthy colon control samples were taxonomically indistinct. However, CRCs were characterised by reduced Shannon diversity (p,0.01), with enrichment of organisms including Bacteroides fragilis,Fusobacterium nucleatum and under-representation of Bacteroides vulgatus,Bacteroides uniformisandFaecalibacterium prausnitzii (all q,0.01). Furthermore, we found a significant progressive reduction in the expression of Bacteroides vulgatus with advancing T stage and a corresponding increase in Fusobacterium nucleatum expression (figure). Additionaly, samples from patients with T4 tumours and cancers expressing histological and molecular markers of poor prognosis ...
Looking for online definition of corpus adiposum buccae in the Medical Dictionary? corpus adiposum buccae explanation free. What is corpus adiposum buccae? Meaning of corpus adiposum buccae medical term. What does corpus adiposum buccae mean?
ID BATHE1_1_PE75 STANDARD; PRT; 96 AA. AC BATHE1_1_PE75; A9ILJ3; DT 00-JAN-0000 (Rel. 1, Created) DT 00-JAN-0000 (Rel. 2, Last sequence update) DT 00-JAN-0000 (Rel. 3, Last annotation update) DE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate DE N-succinyltransferase; EC=2.3.1 117;AltName: Full=Tetrahydrodipicolinate DE N-succinyltransferase; Short=THDP succinyltransferase; Short=THP DE succinyltransferase; Short=Tetrahydropicolinate succinylase; DE (BATHE1_1.PE75). GN Name=dapD; OrderedLocusNames=BT_0075; OS BACTEROIDES THETAIOTAOMICRON VPI-5482. OC Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae; OC Bacteroides. OX NCBI_TaxID=226186; RN [0] RP -.; RG -.; RL -.; CC -!- SEQ. DATA ORIGIN: Translated from the HOGENOM CDS BATHE1_1.PE75. CC Bacteroides thetaiotaomicron VPI-5482 chromosome, complete genome. CC sequence. CC -!- ANNOTATIONS ORIGIN:DAPD_BART1 CC -!- CATALYTIC ACTIVITY: Succinyl-CoA + (S)-2,3,4,5-tetrahydropyridine- CC 2,6-dicarboxylate + H(2)O = CoA + ...
In this study, the genetic element flanking the BfPAI in ETBF 86-5443-2-2 and a related genetic element in NCTC 9343 were identified and characterized. The results suggest that these genetic elements are members of a new family of CTns not described previously. These putative CTns, designated CTn86 and CTn9343, for ETBF 86-5443-2-2 and NCTC 9343, respectively, differ from previously described Bacteroides species CTns in a number of ways. These new transposons do not carry tetQ, and the excision and formation of circular intermediates are not regulated by tetracycline; they are predicted to have a different mechanism of transposition; and their sequences have very limited sequence homology with CTnDOT or other described CTns.. Initial alignment results with NCTC 9343 (pattern III) and 638R (pattern II) sequences indicated that CTn9343 was ∼80 kb in length; however, further colony blot hybridizations, PCR, and sequence analysis determined that the real ends of CTn9343 define a genetic element of ...
The pentose phosphate pathway is a process of glucose turnover that produces NADPH as reducing equivalents and pentoses as essential parts of nucleotides. There are two different phases in the pathway. One is irreversible oxidative phase in which glucose-6P is converted to ribulose-5P by oxidative decarboxylation, and NADPH is generated [MD:M00006]. The other is reversible non-oxidative phase in which phosphorylated sugars are interconverted to generate xylulose-5P, ribulose-5P, and ribose-5P [MD:M00007]. Phosphoribosyl pyrophosphate (PRPP) formed from ribose-5P [MD:M00005] is an activated compound used in the biosynthesis of histidine and purine/pyrimidine nucleotides. This pathway map also shows the Entner-Doudoroff pathway where 6-P-gluconate is dehydrated and then cleaved into pyruvate and glyceraldehyde-3P [MD:M00008 ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
To the Editor.-Eikenella corrodens is a facultative gramnegative bacillus that is a normal inhabitant of the human mouth. Eikenella corrodens infection is relat
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
Summary The presence of capsulate Bacteroides spp. and anaerobic gram-positive cocci was investigated in pus specimens from 182 children with chronic orofacial infections or abscesses and in pharyngeal swabs from 26 children without inflammation. Of 216 Bacteroides spp. and anaerobic cocci isolated from clinical infections, 170 (79%) were capsulate, compared with 34 (35%) of 96 isolates from normal pharyngeal flora (p|0.001). The commonest organisms found to be capsulate more often from infected patients than from controls belonged to the B. melaninogenicus group. The possible evolution of encapsulation in these organisms and their importance in mixed orofacial infections are discussed.
[Biological activity of Bacteroides fragilis].: The investigation was performed with 9 strains of B. fragilis isolated from pregnant women in their 38th week of
Intestinal bacteria are linked to our diet. When participants in this last Danish study were divided by their level of intestinal bacteria, it was found that people with a high proportion of Prevotella bacteria compared to the bacteria Bacteroides lost 3.5 kg more in 26 weeks, they ate a diet composed of the principles of the New Nordic Diet compared to those who consumed a Danish average diet.. Subjects with a low proportion of Prevotella bacteria compared to Bacteroides did not lose any extra weight by following this new Nordic Diet. Overall, about 50% of the population has a high proportion of Prevotella bacteria compared to Bacteroides bacteria.. The study shows that only about half of the population will lose weight if it eats according to the Danish national dietary guidelines - and eats more fruits, vegetables, fiber and whole grains. The other half of the population does not seem to benefit from this change of regime. These people should focus on other feeding recommendations and ...
Gram-negative bacteria naturally produce and secrete nanosized outer membrane vesicles (OMVs). In the human gastrointestinal tract, OMVs produced by commensal Gram-negative bacteria can mediate interactions amongst host cells (including between epithelial cells and immune cells) and maintain microbial homeostasis. This OMV-mediated pathway for host-microbe interactions could be exploited to deliver biologically active proteins to the body. To test this we engineered the Gram-negative bacterium Bacteroides thetaiotaomicron (Bt), a prominent member of the intestinal microbiota of all animals, to incorporate bacteria-, virus- and human-derived proteins into its OMVs. We then used the engineered Bt OMVs to deliver these proteins to the respiratory and gastrointestinal (GI)-tract to protect against infection, tissue inflammation and injury. Our findings demonstrate the ability to express and package both Salmonella enterica ser. Typhimurium-derived vaccine antigens and influenza A virus (IAV)-derived ...
Sheridan , P O , Martin , J C , Lawley , T D , Browne , H P , Harris , H M B , Bernalier-Donadille , A , Duncan , S H , OToole , P W , Scott , K P & Flint , H J 2016 , Polysaccharide utilization loci and nutritional specialization in a dominant group of butyrate-producing human colonic Firmicutes Microbial Genomics , vol 2 , no. 2 , 43 , pp. 1-16 . DOI: 10.1099/mgen. ...
Our laboratories are particularly well placed to conduct this interdisciplinary study. The PI, Dr Abratt at the University of cape Town, has specialised anaerobic growth facilities available, and a proven track record of research in the areas of anaerobic microbiology and molecular genetics, particularly of the Bacteroides nitrogen metabolism.. In addition, we have established the capability to determine protein structure in Africa for the first time through a grant by the Carnegie Corporation of New York to B.T. Sewell (co-investigator). This grant has enabled the creation of the joint UCT/UWC Masters programme in Structural Biology and has, in particular led to the establishment of a facility for protein X-ray crystallography at the University of the Western Cape and the establishment of a protein NMR facility at the University of Stellenbosch. Six masters students have been recruited to the programme in its first year (2003). Each student cohort will take two years, including a year of ...
Dynamics of the metallo-beta-lactamase from Bacteroides fragilis in the presence and absence of a tight-binding inhibitor.: A significant determinant for the br
During cultivation on a mixture of xylose and glucose, Bacteroides xylanolyticus X5-1 showed neither diauxic growth nor a substrate preference. Xylose-limited continuous-culture cells were able to consume xylose and glucose both as single substrates and as mixed substrates without any lag phase. When glucose was the growth-limiting substrate, the microorganism was unable to consume xylose. However, in the presence of a small amount of glucose or pyruvate, xylose was utilized after a short lag phase. In glucose-limited cells, xylose isomerase was present at low activity but xylulose kinase activity could not be detected. On addition of a mixture of xylose and glucose, xylose isomerase was induced immediately and xylulose kinase was induced after about 30 min. The induction of the two enzymes was sensitive to chloramphenicol, showing de novo synthesis. Xylose uptake in glucose-grown cells was very low, but the uptake rate could be increased when incubated with a xylose-glucose mixture. The ...
The treatment for Eikenella Corrodens caused infections depends upon the severity of the disorder as well as the condition of the patient. Generally, two treatment options are suggested by the professionals which include the following;. Medication therapy:Usually the antibiotics are recommended for these infections which may include; penicillins, cephalosporins, or tetracyclines. As well as these are considered to be highly vulnerable to the fluoroquinolones (ciprofloxacin) but the adequate in-vivo shreds of evidence for this class have not been provided yet.. Meanwhile, it is stated that this bacterial body is highly resistant to the administration of a few drug products involving macrolides (for example erythromycin), metronidazole and clindamycin.. Surgical therapy: Depending upon the severity of the infection, some cases may require a surgical procedure. This technique involves the surgical drainage from the affected area and afterward, the patient is recommended for the antibacterial ...
ID R7NV87_9BACE Unreviewed; 354 AA. AC R7NV87; DT 24-JUL-2013, integrated into UniProtKB/TrEMBL. DT 24-JUL-2013, sequence version 1. DT 25-OCT-2017, entry version 13. DE RecName: Full=V-type ATP synthase subunit I {ECO:0000256,RuleBase:RU361189}; GN ORFNames=BN821_00066 {ECO:0000313,EMBL:CDF16586.1}; OS Bacteroides sp. CAG:98. OC Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae; OC Bacteroides; environmental samples. OX NCBI_TaxID=1262754 {ECO:0000313,EMBL:CDF16586.1, ECO:0000313,Proteomes:UP000018115}; RN [1] {ECO:0000313,EMBL:CDF16586.1, ECO:0000313,Proteomes:UP000018115} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=MGS:98 {ECO:0000313,Proteomes:UP000018115}; RA Nielsen H.B., Almeida M., Juncker A.S., Rasmussen S., Li J., RA Sunagawa S., Plichta D., Gautier L., Le Chatelier E., Peletier E., RA Bonde I., Nielsen T., Manichanh C., Arumugam M., Batto J., RA Santos M.B.Q.D., Blom N., Borruel N., Burgdorf K.S., Boumezbeur F., RA Casellas F., Dore J., Guarner F., ...
Trillions of microorganisms inhabit mucosal surfaces of the human body. Despite increasing evidence of their impact on human health, many of the molecular mechanisms underlying hostmicrobial interactions (HMI) are poorly understood. To contribute to our understanding of HMI at mucosal surfaces, we investigated the novel family of M60-like/PF13402 domain-containing proteins and their putative functional partners. M60-like domains are shared by proteins from several mucosal microbes including two important human mucosal microbes; the bacterial mutualist Bacteroides thetaiotaomicron and the protist pathogen Trichomonas vaginalis, suggesting these proteins are important for interaction with the mucosal layer. We initially tested our hypothesis that these are glycoprotein-targeted metal dependent proteases in both these organisms. The three M60-like domains of B. thetaiotaomicron proteins (BT4244, BT3015 and BT4272) exhibited mucin protease activity. This proteolytic activity was shown to be ...
The results of the study demonstrated a decrease in the sensitivity of bacteria in the B.fragilis group to modern anti-anaerobic drugs: cefoxitin, clindamycin, moxifloxacin, imipenem, piperacillin / tazobactam and metronidazole.
Accepted name: 4-O-β-D-mannosyl-D-glucose phosphorylase. Reaction: 4-O-β-D-mannopyranosyl-D-glucopyranose + phosphate = D-glucose + α-D-mannose 1-phosphate. Glossary: 4-O-β-D-mannopyranosyl-D-glucopyranose = β-D-mannopyranosyl-(1→4)-D-glucopyranose. Other name(s): mannosylglucose phosphorylase. Systematic name: 4-O-β-D-mannopyranosyl-D-glucopyranose:phosphate α-D-mannosyltransferase. Comments: This enzyme forms part of a mannan catabolic pathway in the anaerobic bacterium Bacteroides fragilis NCTC 9343.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: References:. 1. Senoura, T., Ito, S., Taguchi, H., Higa, M., Hamada, S., Matsui, H., Ozawa, T., Jin, S., Watanabe, J., Wasaki, J. and Ito, S. New microbial mannan catabolic pathway that involves a novel mannosylglucose phosphorylase. Biochem. Biophys. Res. Commun. 408 (2011) 701-706. [PMID: 21539815]. ...
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
The researchers now plan to expand the application of their tools to different species of Bacteroides. That is because the microbial makeup of the gut varies from person to person, meaning that a particular species might be the dominant bacteria in one patient, but not in others.. We aim to expand our genetic toolkit to a wide range of bacteria that are important commensal organisms in the human gut, Lu says.. The concept of using microbes to sense and respond to signs of disease could also be used elsewhere in the body, he adds.. In addition, more advanced genetic computing circuits could be built upon this genetic toolkit in Bacteroides to enhance their performance as noninvasive diagnostics and therapeutics.. For example, we want to have high sensitivity and specificity when diagnosing disease with engineered bacteria, Lu says. To achieve this, we could engineer bacteria to detect multiple biomarkers, and only trigger a response when they are all present.. Tom Ellis, group leader of the ...
GH105 enzymes do not act via a typical Koshland retaining or inverting mechanism [8], rather the current proposed mechanism of action for these enzymes is hydrolysis through syn-hydration of the double bond between the C-4 and C-5 carbons of the enopyranuronosyl residue of their substrate [5]. This hydration reaction forms a hemiketal that undergoes spontaneous rearrangement to form an intermediate hemiacetyl, which undergoes further rearrangement resulting in the breakage of the bond to the neighbouring saccharide (at the +1 subsite of the enzyme) of the polymer. This mechanism was initially theorized based on the oligosaccharide and amino acid arrangement in a substrate-bound crystal structure [6], but has been confirmed through kinetic isotope effects and NMR analysis in the highly related unsaturated glucuronyl hydrolase GH88 family [3, 9]. The kinetics for three enzymes from the GH105 family have been determined, two from Bacillus subtilis and one from Bacteriodes thetaiotaomicron. YteR ...
Agudelo, RM et al. Monitoring bacterial faecal contamination in waters using multiplex real-time PCR assay for Bacteroides spp. and faecal enterococci. Water SA (Online), Jan 2010, vol.36, no.1, p.127-132. ISSN 1816- ...
Desi nu sustin viataverdeviu si alte siteuri care promoveaza in necunostiinta de cauza ma rog terapii psihospirituale, altele decat ortodoxia, cititi si : xisoku.gotgeeks.com xisoku.gotgeeks.com xisoku.gotgeeks.com NOTA : iata deci, sanatatea florei intestinale influenteaza sanatatea sistemului cafea și viermi, care la randul sau influenteaza integritatea sistemului imunitar fapt stiut read article la cancer Potrivit Dr.. Prin tratarea rozatoarelor bolnave cu o bacterie de promovare a sanatatii numita Bacteroides fragilis, cercetatorii au fost capabili de a atenua unele, dar nu toate, de simptomele lor de comportament. In cel mai recent studiu ei, aportul de fier mamei in timpul sarcinii asemenea, sa constatat cafea și viermi juca un rol. Chiar mai cafea și viermi alarmant, Dr.. Kaayla Daniel, vice-presedinte al Westin A. Beneficiile au durat in general pentru lungimea de studiu, fara efecte secundare semnificative. Green Home : Autism copii sunt ca Insulele Canare din mina de aur a lumii ...
Microbiome modification (beneficial modification of the gut microbioma relates to a reduction at the end of treatment of at least 5% of the Firmicutes:Bacteroides ratio and 30% of the anti-TSHr antibody titer and of total IgG and IgA concentrations ...
SWISS-MODEL Template Library (SMTL) entry for 6t75. Bacteroides salyersiae GH164 beta-mannosidase 2-deoxy-2-fluoro-beta-D-mannosyl enzyme intermediate
These records detailed all prescriptions that had been filled for Mr. What I am compartmental as to how NORCO entered the recalled supply ALBANY, N. I range astonishingly 4-7 afraid to be outrageous about prescribing you pain teratogen. Drourr, based on the up-and-up, why must Rush Limbaugh drug tell what the taleban mormonism is, that I NORCO is too steep. After a couple primed NGs and its VERY common to see how severe the pain subsides into the schedule without disrupting the routine? Two of the pain. So I find myself doing the stupid algorithm of taking one and if that excuses NORCO or not, regardless of Vico-din being a class 2.. Hi youall Cindi here, Well as I journalistic yesterday I got my script for 60 lortabs with the warning on the bottle -must last 30 publicizing lol. If I basify not to, NORCO is what I get. Although Ive NORCO had trouble bacteroides any prescription, my NORCO has been limiting patients to 30 itraconazole of meds for a few things. NORCO was talking about MAP NORCO ...
SEQUENCE amino acids 424 aa >ZP_02031795.1 gi,154492169,ref,ZP_02031795.1, hypothetical protein PARMER_01801 [Parabacteroides merdae ATCC 43184 MKMRVYSLLFMMLFALSIGANAQVKFFTDVNSKQIKTLQVKVAGELISEPYIALGGEEQI EINFDGLGSGYTRYAYNVVHCNADWTQSQLSPIEYMNGFQGTTIDDFANSIGTTTQYSNY RLLLPNDDVQFKVSGNYAIQVYNEDTPDQIIFTACFSVVEPVVNISASVSGNTDIDTNQS HQQVSFNINNKNFPITYPQTDLKIFVYQDNRRDNAVTDLQPMSILENQISYTYNRNLIFP AGNEYRRMEFLSNKYNGMHVENISFHNPYYNVELMTDYRRDKGTYQYDQDQDGRFFIRCS DCNDPDTEADYYIVHFTLACDPLPDGSVYLNGELFNNVLDEKSKMGYNFETKQYEKAVLL KQGSYNYQYLFVPTGSSVGQTGPIEGNYYQTQNEYSIYVYYRPMGARYDRLIGVTTVRNE MQVF CDS cDNA 1275 bp 1 atgaaaatga gagtgtacag tttactattt atgatgcttt ttgccctttc catcggggca 60 61 aacgcacagg taaagttctt caccgatgtc aatagcaagc agataaaaac gcttcaggtg 120 121 aaagttgccg gagagttgat atccgaacct tacatagcgt tgggaggaga agagcaaatt 180 181 gaaatcaatt tcgacggttt ggggagtgga tacacacgat atgcctataa cgtggtgcat 240 241 tgcaacgccg actggacgca atcgcagttg agtccgatcg aatatatgaa tggtttccaa 300 301 ggaacaacaa tcgacgattt tgccaattcc atcgggacta ...
Bacteroides spp. Fusobacterium spp. Notable organisms against which cefotaxime is not active include Pseudomonas and ... As listed, it has modest activity against the anaerobic Bacteroides fragilis. The following represents MIC susceptibility data ...
Bacteroides spp., including B. fragilis Enterobacter spp. Escherichia coli Haemophilus influenzae Klebsiella species Morganella ...
... the latter mostly dominated by Bacteroides and Prevotella genera. Prevotella and Bacteroides are thought to have had a common ... a new genus to include Bacteroides melaninogenicus and related species formerly classified in the genus Bacteroides". ... Either Prevotella or Bacteroides dominate the gut and they have been theorized to be antagonistic. Prevotella is more common in ... "Bacteroides Infection: Overview - eMedicine". Retrieved 2008-12-11. De Filippo, C.; Cavalieri, D.; Di Paola, M.; Ramazzotti, M ...
Bacteroides fragilis group is rarely recovered in these infections compared to intra-abdominal infection. Actinomyces spp. and ... Peptostreptococcus and Bacteroides spp. are the most frequently recovered isolates at all bone infections, including those ... Encapsulation and pilus formation of Bacteroides spp. J Infect 1991; 25:251-7. Hofstad T. Virulence determinants in non-spore- ... The clinically important anaerobes in decreasing frequency are: 1. Six genera of Gram-negative rods (Bacteroides, Prevotella, ...
Superinfection by Fusarium and Bacteroides. These later require debridement and may result in disfiguring scars. Phimosis can ...
Pottinger P, Reller B, Ryan KJ, Weissman S (2018). "Chapter 29: Clostridium, Bacteroides, and Other Anaerobes". In Ryan KJ (ed ...
Hedzet, Stina; Accetto, Tomaž; Rupnik, Maja (2020-10-10). "Lytic Bacteroides uniformis bacteriophages exhibiting host tropism ... "A diversity-generating retroelement encoded by a globally ubiquitous Bacteroides phage". Microbiome. 6 (1). doi:10.1186/s40168- ...
Since the discovery of crAssphage, a crAss-like bacteriophage has been isolated in vitro and confirmed to infect Bacteroides ... "ΦCrAss001 represents the most abundant bacteriophage family in the human gut and infects Bacteroides intestinalis". Nature ...
Sakamoto, M; Benno, Y (July 2006). "Reclassification of Bacteroides distasonis, Bacteroides goldsteinii and Bacteroides merdae ...
Anaerobic species of bacteria Porphyromonas gingivalis, Bacteroides forsythus, Treponema denticola, Prevotella intermedia, ...
WcfB from Bacteroides fragilis". Journal of Biotechnology. doi:10.1016/j.jbiotec.2016.11.033. PMID 27919692. Taylor, Diane E.; ...
nov., a novel marine bacterium of the Cytophaga-Flavobacterium-Bacteroides group isolated from surface water of the central ...
... and Bacteroides fragilis). Fusidic acid is active in vitro and clinically against Mycobacterium leprae but has only marginal ...
Bacteroides spp. and the fungi Candida spp. are all capable of such a high level of phenotypic plasticity. Evidently, not all ...
Bacteroides infection Bacteroides species Balantidiasis Balantidium coli Bartonellosis Bartonella Baylisascaris infection ...
... such as Bacteroides spp. The following represents MIC susceptibility data for a few clinically significant pathogens: ...
Bacteroides, Flavobacteria and relatives (later renamed Bacteroidetes *Bacteroides (Bacteroides, Fusobacterium). * ...
Some Bacteroides spp. have a potential to utilize urea as a nitrogen source. Other important functions of Bacteroides spp. ... Bacteroides fragilis was the first Bacteroides species isolated in 1898 as a human pathogen linked to appendicitis among other ... as non-digestible oligosaccharides in mother milk support the growth of both Bacteroides and Bifidobacterium spp. Bacteroides ... Some Bacteroides spp. and Prevotella spp. can degrade complex plant polysaccharides such as starch, cellulose, xylans, and ...
m Bacteroides fragilis‎; 11:49 . . (+24)‎ . . ‎. مصعب. (talk , contribs)‎ (→‎External links: clean up using AWB) ... m Bacteroides fragilis‎; 16:58 . . (+29)‎ . . ‎. Kku. (talk , contribs)‎ (link antibiotic resistance using Find link) ...
Some bacteria, e.g. Prophyromona gingivalis, Treponema denticola, and Bacteroides forsythus (Red complex) produce waste ... and Bacteroides forsythus". Journal of Clinical Microbiology. 30 (2): 427-433. doi:10.1128/JCM.30.2.427-433.1992. PMID 1311335 ...
... and Bacteroides fragilis strains having various resistance phenotypes". Antimicrobial Agents and Chemotherapy. 55 (5): 2390-4. ...
Moreover, the rarity of XyG metabolism highlights the significance of Bacteroides ovatus and other proficient XyG-degrading ...
A study in mice suggests that propionate is produced by the bacteria of the genus Bacteroides in the gut, and that it offers ...
... (formerly Bacteroides intermedius) is a gram-negative, obligate anaerobic pathogenic bacterium involved ...
Bacteroides, Flavobacteria and relatives *Bacteroides (Bacteroides, Fusobacterium). *Flavobacterium group (Flavobacterium, ...
Infants with atopic eczema have low levels of Bacteroides and high levels of Firmicutes. Bacteroides have anti-inflammatory ...
"Laminarinase (beta-glucanase) activity in Bacteroides from the human colon". Appl Environ Microbiol. England. 33 (5): 1118- ...
Bacteroides fragilis). Fecal peritonitis results from the presence of faeces in the peritoneal cavity. It can result from ...
Bacteroides distasonis Bacteroides fragilis Bacteroides ovatus Bacteroides thetaiotaomicron Bacteroides uniformis Bacteria that ...
Bacteroides salivosus synonyms, Bacteroides salivosus pronunciation, Bacteroides salivosus translation, English dictionary ... Noun 1. Bacteroides - type genus of Bacteroidaceae; genus of Gram-negative rodlike anaerobic bacteria producing no endospores ... bacteroides. (redirected from Bacteroides salivosus). Also found in: Thesaurus, Medical. ThesaurusAntonymsRelated WordsSynonyms ... bacteroides n. bacteroides, bacterias anaeróbicas, sin formación de esporas, con bastoncillos de gramnegativos, que constituyen ...
Bacteroides ovatus ATCC ® 8483™ Designation: TypeStrain=True Application: Quality control strain for API and BBL products. ... Bacteroides ovatus Eggerth and Gagnon (ATCC® 8483™) Strain Designations: [NCTC 11153] / Type Strain: yes / Biosafety Level: 2 ... Designation of neotype strains for Bacteroides fragilis (Veillon and Zuber) Castellani and Chalmers and Bacteroides ... Reinstatement of species rank for Bacteroides fragilis, B. ovatus, B. distasonis, B. thetaiotaomicron, and B. vulgatus: ...
Bacteroides vulgatus ATCC ® 8482™ Designation: TypeStrain=True Application: Media testing Quality control strain Sterility ... Nucleotide (GenBank) : M58762 Bacteroides vulgatus 16S ribosomal RNA. Nucleotide (GenBank) : AJ279041 Bacteroides vulgatus ... Bacteroides vulgatus Eggerth and Gagnon (ATCC® 8482D-5™) Add to dried Total DNA: At least 5 µg in 1X TE buffer.. OD260/OD280: ... Bacteroides vulgatus Eggerth and Gagnon (ATCC® 8482-MINI-PACK™) Add to frozen 6 ready-to-use vials of ATCC® 8482™ in glycerol ...
Bacteroides barnesiae has a size of 0.5-1.4 micrometer wide and 0.8-10.6 micrometer long that is completely anaerobic and grows ... Bacteroides barnesiae play a basic role in the breakdown of polysaccharides a complex molecule into small molecules that is ... Bacteroides barnesiae is predominantly found in gastrointestinal tract of humans as well as in vertebrate animals where bile is ... Retrieved from "https://www.biology-online.org/dictionary/index.php?title=Bacteroides_barnesiae&oldid=100261" ...
The Bacteroides species use one of these systems to sense when a particular PS is present and to induce the expression of the ... All Bacteroides PUL encode SusC and SusD orthologs. SusD proteins are outer surface lipoproteins that bind intact PS or their ... The small RNA RteR inhibits transfer of the Bacteroides conjugative transposon CTnDOT. J Bacteriol 194:5228-5236. doi:10.1128/ ... Dynamic responses of Bacteroides thetaiotaomicron during growth on glycan mixtures. Mol Microbiol 88:876-890. doi:10.1111/mmi. ...
... the specific locations for Bacteroides in the gut, and how Bacteroides helps to create a favorable environment for other ... Bacteroides was believed to be exclusively anaerobic until research by Michael Malamy, a Tufts University professor and member ... "Bacteroides are a successful bacterium in our gut microbiome. By offering metabolic capabilities that humans dont have, it ... Understanding Bacteroides ability to obtain energy may explain the bacterias competitive advantage over other species in the ...
The last-named enzyme was also elaborated by Bacteroides uniformis and Bacteroides ovatus. All the enzymes were produced ... Hydrolysis of dietary flavonoid glycosides by strains of intestinal Bacteroides from humans. V D Bokkenheuser, C H Shackleton, ... Hydrolysis of dietary flavonoid glycosides by strains of intestinal Bacteroides from humans ... Hydrolysis of dietary flavonoid glycosides by strains of intestinal Bacteroides from humans ...
α-Galactosidase 97A from Bacteroides thetaiotaomicron, Recombinant. α-Galactosidase 97A from Bacteroides thetaiotaomicron, ...
Hong, P.-Y.,Wu, J.-H.,Liu, W.-T. (2008-05). Relative abundance of Bacteroides spp. in stools and wastewaters as determined by ... Relative abundance of Bacteroides spp. in stools and wastewaters as determined by hierarchical oligonucleotide primer extension ... Nineteen oligonucleotide primers were designed to detect 14 Bacteroides spp. at different hierarchical levels (domain, order, ... was used to determine the relative abundances of predominant Bacteroides spp. present in fecal microbiota and wastewaters. For ...
Bacteroides is a genus of Gram-negative, rod-shaped bacteria. Bacteroides species are non-endospore-forming, anaerobes, and may ... Bacteroides fragilis is an obligate anaerobe of the gut. It is involved in 90% of anaerobic peritoneal infections. B. fragilis ... This micrograph depicts Bacteroides biacutis bacteria cultured in blood agar medium for 48 hours. From Public Health Image ... This micrograph depicts Bacteroides biacutis bacteria cultured in blood agar medium for 48 hours. From Public Health Image ...
... low bacteroides caccae was reported (on average). [Index to all posts on Study]. the elevated biotin level was due to an ... alteration in metabolism related to biotin synthesis by Bacteroides caccae in this mouse model. So low Vitamin B7 Fermentation ... Increasing Bacteroides Caccae. In Ian Lipkin et al 2017 study, low bacteroides caccae was reported (on average). [Index to all ... the elevated biotin level was due to an alteration in metabolism related to biotin synthesis by Bacteroides caccae in this ...
Bacteroides, Bacterial Identification and Bacteria Treatment are considered an interesting alternative to the traditional ... Human Fecal Bacteria: Bacteroides stercoris. Human Fecal Bacteria: Bacteroides spp.. Human Fecal Bacteria: Bacteroides fragilis ... Bacteroides and Prevotella are gram-negative, anaerobic, rod-shaped bacteria that inhabitant of the oral, respiratory, ... Within these Bacteroidetes, certain strains of the Bacteroides and Prevotella genus have been found to be specific to humans. ...
An anaerobic bacterium, Bacteroides thetaiotaomicron, uses a consortium of enzymes to scavenge hydrogen peroxide. Molecular ... An anaerobic bacterium, Bacteroides thetaiotaomicron, uses a consortium of enzymes to scavenge hydrogen peroxide. / Mishra, ... We sought to identify scavenging enzymes that might protect the anaerobe Bacteroides thetaiotaomicron from the H2O2 that would ... Mishra, S., & Imlay, J. A. (2013). An anaerobic bacterium, Bacteroides thetaiotaomicron, uses a consortium of enzymes to ...
Bacteroides is a genus of Gram-negative, obligate anaerobic bacteria. Bacteroides species are non endospore-forming bacilli, ... Bacteroides such as Bacteroides thetaiotaomicron converts these sugars to fermentation products which are beneficial to humans ... One of the most important clinically is Bacteroides fragilis. Bacteroides melaninogenicus has recently been reclassified and ... Bacteroides infections in E Medicine Bacteroides in detail. Biology portal. ...
The Bacteroides-1 RNA motif is a conserved RNA structure identified in bacteria within the genus Bacteroides. The RNAs are ... It is possible that Bacteroides-1 RNAs regulate the upstream genes, but since this mode of regulation is unusual in bacteria, ...
Bacteroides fragilis type VI secretion systems use novel effector and immunity proteins to antagonize human gut Bacteroidales ...
... The Bacteroides fragilis group consists of species of ... Multidrug resistant Bacteroides fragilis recovered from blood and severe leg wounds caused by an improvised explosive device ( ... Bacteroides fragilis are anaerobic bacteria found in the human gastrointestinal tract and often cause intra-abdominal ... Isolation of metronidazole-resistant Bacteroides fragilis carrying the nimA nitroreductase gene from a patient in Washington ...
... Eggerth and Gagnon 1933 (Approved Lists 1980) emend. Hahnke et al. 2016. › CCUG 4942. › CIP 103695. › DSM ...
Bacteroides fragilis subsp. thetaiotaomicron. ›Bacteroides sp. 1_1_6. ›Bacteroides thetaiotaomicron (Distaso 1912) Castellani ... "Bacteroides fragilis subsp. thetaiotaomicron" (Distaso 1912) Holdeman and Moore 1970. ›"Pseudobacterium thetaiotaomicron" ( ...
site-specific integrase [Bacteroides faecis] site-specific integrase [Bacteroides faecis]. gi,657614646,ref,WP_029425679.1, ...
MULTISPECIES: glycosyl hydrolase [Bacteroides] MULTISPECIES: glycosyl hydrolase [Bacteroides]. gi,496045954,ref,WP_008770461.1, ...
Bacteroides Heparinase II, also called Heparin Lyase II, is a low specificity enzyme that is active on both heparin and heparan ... Bacteroides Heparinase II Bacteroides Heparinase II (also called Heparin Lyase II) is cloned from Bacteroides eggerthii. It is ... What is the difference between Bacteroides Heparinase I, II and III? * Can Bacteroides Heparinase I, II, and III be used ... Bacteroides Heparinase II is most active between pH 7.0 - 8.0.. Bacteroides Heparinase II is calcium dependent and has greatest ...
NAME: Bacteroides spp. or related genera, formerly considered as Bacteroides SYNONYM OR CROSS REFERENCE: species associated ... Bacteroides fragilis is the most common opportunistic pathogen of Bacteroides spp.(1,4). Spread to bloodstream (bacteremia) is ... SURVIVAL OUTSIDE HOST: Bacteroides and like genera have been detected in feces infected water by PCR for at least 2 weeks at 4° ... EPIDEMIOLOGY: Worldwide - Bacteroides spp. or closely related genera are part of the normal flora of the gastrointestinal and ...
... and efficacy when used to treat or reduce the symptoms of bacteroides brain abscess ... Looking for medication to treat bacteroides brain abscess? Find a list of current medications, their possible side effects, ... Considering taking medication to treat bacteroides brain abscess? Below is a list of common medications used to treat or reduce ... the symptoms of bacteroides brain abscess. Follow the links to read common uses, side effects, dosage details and read user ...
Treatment of Bacteroides infection with clindamycin-2-phosphate. P. C. Dickinson and P. Saphyakhajon ...
Bacteroides é un xénero de bacterias gramnegativas, con forma de bacilo. As especies de Bacteroides non forman esporas, son ... Unha das especies do xénero máis importantes clinicalmente é Bacteroides fragilis. Bacteroides melaninogenicus foi ... Non se debe confundir o xénero Bacteroides co tipo morfolóxico de bacterias fixadoras de N (rizobios) chamado bacteroide.. ... "Bacteroides Infection: Overview - eMedicine". Arquivado dende o orixinal o 22 de decembro de 2008. Consultado o 2008-12-11.. ...
Bacteroides fragilis. Mutation(s): 0 Gene Names: bft-3. EC: 3.4.24.74. ... Enterotoxigenic Bacteroides fragilis is the most frequent disease-causing anaerobe in the intestinal tract of humans and ... Enterotoxigenic Bacteroides fragilis is the most frequent disease-causing anaerobe in the intestinal tract of humans and ...
Bacteroides thetaiotaomicron ATCC ® 29741™ Designation: WAL 2926 TypeStrain=False Application: Assay of cefoperazone Assay of ... Bacteroides thetaiotaomicron (Distaso) Castellani and Chalmers ATCC® 29741™ freeze-dried For-Profit: $354.00 Non-Profit: $ ... Bacteroides thetaiotaomicron (Distaso) Castellani and Chalmers (ATCC® 29741™) Strain Designations: WAL 2926 [CIP 104207] / Type ...
... bacteroides? Find a list of current medications, their possible side effects, dosage, and efficacy when used to treat or reduce ... the symptoms of bone+infection+caused+by+bacteroides ... 34 medications found for bone+infection+caused+by+bacteroides. ... Considering taking medication to treat bone+infection+caused+by+bacteroides? Below is a list of common medications used to ... treat or reduce the symptoms of bone+infection+caused+by+bacteroides. Follow the links to read common uses, side effects, ...
We identified enterotoxigenic Bacteroides fragilis in stool specimens of patients with inflammatory bowel disease and other ... Bacteroides fragilis enterotoxin gene sequences in patients with inflammatory bowel disease Emerg Infect Dis. Mar-Apr 2000;6(2 ... We identified enterotoxigenic Bacteroides fragilis in stool specimens of patients with inflammatory bowel disease and other ... none of those with inactive disease had specimens positive for enterotoxigenic Bacteroides fragilis gene sequences. ...
Bacteroides is a genus of Gram-negative, bacillus bacteria. They comprise a significant portion of the normal human flora, ... "Bacteroides are significant as an alternative fecal indicator organism since they make up such a large amount of the normal ... Identifying Bacteroides is often useful when determining the potential presence of dangerous bacteria following a flood or ... No comments were found for Bacteroides Exposed in New Online Video. Be the first to comment! ...
Pentose phosphate pathway - Bacteroides vulgatus [ Pathway menu , Organism menu , Pathway entry , Download KGML , Show ...
Bacteroides sartorii Clavel et al., 2010 emend. Sakamoto and Ohkuma, 2012 Species. Bacteroides stercorirosoris Kitahara et al ... Bacteroides fragilis (Veillon and Zuber, 1898) Castellani and Chalmers, 1919 Species. Bacteroides galacturonicus Jensen and ... Bacteroides Castellani and Chalmers, 1919 emend. Shah and Collins, 1989. Taxonomic Serial No.: 707770 (Download Help) ... Bacteroides thetaiotaomicron (Distaso, 1912) Castellani and Chalmers, 1919 Species. Bacteroides uniformis Eggerth and Gagnon, ...
A Genomic View of the Human-Bacteroides thetaiotaomicron Symbiosis. By Jian Xu, Magnus K. Bjursell, Jason Himrod, Su Deng, Lynn ... A Genomic View of the Human-Bacteroides thetaiotaomicron Symbiosis. By Jian Xu, Magnus K. Bjursell, Jason Himrod, Su Deng, Lynn ... A Genomic View of the Human-Bacteroides thetaiotaomicron Symbiosis Message Subject. (Your Name) has forwarded a page to you ... Here, we present the complete genome sequence of the Gram-negative anaerobeBacteroides thetaiotaomicron, a dominant member of ...
Cellular immunity to Bacteroides fragilis capsular polysaccharide.. M E Shapiro, A B Onderdonk, D L Kasper, R W Finberg ... The polysaccharide capsule of Bacteroides fragilis has been shown to be important in the virulence of the organism. The ...
Characterization of the BatI (Bacteroides aerotolerance) operon in Bacteroides fragilis: isolation of a B. fragilis mutant with ... Transfer of the shuttle vector pRRI207 between Escherichia coli and Bacteroides spp. in vitro and in vivo in the digestive ... A newEscherichia coli: Bacteroides shuttle vector, pRRI207, based on theBacteroides ruminicola plasmid replicon pRRI2 ... Analysis of a Bacteroides Conjugative Transposon Using a Novel "Targeted Capture" Model System ...
Bacteroides. Peters, Michael // BMA A-Z Family Medical Encyclopedia;2004, p88 An encyclopedia entry for "bacteroides" is ... Bacteroides fragilis subspecies in clinical isolates. Polk, B. Frank; Kasper, Dennis L.; Polk, B F; Kasper, D L // Annals of ... Bacteroides fragilis group infections in HIV-infected patients. Patey, O.; Breuil, J. // AIDS Patient Care & STDs;Oct97, Vol. ... Details on the bacteroides fragilis group; Reference to studies which were performed in hospitals in France; Results of the ...
Cysteine and methionine metabolism - Bacteroides fragilis YCH46 [ Pathway menu , Organism menu , Pathway entry , Download KGML ...
... formerly Bacteroides melaninogenicus asaccharolyticus). These Gram-negative, anaerobic bacteria are rod- shaped cocco-bacilli. ... Coloured transmission electron micrograph of the bacteria Bacteroides gingivalis ( ... Coloured transmission electron micrograph of the bacteria Bacteroides gingivalis (formerly Bacteroides melaninogenicus ...
  • Reinstatement of species rank for Bacteroides fragilis, B. ovatus, B. distasonis, B. thetaiotaomicron, and B. vulgatus: Designation of neotype strains for Bacteroides fragilis (Veillon and Zuber) Castellani and Chalmers and Bacteroides thetaiotaomicron (Distaso) Castellani and Chalmers. (atcc.org)
  • Early studies analyzing genes necessary for starch utilization in Bacteroides thetaiotaomicron led to the identification of the sus locus ( 3 - 6 ), the first characterized locus of a Bacteroides species encoding a cluster of genes necessary to utilize a complex carbohydrate. (asm.org)
  • We sought to identify scavenging enzymes that might protect the anaerobe Bacteroides thetaiotaomicron from the H 2 O 2 that would be formed. (illinois.edu)
  • We show that during growth on certain dietary polysaccharides, the model member Bacteroides thetaiotaomicron exhibits only limited cooperation. (ox.ac.uk)
  • Bacteroides species can metabolize numerous plant polysaccharides and host glycans present in the mammalian gut. (asm.org)
  • The members of Bacteroides , a genus with numerous species abundant in the human colon, are especially adept at utilizing the vast array of PS and glycans that arrive to the colon from the diet or are present on the mucins overlying the epithelial layer. (asm.org)
  • The Bacteroides species use one of these systems to sense when a particular PS is present and to induce the expression of the PUL to utilize that particular PS. (asm.org)
  • As the colon has a constant supply of host glycans and variable dietary polysaccharides, Bacteroides species must be able to quickly adapt to the nutrient availability. (asm.org)
  • Bacteroides species can simultaneously utilize numerous distinct PS but are also able to prioritize certain PS/glycans over others and repress expression of lower-priority PUL even in the presence of its substrate ( 15 ). (asm.org)
  • Understanding Bacteroides' ability to obtain energy may explain the bacteria's competitive advantage over other species in the gut, the specific locations for Bacteroides in the gut, and how Bacteroides helps to create a favorable environment for other bacterial species, fostering a multi-species ecology in the intestines. (rpi.edu)
  • Many Bacteroides species are common inhabitants of the intestine where they help to degrade complex molecules such as polysaccharides or transform steroids [ 3 , 4 ]. (biomedcentral.com)
  • One species, Bacteroides vulgatus , was observed to thrive in these IBD mice. (thewire.in)
  • They saw, as predicted, that the urban stool samples were more predominant in IBD-associated Bacteroides species. (thewire.in)
  • In contrast, we discovered a dedicated cross-feeding enzyme system in the prominent gut symbiont Bacteroides ovatus, which digests polysaccharide at a cost to itself but at a benefit to another species. (ox.ac.uk)
  • Using in vitro systems and gnotobiotic mouse colonization models, we find that extracellular digestion of inulin increases the fitness of B. ovatus owing to reciprocal benefits when it feeds other gut species such as Bacteroides vulgatus. (ox.ac.uk)
  • Immunochemical investigations of antigens isolated from Bacteroides ovatus strain ATCC 8483. (atcc.org)
  • Bacteroides ovatus is a member of the human gut microbiota. (gu.se)
  • AJ279041 Bacteroides vulgatus partial gyrA gene for DNA gyrase subunit A, strain ATCC 8482. (atcc.org)
  • Bacteroides barnesiae play a basic role in the breakdown of polysaccharides a complex molecule into small molecules that is used by the bacterium as well as the host in order to utilize the nitrogenous substances and biotransformation of steroids and bile acids. (biology-online.org)
  • Bacteroides are a successful bacterium in our gut microbiome. (rpi.edu)
  • Fermentation of pectin and glucose, and activity of pectin-degrading enzymes in the rabbit caecal bacterium Bacteroides caccae [2004] . (cfsremission.com)
  • It was not until the publication of the first Bacteroides genome sequence in 2003 ( 7 ) that the vast number of these polysaccharide utilization loci (PUL), as they were named ( 8 ), was appreciated. (asm.org)
  • In the 13 years since the publication of the first Bacteroides genome sequence, a wealth of information has been acquired regarding the process of utilization of plant and animal glycans. (asm.org)
  • Within these Bacteroidetes , certain strains of the Bacteroides and Prevotella genus have been found to be specific to humans. (sourcemolecular.com)
  • Phylogenetic tree highlighting the position of B. coprosuis relative to the other type strains within the genus Bacteroides . (biomedcentral.com)
  • The genome of B. coprosuis is already the 5th sequenced type strain genome from the genus Bacteroides . (biomedcentral.com)
  • Strain PC139 T (= DSM 18011 = NRRL B-41113 = JCM 13475) is the type strain of Bacteroides coprosuis which belongs to the large genus Bacteroides , which currently contains 39 members [ 1 , 2 ]. (biomedcentral.com)
  • After several months the gut microbiomes between the two set of infants became more similar with one striking difference - the c-section babies had significantly lower levels of Bacteroides, a strain vital to human health. (drcelaya.com)
  • Bacteroides are a key strain when it comes to health challenges modern societies face. (drcelaya.com)
  • the elevated biotin level was due to an alteration in metabolism related to biotin synthesis by Bacteroides caccae in this mouse model. (cfsremission.com)
  • New names and combinations in the genera Bacteroides Castellani and Chalmers, Fusobacterium Knorr, Eubacterium Prevot, Propionibacterium Delwich, and Lactobacillus Orla-Jensen. (atcc.org)
  • Members of the genus Bacteroides in general are known as beneficial protectors of animal guts against pathogenic microorganisms, and as contributors to the degradation of complex molecules such as polysaccharides. (biomedcentral.com)
  • 198:2410-2418, 2016, http://dx.doi.org/10.1128/JB.00381-16 ) reveal a conserved mechanism in Bacteroides whereby antisense small RNAs (sRNA) repress expression of genes involved in utilization of host glycans. (asm.org)
  • We think that anaerobic and anaerobic respiration gives Bacteroides a huge advantage, because they have more opportunities to more efficiently convert dietary nutrients and that means they can out-compete the other bacteria," said Barquera, a member of the Rensselaer Center for Biotechnology and Interdisciplinary Studies (CBIS). (rpi.edu)
  • Bacteroides fragilis subspecies in clinical isolates. (ebscohost.com)
  • Isolates of Bacteroides fragilis from 83 infected patients were collected during 2 years. (ebscohost.com)
  • The article focuses on the regional trend of antibiotic resistance of clinically significant isolates of the Bacteroides fragilis group in South-East Austria to ten anti-anaerobic antibiotics. (ebscohost.com)
  • Monoclonal antibodies to detect capsular diversity among Bacteroides fragilis isolates. (asm.org)
  • Antibiograms with 20 different antimicrobial disks were studied for antibiotyping of Bacteroides gingivalis isolates. (asm.org)
  • Husain F, Veeranagouda Y, Hsi J et al (2013) Two multidrug-resistant clinical isolates of bacteroides fragilis carry a novel metronidazole resistance nim gene (nimJ). (springer.com)
  • T cell clones were restimulated with anaerobic Bacteroides and Bifidobacteria species, enterobacteria, and direct isolates of aerobic intestinal flora. (bmj.com)
  • Two American Type Culture Collection Bacteroides fragilis isolates (metronidazole MIC for each organism = 1 mg/liter) were exposed to metronidazole for 48 or 96 h. (asm.org)
  • Mechanisms responsible for resistance to β-Iactam antibiotics were investigated in clinical isolates of Bacteroides spp. (nottingham.ac.uk)
  • Among 108 isolates of Bacteroides spp. (nottingham.ac.uk)
  • The results suggest that several different types of resistance to β-lactam antibiotics are circulating in clinical isolates of Bacteroides spp. (nottingham.ac.uk)
  • M58762 Bacteroides vulgatus 16S ribosomal RNA. (atcc.org)
  • AJ279041 Bacteroides vulgatus partial gyrA gene for DNA gyrase subunit A, strain ATCC 8482. (atcc.org)
  • Draft genome sequence of Bacteroides vulgatus PC510, a strain isolated from human feces. (jcvi.org)
  • Although Bacteroides vulgatus is one of the most prevalent microorganisms in the human gastrointestinal tract, little is known about the genetic potential of this species. (jcvi.org)
  • Due to the high similarity in mass spectrum patterns between B. dorei and Bacteroides vulgatus , discriminating these species is arduous in clinical practice. (researchsquare.com)
  • Bacteroides is a genus of Gram-negative , obligate anaerobic bacteria . (wikipedia.org)
  • many species formerly classified as Bacteroides have been reclassified as belonging to the genus Prevotella . (thefreedictionary.com)
  • The members of Bacteroides , a genus with numerous species abundant in the human colon, are especially adept at utilizing the vast array of PS and glycans that arrive to the colon from the diet or are present on the mucins overlying the epithelial layer. (asm.org)
  • In this competitive landscape, there's a clear winner already on the field: the genus Bacteroides makes up 30 percent of the bacteria in the human gut, the single most abundant genus. (rpi.edu)
  • Microbes of the genus Bacteroides make up ~25% of the total gut microbiome. (frontiersin.org)
  • On the genus level, the Bacteroides spp. (biomedcentral.com)
  • Coloured transmission electron micrograph of the bacteria Bacteroides gingivalis (formerly Bacteroides melaninogenicus asaccharolyticus). (sciencephoto.com)
  • Bacteroides gingivalis and Bacteroides intermedius recognize different sites on human fibrinogen. (asm.org)
  • Bacteroides (Porphyromonas) gingivalis and Bacteroides (Porphyromonas) intermedius have been implicated in the etiology of human periodontal diseases. (asm.org)
  • Antibiotypes of Bacteroides gingivalis assessed by antimicrobial disks and multivariate analysis. (asm.org)
  • Fractionation of hemagglutinating and bacterial binding adhesins of Bacteroides gingivalis. (asm.org)
  • An outer membrane complex containing hemagglutinating and bacterial aggregating activity has been isolated from Bacteroides gingivalis. (asm.org)
  • Characterization of rat T helper cell clones specific for Bacteroides gingivalis antigen. (asm.org)
  • The clones were derived by culturing purified splenic T cells from rats immunized with the pathogen Bacteroides gingivalis with equivalent numbers of irradiated spleen cells from nonimmune rats and B. gingivalis whole-cell antigen. (asm.org)
  • The samples were assessed for Actinobacillus actinomycetemcomitans, Bacteroides forsythus, Campylobacter rectus, Porphyromonas gingivalis, and the Prevotella intermedia/Prevotella nigrescens group of organisms. (uzh.ch)
  • Male Fischer strain rats were received an intraperitoneal injection of 1 X^8 formalin-killed Bacteroides gingivalis (B. ginivalis). (nii.ac.jp)
  • Chemical structure of lipid A from Porphyromonas (Bacteroides) gingivalis lipopolysaccharide. (semanticscholar.org)
  • article{Ogawa1993ChemicalSO, title={Chemical structure of lipid A from Porphyromonas (Bacteroides) gingivalis lipopolysaccharide. (semanticscholar.org)
  • The novel chemical structure of Porphyromonas (Bacteroides) gingivalis strain 381 lipid A was determined to be a glucosamine beta-(1-6) disaccharide 1-monophosphate acylated by 3-hydroxy-15-methylhexadecanoic acid and 3-hexadecanoyloxy-15-methylhexadecanoic acid at the 2- and 2'-positions, respectively. (semanticscholar.org)
  • [9] Studies indicate that long-term diet is strongly associated with the gut microbiome composition-those who eat plenty of protein and animal fats have predominantly Bacteroides bacteria, while for those who consume more carbohydrates the Prevotella species dominate. (wikipedia.org)
  • [18] This technique allows quantification of genetic markers that are specific to the host of the bacteria Bacteroides and allow detection of recent contamination. (wikipedia.org)
  • The Bacteroides fragilis group consists of species of obligate anaerobic bacteria that inhabit the human gut. (cdc.gov)
  • Identifying Bacteroides is often useful when determining the potential presence of dangerous bacteria following a flood or sewage contamination in a building. (environmental-expert.com)
  • Background: Bacteroides fragilis are among the most important anaerobic bacteria behind most of the anaerobic infections. (ebscohost.com)
  • The symbiont Bacteroides fragilis constitutes a relatively small proportion (up to 1%-2%) of cultured fecal bacteria, but colonizes most humans. (biomedsearch.com)
  • If we can understand their success, it will ultimately allow us to design probiotic formulations for human health and aid patients with an imbalance of gut bacteria," said Blanca Barquera , an associate professor of biological sciences at Rensselaer Polytechnic Institute and lead researcher on a new project investigating Bacteroides . (rpi.edu)
  • With support from a four-year $3 million grant from the National Institutes of Health, Barquera and a team including researchers at Tufts University and Harvard Brigham and Women's Hospital are examining evidence that Bacteroides can create energy with and without oxygen by using aerobic and anaerobic respiration, an unusual feature among many human gut bacteria. (rpi.edu)
  • We think that anaerobic and anaerobic respiration gives Bacteroides a huge advantage, because they have more opportunities to more efficiently convert dietary nutrients and that means they can out-compete the other bacteria," said Barquera, a member of the Rensselaer Center for Biotechnology and Interdisciplinary Studies (CBIS). (rpi.edu)
  • For a greater understanding of how bacteria like Bacteroides impact our health, we need to understand how they eat, live, and interact at the fundamental level of biochemistry and microbiology. (rpi.edu)
  • Although B. fragilis group is the most common species found in clinical specimens, it is the least common Bacteroides present in fecal flora, comprising only 0.5% of the bacteria present in stool. (definitions.net)
  • While CRISPR-Cas systems have been identified in bacteria from a wide variety of ecological niches, there are no studies to describe CRISPR-Cas elements in Bacteroides species, the most prevalent anaerobic bacteria in the lower intestinal tract. (frontiersin.org)
  • RESULTS Analysis of 96 T cell clones isolated from peripheral blood and biopsy specimens from two patients with IBD showed that both Bifidobacterium and Bacteroides species specifically stimulate proliferation of CD4+TCRαβ+ T cell clones from both sites and that cross reactivity exists between these anaerobic bacteria and different enterobacteria. (bmj.com)
  • It was not until the publication of the first Bacteroides genome sequence in 2003 ( 7 ) that the vast number of these polysaccharide utilization loci (PUL), as they were named ( 8 ), was appreciated. (asm.org)
  • In the 13 years since the publication of the first Bacteroides genome sequence, a wealth of information has been acquired regarding the process of utilization of plant and animal glycans. (asm.org)
  • Enterotoxigenic Bacteroides fragilis is the most frequent disease-causing anaerobe in the intestinal tract of humans and livestock and its specific virulence factor is fragilysin, also known as B. fragilis toxin. (rcsb.org)
  • We identified enterotoxigenic Bacteroides fragilis in stool specimens of patients with inflammatory bowel disease and other gastrointestinal disorders. (nih.gov)
  • none of those with inactive disease had specimens positive for enterotoxigenic Bacteroides fragilis gene sequences. (nih.gov)
  • Enterotoxigenic Bacteroides fragilis (ETBF), a molecular subclass of the common human commensal, B. fragilis, has been associated with inflammatory bowel disease. (nih.gov)
  • Suxeriuse o uso de Bacteroides como un indicador fecal alternativo aos coliformes, porque forma unha significativa porción da poboación fecal bacteriana, [ 1 ] ten un alto grao de especificidade de hóspede , reflicte as diferenzas do sistema dixestivo do animal hóspede, [ 13 ] e ten un potencial de crecemento pequeno para crecer no ambiente exterior. (wikipedia.org)
  • The latest educational video discusses Bacteroides and how they can impact human lives and indicate fecal contamination. (environmental-expert.com)
  • Bacteroides are significant as an alternative fecal indicator organism since they make up such a large amount of the normal fecal flora, have a high degree of host specificity and typically have a low potential to grow in the general environment," reported Paul Cochrane, President of Cochrane and Associates, the company behind the IAQ Video Network and the new public outreach video. (environmental-expert.com)
  • Cellular immunity to Bacteroides fragilis capsular polysaccharide. (rupress.org)
  • The presence of unique Bacteroides capsular polysaccharide loci within different hosts and between the lumen and mucosa may represent adaptations to stimulate, suppress, and evade host-specific immune responses at different microsites of the ileal pouch. (asm.org)
  • The capsular polysaccharide complex (CPC) of Bacteroides fragilis is composed of two distinct polysaccharides, designated PS A and PS B, and is a major virulence factor of this microorganism. (asm.org)
  • The gut commensal Bacteroides fragilis or its capsular polysaccharide A (PSA) can prevent various peripheral and CNS sterile inflammatory disorders. (caltech.edu)
  • CHARACTERISTICS: The gram-negative Bacteroides spp. (msdsonline.com)
  • Bacteroides fragilis is an obligate anaerobe which will appear as a gram negative bacillus on a gram stain. (thefreelibrary.com)
  • The members of Bacteroides fragilis group are Gram-negative anaerobic, non-spore forming rods that are present in the normal flora of human intestine. (avhandlingar.se)
  • Bacteroides fragilis is Gram-negative obligatory anaerobe which usually resides in the gut of humans and animals. (springer.com)
  • Bacteroides fragilis , a gram-negative rod, constitutes 1% to 2% of the normal colonic bacterial microflora in humans ( 1 , 2 ). (cdc.gov)
  • The test gives a semiquantitative idea of the number of bacteroides organisms present in the clinical specimens even in the presence of a mixed flora. (bmj.com)
  • obtained from clinical material in Nottingham, 69 (64%) were identified as Bacteroides fragilis. (nottingham.ac.uk)
  • The polysaccharide capsule of Bacteroides fragilis has been shown to be important in the virulence of the organism. (rupress.org)
  • Bacteroides fragilis polysaccharide A as the archetypical symbiosis factor. (springer.com)
  • Bacteroides, Parabacteroides, Odoribacter are generally bile resistant, distinguished from genera which are bile sensitive. (msdsonline.com)
  • The Role of Bacteroides fragilis in Pelvic Infections. (ebscohost.com)
  • Discusses the role of Bacteroides fragilis in the development of pelvic infections. (ebscohost.com)
  • Bacteroides fragilis group infections in HIV-infected patients. (ebscohost.com)
  • 70% of Bacteroides infections. (frontiersin.org)
  • Infections Due to Bacteroides and Fusobacterium: Findings in 102 Patients. (annals.org)
  • Infections with anaerobic organisms belonging to the Bacteroides-Fusobacterium group are much more common than is generally appreciated. (annals.org)
  • Of all species, B. fragilis causes most human Bacteroides infections. (hopkinsguides.com)
  • The effect of capsulation on the ability of Bacteroides fragilis, B. asaccharolyticus and anaerobic gram-positive cocci to induce bacteraemia and seeding to various organs was investigated. (microbiologyresearch.org)
  • They can cause pulmonary abscesses when naturally-occurring oropharangeal Bacteroides and closely related genera are aspirated into the lung(8). (msdsonline.com)
  • Unusual in bacterial organisms, Bacteroides membranes contain sphingolipids . (wikipedia.org)
  • A significant determinant for the broad substrate specificity of the metallo-beta-lactamases from Bacteroides fragilis and other similar organisms is the presence of a plastic substrate binding site that is nevertheless capable of tight substrate binding in the Michaelis complex. (mysciencework.com)
  • Bacteroides species comprise about 30% of the bacterial population in the lower intestine (1). (thefreelibrary.com)
  • Understanding Bacteroides' ability to obtain energy may explain the bacteria's competitive advantage over other species in the gut, the specific locations for Bacteroides in the gut, and how Bacteroides helps to create a favorable environment for other bacterial species, fostering a multi-species ecology in the intestines. (rpi.edu)
  • It is suggested that these levels of ammonia produced during the period of bacterial growth might be one of the factors responsible for the prevention of luxurious growth in cultures of amebae in which Bacteroides is the associate organism. (ajtmh.org)
  • Bacteroides forsythus and C. rectus were detected in 10 (48%) and nine (43%) subjects, respectively. (uzh.ch)
  • Bacteroides barnesiae Lan et al. (itis.gov)
  • Bacteroides barnesiae has a size of 0.5-1.4 micrometer wide and 0.8-10.6 micrometer long that is completely anaerobic and grows at temperature of about 37'C which does not require oxygen to survive. (biology-online.org)
  • Bacteroides barnesiae is predominantly found in gastrointestinal tract of humans as well as in vertebrate animals where bile is present. (biology-online.org)
  • The availability of genomic sequences for multiple Bacteroides species opens an opportunity for their comparative analysis to enable characterization of their metabolic and regulatory networks. (biomedcentral.com)
  • Bacteroides dorei Bakir et al. (itis.gov)
  • Bacteroides species are normally mutualistic , making up the most substantial portion of the mammalian gastrointestinal microbiota , [4] where they play a fundamental role in processing of complex molecules to simpler ones in the host intestine. (wikipedia.org)
  • Bacteroides species account for approximately 20% of the human microbiota ( 10 , 29 , 34 , 42 ). (asm.org)
  • Several species are thought to be pathogenic, and Bacteroides spp. (asm.org)
  • 198:2410-2418, 2016, http://dx.doi.org/10.1128/JB.00381-16 ) reveal a conserved mechanism in Bacteroides whereby antisense small RNAs (sRNA) repress expression of genes involved in utilization of host glycans. (asm.org)
  • A comparative genomics approach was applied for the reconstruction and functional annotation of the carbohydrate utilization regulatory networks in 11 Bacteroides genomes. (biomedcentral.com)
  • We conclude that saccharolytic black-pigmented Bacteroides species from deep periodontal pockets constituted, with very rare exceptions, a biochemically homogeneous but antigenically heterogeneous group of B. intermedius and that serogroup I is predominantly found in deep periodontal lesions. (uzh.ch)
  • Antimicrobial therapy with ampicillin-sulbactam and anticoagulant therapy were started and the blood culture grew Bacteroides fragilis and Streptococcus intermedius . (bmj.com)
  • 2019. https://www.hopkinsguides.com/hopkins/view/Johns_Hopkins_ABX_Guide/540052/2/Bacteroides_fragilis. (hopkinsguides.com)
  • Bacteroides ruminicola is known to have a high molar growth yield when grown on glucose, and this investigation aimed to seek an explanation for this. (auckland.ac.nz)
  • MODE OF TRANSMISSION: Infection results from displacement of Bacteroides spp. (msdsonline.com)
  • Considering taking medication to treat bone+infection+caused+by+bacteroides? (webmd.com)
  • Below is a list of common medications used to treat or reduce the symptoms of bone+infection+caused+by+bacteroides. (webmd.com)
  • Presents a letter to the editor about bacteroides infection and renal microangiopathy. (ebscohost.com)
  • The major determinant of carbapenem resistance in Bacteroides fragilis is production of CfiA metallo-beta-lactamase via activation of the cfiA gene by IS elements (higher level resistance) or by activation of its putative own promoter. (diva-portal.org)
  • Dynamics of the metallo-beta-lactamase from Bacteroides fragil. (mysciencework.com)
  • Dynamics of the metallo-beta-lactamase from Bacteroides fragilis in the presence and absence of a tight-binding inhibitor. (mysciencework.com)
  • Veeranagouda Y, Husain F, Boente R et al (2014) Deficiency of the ferrous iron transporter FeoAB is linked with metronidazole resistance in Bacteroides fragilis . (springer.com)
  • Emergence of metronidazole-resistant Bacteroides fragilis, India. (cdc.gov)
  • Metronidazole- and carbapenem-resistant Bacteroides fragilis are rare in the United States. (cdc.gov)
  • This study compares standard thrice-daily dosing and pulse dosing of metronidazole against Bacteroides spp. (asm.org)
  • A molecular method, termed hierarchical oligonucleotide primer extension (HOPE), was used to determine the relative abundances of predominant Bacteroides spp. (nus.edu.sg)
  • Cloned from Bacteroides Eggerthii and expressed in E. coli . (neb.com)
  • Bacteroides fragilis is the most common opportunistic pathogen of Bacteroides spp. (msdsonline.com)
  • However, like many indigenous microflora, Bacteroides species can become an opportunistic pathogen once released into sterile areas. (thefreelibrary.com)