A species of filamentous Pseudomonas phage in the genus INOVIRUS, family INOVIRIDAE.
Viruses whose host is Pseudomonas. A frequently encountered Pseudomonas phage is BACTERIOPHAGE PHI 6.
Viruses whose hosts are bacterial cells.
Virulent bacteriophage and type species of the genus T4-like phages, in the family MYOVIRIDAE. It infects E. coli and is the best known of the T-even phages. Its virion contains linear double-stranded DNA, terminally redundant and circularly permuted.
A temperate inducible phage and type species of the genus lambda-like viruses, in the family SIPHOVIRIDAE. Its natural host is E. coli K12. Its VIRION contains linear double-stranded DNA with single-stranded 12-base 5' sticky ends. The DNA circularizes on infection.
Viruses whose host is Escherichia coli.
Virulent bacteriophage and type species of the genus T7-like phages, in the family PODOVIRIDAE, that infects E. coli. It consists of linear double-stranded DNA, terminally redundant, and non-permuted.
The phenomenon by which a temperate phage incorporates itself into the DNA of a bacterial host, establishing a kind of symbiotic relation between PROPHAGE and bacterium which results in the perpetuation of the prophage in all the descendants of the bacterium. Upon induction (VIRUS ACTIVATION) by various agents, such as ultraviolet radiation, the phage is released, which then becomes virulent and lyses the bacterium.
A series of 7 virulent phages which infect E. coli. The T-even phages T2, T4; (BACTERIOPHAGE T4), and T6, and the phage T5 are called "autonomously virulent" because they cause cessation of all bacterial metabolism on infection. Phages T1, T3; (BACTERIOPHAGE T3), and T7; (BACTERIOPHAGE T7) are called "dependent virulent" because they depend on continued bacterial metabolism during the lytic cycle. The T-even phages contain 5-hydroxymethylcytosine in place of ordinary cytosine in their DNA.
A temperate coliphage, in the genus Mu-like viruses, family MYOVIRIDAE, composed of a linear, double-stranded molecule of DNA, which is able to insert itself randomly at any point on the host chromosome. It frequently causes a mutation by interrupting the continuity of the bacterial OPERON at the site of insertion.
Virulent bacteriophage and sole member of the genus Cystovirus that infects Pseudomonas species. The virion has a segmented genome consisting of three pieces of doubled-stranded DNA and also a unique lipid-containing envelope.
Deoxyribonucleic acid that makes up the genetic material of viruses.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
The type species of the genus MICROVIRUS. A prototype of the small virulent DNA coliphages, it is composed of a single strand of supercoiled circular DNA, which on infection, is converted to a double-stranded replicative form by a host enzyme.
Proteins found in any species of virus.
A species of temperate bacteriophage in the genus P2-like viruses, family MYOVIRIDAE, which infects E. coli. It consists of linear double-stranded DNA with 19-base sticky ends.
Temperate bacteriophage of the genus INOVIRUS which infects enterobacteria, especially E. coli. It is a filamentous phage consisting of single-stranded DNA and is circularly permuted.
Viruses whose nucleic acid is DNA.
Bacteriophage in the genus T7-like phages, of the family PODOVIRIDAE, which is very closely related to BACTERIOPHAGE T7.
A technique of bacterial typing which differentiates between bacteria or strains of bacteria by their susceptibility to one or more bacteriophages.
A species of temperate bacteriophage in the genus P1-like viruses, family MYOVIRIDAE, which infects E. coli. It is the largest of the COLIPHAGES and consists of double-stranded DNA, terminally redundant, and circularly permuted.
Viruses whose host is Salmonella. A frequently encountered Salmonella phage is BACTERIOPHAGE P22.
A family of BACTERIOPHAGES and ARCHAEAL VIRUSES which are characterized by long, non-contractile tails.
Bacteriophages whose genetic material is RNA, which is single-stranded in all except the Pseudomonas phage phi 6 (BACTERIOPHAGE PHI 6). All RNA phages infect their host bacteria via the host's surface pili. Some frequently encountered RNA phages are: BF23, F2, R17, fr, PhiCb5, PhiCb12r, PhiCb8r, PhiCb23r, 7s, PP7, Q beta phage, MS2 phage, and BACTERIOPHAGE PHI 6.
The functional hereditary units of VIRUSES.
Rupture of bacterial cells due to mechanical force, chemical action, or the lytic growth of BACTERIOPHAGES.
Bacteriophage and type species in the genus Tectivirus, family TECTIVIRIDAE. They are specific for Gram-negative bacteria.
Viruses whose host is Staphylococcus.
Viruses whose host is Bacillus. Frequently encountered Bacillus phages include bacteriophage phi 29 and bacteriophage phi 105.
A family of bacteriophages which are characterized by short, non-contractile tails.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Viruses whose host is Streptococcus.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Proteins found in the tail sections of DNA and RNA viruses. It is believed that these proteins play a role in directing chain folding and assembly of polypeptide chains.
A bacteriophage genus of the family LEVIVIRIDAE, whose viruses contain the short version of the genome and have a separate gene for cell lysis.
The complete genetic complement contained in a DNA or RNA molecule in a virus.
The adhesion of gases, liquids, or dissolved solids onto a surface. It includes adsorptive phenomena of bacteria and viruses onto surfaces as well. ABSORPTION into the substance may follow but not necessarily.
The folding of an organism's DNA molecule into a compact, orderly structure that fits within the limited space of a CELL or VIRUS PARTICLE.
The process by which a DNA molecule is duplicated.
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
Genomes of temperate BACTERIOPHAGES integrated into the DNA of their bacterial host cell. The prophages can be duplicated for many cell generations until some stimulus induces its activation and virulence.
A genus of filamentous bacteriophages of the family INOVIRIDAE. Organisms of this genus infect enterobacteria, PSEUDOMONAS; VIBRIO; and XANTHOMONAS.
A bibliographic database that includes MEDLINE as its primary subset. It is produced by the National Center for Biotechnology Information (NCBI), part of the NATIONAL LIBRARY OF MEDICINE. PubMed, which is searchable through NLM's Web site, also includes access to additional citations to selected life sciences journals not in MEDLINE, and links to other resources such as the full-text of articles at participating publishers' Web sites, NCBI's molecular biology databases, and PubMed Central.
A publication issued at stated, more or less regular, intervals.
The scattering of x-rays by matter, especially crystals, with accompanying variation in intensity due to interference effects. Analysis of the crystal structure of materials is performed by passing x-rays through them and registering the diffraction image of the rays (CRYSTALLOGRAPHY, X-RAY). (From McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
A fibrous protein complex that consists of proteins folded into a specific cross beta-pleated sheet structure. This fibrillar structure has been found as an alternative folding pattern for a variety of functional proteins. Deposits of amyloid in the form of AMYLOID PLAQUES are associated with a variety of degenerative diseases. The amyloid structure has also been found in a number of functional proteins that are unrelated to disease.
The formation of crystalline substances from solutions or melts. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
The level of protein structure in which regular hydrogen-bond interactions within contiguous stretches of polypeptide chain give rise to alpha helices, beta strands (which align to form beta sheets) or other types of coils. This is the first folding level of protein conformation.

Cell death in Pseudomonas aeruginosa biofilm development. (1/14)

Bacteria growing in biofilms often develop multicellular, three-dimensional structures known as microcolonies. Complex differentiation within biofilms of Pseudomonas aeruginosa occurs, leading to the creation of voids inside microcolonies and to the dispersal of cells from within these voids. However, key developmental processes regulating these events are poorly understood. A normal component of multicellular development is cell death. Here we report that a repeatable pattern of cell death and lysis occurs in biofilms of P. aeruginosa during the normal course of development. Cell death occurred with temporal and spatial organization within biofilms, inside microcolonies, when the biofilms were allowed to develop in continuous-culture flow cells. A subpopulation of viable cells was always observed in these regions. During the onset of biofilm killing and during biofilm development thereafter, a bacteriophage capable of superinfecting and lysing the P. aeruginosa parent strain was detected in the fluid effluent from the biofilm. The bacteriophage implicated in biofilm killing was closely related to the filamentous phage Pf1 and existed as a prophage within the genome of P. aeruginosa. We propose that prophage-mediated cell death is an important mechanism of differentiation inside microcolonies that facilitates dispersal of a subpopulation of surviving cells.  (+info)

Prediction of charge-induced molecular alignment of biomolecules dissolved in dilute liquid-crystalline phases. (2/14)

Alignment of macromolecules in nearly neutral aqueous lyotropic liquid-crystalline media such as bicelles, commonly used in macromolecular NMR studies, can be predicted accurately by a steric obstruction model (Zweckstetter and Bax, 2000). A simple extension of this model is described that results in improved predictions for both the alignment orientation and magnitude of protein and DNA solutes in charged nematic media, such as the widely used medium of filamentous phage Pf1. The extended model approximates the electrostatic interaction between a solute and an ordered phage particle as that between the solute's surface charges and the electric field of the phage. The model is evaluated for four different proteins and a DNA oligomer. Results indicate that alignment in charged nematic media is a function not only of the solute's shape, but also of its electric multipole moments of net charge, dipole, and quadrupole. The relative importance of these terms varies greatly from one macromolecule to another, and evaluation of the experimental data indicates that these terms scale differently with ionic strength. For several of the proteins, the calculated alignment is sensitive to the precise position of the charged groups on the protein surface. This suggests that NMR alignment measurements can potentially be used to probe protein electrostatics. Inclusion of electrostatic interactions in addition to steric effects makes the extended model applicable to all liquid crystals used in biological NMR to date.  (+info)

Therapy of experimental pseudomonas infections with a nonreplicating genetically modified phage. (3/14)

Bacteriophage therapy of bacterial infections has received renewed attention owing to the increasing prevalence of antibiotic-resistant pathogens. A side effect of many antibiotics as well as of phage therapy with lytic phage is the release of cell wall components, e.g., endotoxins of gram-negative bacteria, which mediate the general pathological aspects of septicemia. Here we explored an alternative strategy by using genetically engineered nonreplicating, nonlytic phage to combat an experimental Pseudomonas aeruginosa infection. An export protein gene of the P. aeruginosa filamentous phage Pf3 was replaced with a restriction endonuclease gene. This rendered the Pf3 variant (Pf3R) nonreplicative and concomitantly prevented the release of the therapeutic agent from the target cell. The Pf3R phage efficiently killed a wild-type host in vitro, while endotoxin release was kept to a minimum. Treatment of P. aeruginosa infections of mice with Pf3R or with a replicating lytic phage resulted in comparable survival rates upon challenge with a minimal lethal dose of 3. However, the survival rate after phage therapy with Pf3R was significantly higher than that with the lytic phage upon challenge with a minimal lethal dose of 5. This higher survival rate correlated with a reduced inflammatory response elicited by Pf3R treatment relative to that with the lytic phage. Therefore, this study suggests that the increased survival rate of Pf3R-treated mice could result from reduced endotoxin release. Thus, the use of a nonreplicating modified phage for the delivery of genes encoding proteins toxic to bacterial pathogens may open up a new avenue in antimicrobial therapy.  (+info)

The polybasic region that follows the plant homeodomain zinc finger 1 of Pf1 is necessary and sufficient for specific phosphoinositide binding. (4/14)

The plant homeodomain (PHD) zinc finger is one of 14 known zinc-binding domains. PHD domains have been found in more than 400 eukaryotic proteins and are characterized by a Cys(4)-His-Cys(3) zinc-binding motif that spans 50-80 residues. The precise function of PHD domains is currently unknown; however, the PHD domains of the ING1 and ING2 tumor suppressors have been shown recently to bind phosphoinositides (PIs). We have recently identified a novel PHD-containing protein, Pf1, as a binding partner for the abundant and ubiquitous transcriptional corepressor mSin3A. Pf1 contains two PHD zinc fingers, PHD1 and PHD2, and functions to bridge mSin3A to the TLE1 corepressor. Here, we show that PHD1, but not PHD2, binds several monophosporylated PIs but most strongly to PI(3)P. Surprisingly, a polybasic region that follows the PHD1 is necessary for PI(3)P binding. Furthermore, this polybasic region binds specifically to PI(3)P when fused to maltose-binding protein, PHD2, or as an isolated peptide, demonstrating that it is sufficient for specific PI binding. By exchanging the polybasic regions between different PHD fingers we show that this region is a strong determinant of PI binding specificity. These findings establish the Pf1 polybasic region as a phosphoinositide-binding module and suggest that the PHD domains function down-stream of phosphoinositide signaling triggered by the interaction between polybasic regions and phosphoinositides.  (+info)

Proteomic, microarray, and signature-tagged mutagenesis analyses of anaerobic Pseudomonas aeruginosa at pH 6.5, likely representing chronic, late-stage cystic fibrosis airway conditions. (5/14)

 (+info)

Solid-state NMR spectroscopy of a membrane protein in biphenyl phospholipid bicelles with the bilayer normal parallel to the magnetic field. (6/14)

 (+info)

Liquid crystalline phase of G-tetrad DNA for NMR study of detergent-solubilized proteins. (7/14)

 (+info)

Conformational dynamics of an intact virus: order parameters for the coat protein of Pf1 bacteriophage. (8/14)

 (+info)

PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
These genetic analyses, together with the sequence comparison of the N terminus of Sec3 with that of Gic2, have also led to the identification of a polybasic region in Sec3 that is crucial for its function. Using the vesicle sedimentation assay, we found that the polybasic region interacts with PIP2. Disruption of the Sec3-PIP2 interaction (sec3-202 and sec3-203) affects Sec3 function. What is the functional implication of this interaction? One possibility is that this interaction may serve to make Sec3 more accessible as a downstream effector of Cdc42 at the plasma membrane. However, blocking Cdc42 binding in the sec3-201 mutant affected, but did not totally abolish, the function of Sec3N. Only when PIP2 and Cdc42 binding were both disrupted did the sec3 mutants (sec3-204 and sec3-205) become synthetic lethal with exo70-38. Thus, both Cdc42 and PIP2 are needed for the complete function of Sec3N. Another possibility is that PIP2 acts in concert with Cdc42 to coactivate Sec3. The synergy in which ...
TY - JOUR. T1 - Hybridization of TEDOR and NCX MAS solid-state NMR experiments for simultaneous acquisition of heteronuclear correlation spectra and distance measurements. AU - Tata, Gopinath. AU - Wang, Songlin. AU - Lee, John. AU - Aihara, Hideki. AU - Veglia, Gianluigi. N1 - Funding Information: Acknowledgements This work was supported by the National Institute of Health (GM 64742 to G.V. and R35 GM118047 to H.A.). Many thanks to Dr. D. Weber for critical reading and editing the manuscript. Publisher Copyright: © 2019, Springer Nature B.V.. PY - 2019/4/15. Y1 - 2019/4/15. N2 - Magic angle spinning (MAS) solid-state NMR (ssNMR) spectroscopy is a major technique for the characterization of the structural dynamics of biopolymers at atomic resolution. However, the intrinsic low sensitivity of this technique poses significant limitations to its routine application in structural biology. Here we achieve substantial savings in experimental time using a new subclass of Polarization Optimized ...
Filamentous bacteriophages were engineered to express foreign genes with the ultimate purpose of displaying transmission control anti-malarial peptides as in phage display. It was hypothesized that expression of foreign genes would be possible using the phages promoters. This hypothesis was tested by assuming that promoters for the phage major coat protein (MCP) gene would also promote the expression of any foreign gene inserted downstream of the MCP gene. As proof of principle, the bacteriophages Pf3, Pf1, and M13 were engineered in this way to successfully synthesize Enhanced Green Fluorescent Protein (EGFP). Type 88 phage display on the EGFP recombinant Pf3 was attempted by fusing a second copy of its MCP gene to the existing EGFP gene. This resulted in a phage display Pf3 replacement vector which was then used to construct a phage for displaying an anti-malarial peptide.
The configuration of oximes ,b,1a,/b, and ,b,1b,/b, was investigated by chemical and spectroscopic methods. Under the Beckmann rearrangement conditions, using sulfonyl chlorides as reagents, the sulfonic esters ,b,2a-c,/b, were obtained. Under more drastic conditions, using PCl,sub,5,/sub, or P,sub,2,/sub,O,sub,5,/sub,, the only isolated product was 4-nitro-5H-furan-2-on (,b,3,/b,). It was also formed as the sole product by hydrolysis of oximes ,b,1a-b,/b,, as well as sulfonic ester ,b,2a,/b,. The structure of all compounds was determined by one- and twodimensional homo- and hetero-nuclear ,sup,1,/sup,H and ,sup,13,/sup,C NMR correlated spectra: COSY, NOESY, HETCOR and HMBC. Gradient selected differential NOE measurements confirmed that, in dimethylsulfoxide solution, oximes ,b,1a,/b, and ,b,1b,/b, exist in ,i,E,/i,-configuration, irrespective of the route of their formation ...
The presence of slow motions with large amplitudes, as detected by measurements based on residual dipolar couplings [Peti, W., Meiler, J., Brueschweiler, R. and Griesinger, C. (2002) J. Am. Chem. Soc.
2KSJ: Structure and Dynamics of the Membrane-bound form of Pf1 Coat Protein: Implications for Structural Rearrangement During Virus Assembly
Purpose: : There are a number of human diseases which are linked to the failure of proper gap junction control. Mutations in PKCγ C1B domains are associated with Human Spinocerebellar Ataxia, SCA-14. The mutations lead to an impaired cellular response to extracellular signals and oxidative stress. The purpose of this research is to determine the structural influence of C1B domains mutations on the functional activation of PKCγ, a major lens PKC. Methods: : We used molecular dynamics simulations and the solved NMR structure to compare the energy-minimized structures of PKCγ WT and mutant proteins. We purified the C1B domain and several variants using a bacterial expression system and carried out multi-dimensional hetero-nuclear NMR. C1B domain mutations H101Y and S119P were introduced into a GST linked pGEX-6p vector and subsequently transfected into BLD-21 low competency E. coli cells. The fusion proteins were treated with lysate buffer and then clarified by centrifugation and filtration ...
Pauling built a amazing prediction relating to this variation in 1949, when he wrote: Lets suggest that theres a floor region over the . . . sickle cell anemia hemoglobin molecule and that is absent in the normal molecule and that has a configuration complementary to a unique region on the surface with the hemoglobin molecule. . . .Below the appropriate problems [as in small oxygen or air force], then, the sickle mobile anemia hemoglobin molecules could possibly be effective at interacting with one another at these web Read Full Article pages adequately to lead to no less than a partial alignment from the molecules in the mobile, resulting in the erythrocytes . . . membranes remaining distorted to accomodate the now fairly rigid buildings inside of its confines ...
Myocardial disarray, also known as myocyte disarray, is a term to describe the loss of the normal parallel alignment of myocytes (the muscle cells of the heart). Instead, the myocytes usually form circles around foci of connective tissue. Myocardial disarray is associated with myocardial fibrosis (the replacement of the myocytes with non-contractile scar tissue). Myocardial disarray can be seen in a number of disease states, including: Aortic stenosis Congenital heart disease Hypertensive heart disease Hypertrophic cardiomyopathy The common factor amongst all these diseases is that they all cause varying degrees of remodelling (myocardial fibrosis) of the ventricles. Myocardial disarray. A critical review Information from the Stanford Hypertrophic Cardiomyopathy ...
Establishing connectivity and proximity of nuclei is an important step in elucidating the structure and dynamics of molecules in solids using magic angle spinning (MAS) NMR spectroscopy. Although recent studies have successfully demonstrated the feasibility of proton-detected multidimensional solid-state NMR experiments under ultrafast-MAS frequencies and obtaining high-resolution spectral lines of protons, assignment of proton resonances is a major challenge. In this study, we first re-visit and demonstrate the feasibility of 2D constant-time uniform-sign cross-peak correlation (CTUC-COSY) NMR experiment on rigid solids under ultrafast-MAS conditions, where the sensitivity of the experiment is enhanced by the reduced spin-spin relaxation rate and the use of low radio-frequency power for heteronuclear decoupling during the evolution intervals of the pulse sequence. In addition, we experimentally demonstrate the performance of a proton-detected pulse sequence to obtain a 3D {sup 1}H/{sup ...
The 15 mini-Tn5 inserted genes encoded proteins from almost all functional classes (Table S3 in Text S1): hypothetical, unknown, unclassified proteins (PA2972, PA4842, PA5028), motility and attachment (PA0410-pilI, PA0499, PA1077-flgB, PA4554-pilY1), putative enzymes (PA1856), transport of small molecules (PA0890-aotM, PA2252, PA4887), amino acid biosynthesis and metabolism (PA0895-aruC), energy metabolism (PA2998-nqrB), secreted factors (PA3478-rhlB), chaperones and heat shock proteins (PA5053-hslV). However, we noted that some insertions map into either the first or internal genes of certain operons, as listed in Table S3 in Text S1, and polar effects on the expression of downstream genes could account for the observed phenotype. In the case of mutants 70T5K and 70T15K, the Pos-STM phenotype can be due to a combination effect caused by the double insertion and or recombination events. Finally, since the intergenic transposon insertion in the 70T22T STM mutant is between convergent PA loci, we ...
The role of lipids in the aggregation of three Alzheimer model peptides was investigated with circular dichroism spectroscopy and high-sensitivity titration calorimetry under conditions of low ionic strength. In solution, the peptides beta AP(25-35)OH and beta AP(25-35Nle)NH2 exhibit a reversible random-coilbeta-sheet (or beta-structured aggregate) transition. Addition of lipid vesicles containing negatively charged lipids shifts the random-coilbeta-sheet equilibrium almost completely toward beta-sheet structure, which can be explained by the specific conditions created at the membrane surface: the cationic peptides are attracted to the negatively charged membrane, and the increase in peptide concentration together with the partial alignment of the peptide molecules then facilitates beta-sheet formation. The third peptide, beta AP-(25-35)NH2, also binds to the lipid membrane but was found to adopt an essentially random-coil structure, both with and without lipids. A quantitative characterization ...
Whereas the rigid nature of standard thermoelectrics limits their use, flexible thermoelectric platforms can find much broader applications, for example, in low-power, wearable energy harvesting for internet-of-things applications. Here we realize continuous, flexible thermoelectric threads via a rapid extrusion of 3D-printable composite inks (Bi2Te3 n- or p-type micrograins within a non-conducting polymer as a binder) followed by compression through a roller-pair, and we demonstrate their applications in flexible, low-power energy harvesting. The thermoelectric power factors of these threads are enhanced up to 7 orders-of-magnitude after lateral compression, principally due to improved conductivity resulting from reduced void volume fraction and partial alignment of thermoelectric micrograins. This dependence is quantified using a conductivity/Seebeck vise for pressure-controlled studies. The resulting grain-to-grain conductivity is well explained with a modified percolation theory to model a pressure
Protein dynamics in the solid-state from 2H NMR lineshape analysis. III. MOMD in the presence of Magic Angle Spinning Publication date: Available
Properties of Mixtures of Cholesterol with Phosphatidylcholine or with Phosphatidylserine Studied by 13C Magic Angle Spinning Nuclear Magnetic Resonance Academic Article ...
Author: Mukrasch, M. et al.; Genre: Journal Article; Published in Print: 2007; Title: Highly populated turn conformations in natively unfolded Tau protein identified from residual dipolar couplings and molecular simulation
DNA signature tags (molecular barcodes) facilitate functional screens by identifying mutants in mixed populations that have a reduced or increased adaptation to a particular environment. Many innovative adaptations and refinements in the technology have been described since its original use with Salmonella; they have yielded a wealth of information on a broad range of biological processes--mainly in bacteria, but also in yeast and other fungi, viruses, parasites and, most recently, in mammalian cells. By combining whole-genome microarrays and comprehensive ordered libraries of mutants, high-throughput functional screens can now be achieved on a genomic scale.
What would a caveman consider to be magical, like his source for magic power? Poo. I mean how does a caveman know where poo comes from, how its made, it just appears, as if by magic ...
Magic links are a feature of MediaWiki core that create automatic links for three hardcoded external identifiers. As of MediaWiki 1.28, this feature is disabled by default but may be enabled using the ...
Whats so magical about them? Who knows? Theyre a type of wiki formatting that remains elusive to the new user. Magic words include: ...
Magic Forum: Signs Of Shifting? - Hi, Its me again. So I havent been feeling myself as of lately. Ive been feeling numb. Ive been waking up....
Not really .. it only started in 1800. The best thing about it is that it doesnt do anything :D ..as opposed to modern pills which often have dreadful...
pagenav.currentPage-1)*pagenav.itemPerPage+1}}-{{(pagenav.currentPage-1)*pagenav.itemPerPage+pagenav.dataInfo.products.length}} of {{pagenav.dataInfo.summary.total , number}} items {{pagenav.dataInfo.summary.total , number}} items ...
تولیدکنندگان محصولات شبکه بر اساس گزارش سال ۲۰۱۸ موسسه گارتنر وضعیت و جایگاه شرکت های تولید کننده محصولات شبکه به شرح زیر می باشد. Magic Quadrant
disney world magic kingdom theBB Jul 19, 08:22 PM Well, during 2000-2001 that was a long waiting period for OSX... and then of course durin ...
Calcium-43 (nuclear spin, S = 7/2) is an NMR insensitive low-gamma quadrupolar nucleus and up until recently only one-dimensional solid-state Ca-43 NMR spectra have been reported. Through-space correlation experiments are challenging between spin-1/2 and low-gamma quadrupolar nuclei because of the intrinsically weak dipolar interaction and the often-low natural abundance of the quadrupolar nucleus. Rotary-resonance recoupling (R-3) has recently been used to re-introduce hetero-nuclear dipolar interactions for sensitive high-gamma quadrupolar nuclei, but has not yet been applied in the case of low-gamma half-integer quadrupolar nuclei. Here an effective and robust 2D H-1-Ca-43 NMR correlation experiment combining the R-3 dipole-recoupling scheme with 2D HMQC is presented. It is demonstrated that the weak Ca-43-H-1 dipolar coupling in hydroxyapatite and oxy-hydroxyapatite can be readily re-introduced and that this recoupling scheme is more efficient than conventional cross-polarization transfer. ...
The extraintestinal pathogen, avian pathogenic E. coli (APEC), known to cause systemic infections in chickens, is responsible for large economic losses in the poultry industry worldwide. In order to identify genes involved in the early essential stages of pathogenesis, namely adhesion and colonization, Signature-tagged mutagenesis (STM) was applied to a previously established lung colonization model of infection by generating and screening a total of 1,800 mutants of an APEC strain IMT5155 (O2:K1:H5; Sequence type complex 95). The study led to the identification of new genes of interest, including two adhesins, one of which coded for a novel APEC fimbrial adhesin (Yqi) not described for its role in APEC pathogenesis to date. Its gene product has been temporarily designated ExPEC Adhesin I (EA/I) until the adhesin-specific receptor is identified. Deletion of the ExPEC adhesin I gene resulted in reduced colonization ability by APEC strain IMT5155 both in vitro and in vivo. Furthermore, complementation of
CREST. The accurate identification of structural variations using whole-genome DNA sequencing data generated by next-generation sequencing technology is extremely difficult. To address this challenge, we have developed CREST, an algorithm that uses sequencing reads with partial alignments to the reference human genome (so-called soft-clipped reads) to directly map the breakpoints of somatic structural variations. We applied CREST to paired tumor/normal whole genome sequencing data from five cases of T-lineage acute lymphoblastic leukemia (T-ALL). A total of 110 somatic structural variants were identified, ,80% of which were validated by genomic PCR and Sanger sequencing. The validated structural variants included 31 inter-chromosomal translocations, 19 intra-chromosomal translocations, one inversion, 22 deletions and 16 insertions. A comparison of the results generated with CREST to those obtained using the traditional paired-end discordant mapping methods demonstrate CREST to have a much higher ...
Fingerprint Dive into the research topics of Intratumoral Agreement of High-Resolution Magic Angle Spinning Magnetic Resonance Spectroscopic Profiles in the Metabolic Characterization of Breast Cancer. Together they form a unique fingerprint. ...
Description: The development of fast magic angle spinning (MAS) opened up an opportunity for the indirect detection of insensitive low-{gamma} nuclei (e.g., {sup 13}C and {sup 15}N) via the sensitive high-{gamma} nuclei (e.g., {sup 1}H and {sup 19}F) in solid-state NMR, with advanced sensitivity and resolution. In this thesis, new methodology utilizing fast MAS is presented, including through-bond indirectly detected heteronuclear correlation (HETCOR) spectroscopy, which is assisted by multiple RF pulse sequences for {sup 1}H-{sup 1}H homonuclear decoupling. Also presented is a simple new strategy for optimization of {sup 1}H-{sup 1}H homonuclear decoupling. As applications, various classes of materials, such as catalytic nanoscale materials, biomolecules, and organic complexes, are studied by combining indirect detection and other one-dimensional (1D) and two-dimensional (2D) NMR techniques. Indirectly detected through-bond HETCOR spectroscopy utilizing refocused INEPT (INEPTR) mixing was ...
For the Ras-binding domain of the protein kinase Byr2, only a limited number of NOE contacts could be initially assigned unambiguously, as the quality of the NOESY spectra was too poor. However, the use of residual (1)H-(15)N dipolar couplings in the beginning of the structure determination process allows to overcome this problem. We used a three-step recipe for this procedure. A previously unknown structure could be calculated reasonably well with only a limited number of unambiguously assigned NOE contacts. ...
The European Physical Journal D (EPJ D) presents new and original research results in Atomic, Molecular, Optical and Plasma Physics
1C06: Refining the overall structure and subdomain orientation of ribosomal protein S4 delta41 with dipolar couplings measured by NMR in uniaxial liquid crystalline phases.
Back in Print!Master illusionist Mark Wilson has compiled the most comprehensive magic teach-in ever assembled. The secrets to more than 300 classic tricks-from sleight of hand to levitation-are carefully explained in this 503-page volume. Its all here: Card Magic, Coin Magic, Rope Magic, Mental Magic, Make-at-Home
Couldnt detect gpg so will proceed without verification! , gpg.exe is in C:\texlive\2016\tlpkg\installer\gpg, but is not in the Should be fixed after today, hopefully ;-) Sorry. Norbert ------------------------------------------------------------------------ PREINING, Norbert http://www.preining.info JAIST, Japan TeX Live & Debian Developer GPG: 0x860CDC13 fp: F7D8 A928 26E3 16A1 9FA0 ACF0 6CAC A448 860C DC13 ...
Incredible Magic At The Bar - Volumes 1-5: Michael Maxwells Incredible Magic...Made Easy! is a multi-volume DVD series designed to teach you how to easily master and performm some of the...
The trouble cauldron is bubbling over at the Magic Factory, so the chief magic officer consults his crystal ball. But, is the balls advice as simple as it appears to be?
Anyone would be lucky to wear our Adult Magic Hat Rabbit Costume. Featuring a complete bunny head-piece, this rabbit costume is sure to create magic.
Magic Forum: Magickal drainage? - Ive worked a few spells in the recent few weeks and have seen a notable amount of success and change in....
The magic angle is a precisely defined angle, the value of which is approximately 54.7356°. The magic angle is a root of a second-order Legendre polynomial, P2(cos θ) = 0, and so any interaction which depends on this second-order Legendre polynomial vanishes at the magic angle. This property makes the magic angle of particular importance in magic angle spinning solid-state NMR spectroscopy. In magnetic resonance imaging, structures with ordered collagen, such as tendons and ligaments, oriented at the magic angle may appear hyperintense in some sequences, this is called the magic angle artifact or effect. The magic angle θm is θ m = arccos ⁡ 1 3 = arctan ⁡ 2 ≈ 0.955 32 rad ≈ 54.7 ∘ , {\displaystyle \theta _{\mathrm {m} }=\arccos {\frac {1}{\sqrt {3}}}=\arctan {\sqrt {2}}\approx 0.955\,32\ {\text{rad}}\approx 54.7^{\circ }\!,} where arccos and arctan are the inverse cosine and tangent functions respectively. A195696 θm is the angle between the space diagonal of a cube and any of its ...
TY - JOUR. T1 - DNA that is dispersed in the liquid crystalline phases of phospholipids is actively transcribed. AU - Corsi, J.. AU - Dymond, Marcus. AU - Ces, O.. AU - Muck, J.. AU - Zink, D.. AU - Attard, George S.. PY - 2008/5/28. Y1 - 2008/5/28. N2 - We report that a 4.3 kbp linearised T7 DNA plasmid is actively transcribed when it is dispersed in the hexagonal liquid crystalline phase of dioleoylphosphoethanolamine (DOPE).. AB - We report that a 4.3 kbp linearised T7 DNA plasmid is actively transcribed when it is dispersed in the hexagonal liquid crystalline phase of dioleoylphosphoethanolamine (DOPE).. U2 - 10.1039/b801199k. DO - 10.1039/b801199k. M3 - Article. SP - 2307. EP - 2309. JO - Chemical Communications. JF - Chemical Communications. SN - 1359-7345. IS - 20. ER - ...
Understanding the molecular interactions between inorganic phases such as silica and organic material is fundamental for chromatographic applications, for tailoring silica enzyme interactions, and for elucidating the mechanisms of biomineralization. The formation, structure, and properties of the organic/inorganic interface is crucial in this context. Here, we investigate the interaction of selectively C-13-labeled choline with Si-29-labeled monosilicic acid/silica at the molecular level. Silica/choline nanocomposites were analyzed by solid-state NMR spectroscopy in combination with extended molecular dynamics (MD) simulations to understand the silica/organic interface. Cross polarization magic angle spinning (CP MAS)-based NMR experiments like H-1-C-13 CP-REDOR (rotational-echo double resonance), H-1-C-13 HETCOR (heteronuclear correlation), and H-1-Si-29-H-1 double CP are employed to determine spatial parameters. The measurement of Si-29-C-13 internuclear distances for selectively C-13-labeled choline
Structural plasticity and Mg2+ binding properties of RNase P P4 from combined analysis of NMR residual dipolar couplings and motionally decoupled spin relaxation.
UCL Discovery is UCLs open access repository, showcasing and providing access to UCL research outputs from all UCL disciplines.
M184/Page34/USP9Y+3178, CTS150, CTS482/PF5596, CTS493/PF5597, CTS549/L1322/PF5598, CTS573, CTS3585/PF5618, CTS3837, CTS4014, CTS4201/PF5621, CTS4652/PF5547, CTS5035, CTS5268/PF7471, CTS5336/PF5626, CTS6045/PF5629, CTS6275/PF7447, CTS6887/PF5637, CTS7164, CTS7263, CTS7426, CTS7749/L810/PF5640, CTS8247, CTS8994, CTS10416/PF5655, CTS10700, CTS10879, CTS11569, CTS12657, L445, L452, L455/PF5670, L692, M193, M272/PF5667, Page129, PF5529, PF5537, PF5568, PF5587, PF5589, PF5590, PF5603, PF5607, PF5609, PF5612, PF5613, PF5657, PF5661, PF5674, PF5678, PF7460, PF7464, PF7466, ...
Im having some strange results with GPG. Im getting quite a few BAD signatures from people whos public keys are on my keyring and even the occasional bad signature from MYSELF. I know that there are some options that are on (or off) by default in GPG due to OpenPGP standards, but that conflict with PGP default settings. However, I dont think Ive ever seen an actual PGP signature on this list (most are GPG). Any suggestions? -Alex ...
Magic Kits by Mikael Montier is an exclusive and innovative new way of performing amazing, spectacular magic tricks straight from your smart
I hope you enjoy doing these effects as much as Ive enjoyed doing them during my magic life.- Johnny PaulThink of the best in magic and this man comes to mind. Groomed in Chicago as Americas first bar magician, Johnny quickly rose to the top of his field. His years performing at the Showboat Hotel have proved to all
在 Dream Hills:Captured Magic 裡,邪惡的巫婆對童話王國施展黑色魔法。在這款隱藏物件遊戲裡,黑暗統治一切,快樂與歡笑消失無蹤。拯救您最喜愛的童話人物,破除咒語,讓 Dream Hills 重返舊日的榮耀。今天就進入 Dream Hills:Captured Magic 的童話王國!. ...
data_MAGIC ,- magic(magic_testdata, genes=all_genes, t=6, init=data_MAGIC) as.data.frame(data_MAGIC)[1:5, 1:10] #, A1BG-AS1 AAMDC AAMP AARSD1 ABCA12 ABCG2 #, 6564 0.02565716 0.06303703 0.1726791 0.01559474 0.03114244 0.01423031 #, 3835 0.02535551 0.06286382 0.1678011 0.01547390 0.03017628 0.01428737 #, 6318 0.02619089 0.06298015 0.1744098 0.01514747 0.03145176 0.01477152 #, 3284 0.02517645 0.06254417 0.1684572 0.01559623 0.03015758 0.01414733 #, 1171 0.02651602 0.06289360 0.1729842 0.01514780 0.03162480 0.01480426 #, ABHD13 AC007773.2 AC011998.4 AC013470.6 #, 6564 0.07100262 0.001129400 0.001880153 0.003215547 #, 3835 0.06989726 0.001086716 0.001847604 0.002833342 #, 6318 0.07165035 0.001203505 0.002044504 0.003550067 #, 3284 0.07066602 0.001039065 0.001723499 0.002822357 #, 1171 0.07094679 0.001236082 0.002133401 0.003450875 ...
One of the biggest sayings in magic is that a true magician never reveals their secrets. This has become taken at face value in our culture. Some people accept it for what it is, while others become frustrated. No matter your feelings on the matter, many accept it as an inevitability.
Tenemos un amplio stock en: Juegos de mesa; Cubos Rubik; Cartas Magic/Pok mon y Yu-Gi-Oh y muchas cositas m s. Pasa a conocernos!
Tenemos un amplio stock en: Juegos de mesa; Cubos Rubik; Cartas Magic/Pok mon y Yu-Gi-Oh y muchas cositas m s. Pasa a conocernos!
Advanced techniques for making eForms in Oscar 12_1 Including Database pulls - simple, measurements, enhanced and extended as well as Templates to paste into ...
... , PF-1, PF01, PF-01, or variant, may refer to: PSA PF1 platform, the "PF1" platform from PSA pf1, a bacteriophage code, see ... PF-1), "PF-1" ship number Thai patrol frigate HTMS Tachin Shenyang PF-1, model PF-1 jet engine from Shenyang MANOI PF01, model ... model PF-1 glider "White Knight" from Posnansky/Fronius USS Asheville (PF-1), "PF-1" ship number USN patrol frigate USS ... List of MeSH codes (B04) Pf1, a Pseudomonas phage, see List of viruses Posnansky/Fronius PF-1 White Knight, ...
... species Pseudomonas virus Pf1 Pf1 phage genus Tertilicivirus) species Pseudomonas virus Pf3 - bacteriophages that infect ... species Escherichia virus M13 M13 bacteriophage f1 phage species Filamentous bacteriophage fd (proposal) fd phage genus ... whereas Class II includes strains Pf1 (of ICTV's species Pseudomonas virus Pf1 of genus Primolicivirus), and perhaps also Pf3 ( ... inactivated infectivity as predicted for a filamentous bacteriophage morphology. Three filamentous bacteriophages, fd, f1 and ...
... bacteriophage phi x 174 MeSH B04.123.660.535 - bacteriophage pf1 MeSH B04.123.660.550 - bacteriophage phi 6 MeSH B04.123. ... bacteriophage ike MeSH B04.123.370.400.250 - bacteriophage m13 MeSH B04.123.370.400.300 - bacteriophage pf1 MeSH B04.123. ... bacteriophage ike MeSH B04.280.400.400.250 - bacteriophage m13 MeSH B04.280.400.400.300 - bacteriophage pf1 MeSH B04.280. ... bacteriophage p1 MeSH B04.123.205.305 - bacteriophage p2 MeSH B04.123.205.320 - bacteriophage phi x 174 MeSH B04.123.205.350 - ...
... filters-fiberglass-HeLa cells-bacteriophage T4)". Proc. Natl. Acad. Sci. U.S.A. 69 (2): 417-21. doi:10.1073/pnas.69.2.417. PMC ... hydrolase RNA formation factors PF1 Adenosine triphosphate:ribonucleic acid adenylyltransferase This enzyme is responsible for ...
DNA sequence of the filamentous bacteriophage Pf1.. Hill DF1, Short NJ, Perham RN, Petersen GB. ... The genome of the class II filamentous bacteriophage Pf1 has been sequenced by a combination of the chain termination and ... The Pf1 genome contains no collection of potential stem-and-loop structures corresponding to those that initiate replication of ... Overall, the organization of the Pf1 genome differs from that of the other class II filamentous phage whose genome has been ...
Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre ... PF1 FILAMENTOUS BACTERIOPHAGE A 46 Pseudomonas virus pf1 Details: MAJOR COAT PROTEIN ASSEMBLY IN THE LOWER-TEMPERATURE SYMMETRY ... PF1 FILAMENTOUS BACTERIOPHAGE: REFINEMENT OF A MOLECULAR MODEL BY SIMULATED ANNEALING USING 3.3 ANGSTROMS RESOLUTION X-RAY ...
Nambudripad, R., Stark, W., Opella, S. J. & Makowski, L. (1991). Membrane-mediated assembly of filamentous bacteriophage Pf1 ... Thiriot, D. S., Nevzorov, A. A. & Opella, S. J. (2005). Structural basis of the temperature transition of Pf1 bacteriophage. ... NMR studies of the structure and dynamics of membrane-bound bacteriophage Pf1 coat protein. Science 252, 1303-1305. ... Structure of the coat protein in Pf1 bacteriophage determined by solid-state NMR spectroscopy. Journal of Molecular Biology 341 ...
Pseudomonas phage Pf1 (Bacteriophage Pf1)Imported. Automatic assertion inferred from database entriesi ... tr,Q56VP4,Q56VP4_BPPF1 PA0721 OS=Pseudomonas phage Pf1 OX=2011081 PE=4 SV=1 MLRYLSLFAVGLATGYAWGWIDGLAASLAV Align. Format. Add ...
Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre ... PF1 FILAMENTOUS BACTERIOPHAGE: REFINEMENT OF A MOLECULAR MODEL BY SIMULATED ANNEALING USING 3.3 ANGSTROMS RESOLUTION X-RAY ...
The bacteriophage implicated in biofilm killing was closely related to the filamentous phage Pf1 and existed as a prophage ... We found evidence of wild-type RF molecules in the Pf1::Gmr strain by using PCR primers Pf1 3 and Pf1 4, which amplify a region ... A Pf1::Gmr cassette was constructed by (i) PCR amplifying Pf1 genes from genomic DNA of P. aeruginosa PAO1 with primers Pf1 3 ( ... By using the Pf1-specific PCR primers 437F and 437R, which recognize Pf1 open reading frame 437, we detected and confirmed by ...
DNA sequence of the filamentous bacteriophage Pf1. Hill DF, Short NJ, Perham RN, Petersen GB ...
coat protein B of bacteriophage Pf1 Pseudomonas aeruginosa UCBPP-PA14 PA14_48940 coat protein B of bacteriophage Pf1) 82 92.7 ... probable coat protein A of bacteriophage Pf1 Pseudomonas aeruginosa UCBPP-PA14 PA14_48930 coat protein A of bacteriophage Pf1 ... hypothetical protein of bacteriophage Pf1 Pseudomonas aeruginosa UCBPP-PA14 PA14_49000 hypothetical protein 70 95.7 ... hypothetical protein of bacteriophage Pf1 Pseudomonas aeruginosa UCBPP-PA14 PA14_48990 hypothetical protein 96 96.9 ...
Century-long research has suggested treating patients with bacteriophages (phages, prokaryotic viruses) naturally hosted by ... Century-long research has suggested treating patients with bacteriophages (phages, prokaryotic viruses) naturally hosted by ... Small colony variants and single nucleotide variations in Pf1 region of PB1 phage-resistant Pseudomonas aeruginosa. Front. ... Ackermann, H. W. (2005). "Bacteriophage classification," in Bacteriophages: Biology and Applications, eds E. Kutter, and A. ...
Zweckstetter, M.; Bax, A.: Characterization of molecular alignment in aqueous suspensions of Pf1 bacteriophage. Journal of ...
Studies of the Unusually Extended DNA Inside the Pf1 Bacteriophage by Solid-State NMR and Computational Methods ...
Bacteriophage / Human Immune Interactions. We recently reported that bacteriophage present at sites of bacterial infection are ... Two other phages, Pf1 and fd, did not inhibit Af, nor did supernatant from a Pa strain incapable of producing Pf4. Pf4, but not ... Fd, a related bacteriophage of Escherichia coli, has similar biofilm-building capabilities. Targeting filamentous bacteriophage ... 2019 sought to kill cancer-causing bacteria with bacteriophages. However, the bacteriophages themselves directly stimulated an ...
Two other phages, Pf1 and fd, did not inhibit Af, nor did supernatant from a Pa strain incapable of producing Pf4. Pf4, but not ... Here, we report that the bacteriophage Pf4, produced by Pa, can inhibit the metabolic activity of Af biofilms. This phage- ... Pf4 bacteriophage produced by Pseudomonas aeruginosa inhibits Aspergillus fumigatus metabolism via iron sequestration ... Pf1, attaches to Af hyphae in an avid and prolonged manner, suggesting that Pf4-mediated inhibition of Af may occur at the ...
RDCs were measured for wild-type PDEγ aligned in 14 mg/ml of bacteriophage Pf1 (Alsa), 20 mM MOPS, and 200 mM NaCl, pH 6.5. To ...
DNP experiments were performed on Pf1 bacteriophage with non-uniform sampling (NUS) for rapid acquisition of multidimensional ...
PF1, PF-1, PF01, PF-01, or variant, may refer to: PSA PF1 platform, the "PF1" platform from PSA pf1, a bacteriophage code, see ... PF-1), "PF-1" ship number Thai patrol frigate HTMS Tachin Shenyang PF-1, model PF-1 jet engine from Shenyang MANOI PF01, model ... model PF-1 glider "White Knight" from Posnansky/Fronius USS Asheville (PF-1), "PF-1" ship number USN patrol frigate USS ... List of MeSH codes (B04) Pf1, a Pseudomonas phage, see List of viruses Posnansky/Fronius PF-1 White Knight, ...
... species Pseudomonas virus Pf1 Pf1 phage genus Tertilicivirus) species Pseudomonas virus Pf3 - bacteriophages that infect ... species Escherichia virus M13 M13 bacteriophage f1 phage species Filamentous bacteriophage fd (proposal) fd phage genus ... whereas Class II includes strains Pf1 (of ICTVs species Pseudomonas virus Pf1 of genus Primolicivirus), and perhaps also Pf3 ( ... inactivated infectivity as predicted for a filamentous bacteriophage morphology. Three filamentous bacteriophages, fd, f1 and ...
The bacteriophages of Pa physically alter biofilms, and were recently shown to inhibit the biofilms of Aspergillus fumigatus. ... To understand the range of this viral-fungal interaction, we studied Pa phages Pf4 and Pf1, and their interactions with Ca ... Bacteriophage-fungal interactions may be a general feature with several pathogens in the fungal kingdom. ...
12 MG/ML PF1 REMARK 210 BACTERIOPHAGE REMARK 210 REMARK 210 NMR EXPERIMENTS CONDUCTED : 3D_15N-SEPARATED_NOESY, 3D_ REMARK 210 ...
In this study, SCVs was derived from Pseudomonas aeruginosa exposed to the lytic bacteriophage PB1 and these cells were ... Whole genome sequencing of the SCV revealed multiple single nucleotide variations within the Pf1 prophage region, a genetic ... Phage therapy involves the application of lytic bacteriophages for treatment of clinical infections but bacterial resistance ... Bacteriophage therapy for refractory Pseudomonas aeruginosa urinary tract infection.. Abdel Karim Khawaldeh, Sandra Morales, +7 ...
Bacteriophage Pf1 - Preferred Concept UI. M0027063. Scope note. A species of filamentous Pseudomonas phage in the genus ... Pf1 Phage Pf1 Phages Phage Pf1 Phage, Pf1 Phages, Pf1 Pseudomonas phage Pf1 ... Pf1 Phage. Pf1 Phages. Phage Pf1. Phage, Pf1. Phages, Pf1. Pseudomonas phage Pf1. ... Bacteriophage Pf1 Entry term(s). ...
Four kinds of bacteriophage (φRSL, φRSA, φRSM and φRSS) were isolated from Ralstonia solanacearum, a soil-borne Gram-negative ... Hill, D. F., Short, J., Perharm, N. R. & Petersen, G. B. ( 1991; ). DNA sequence of the filamentous bateriophage Pf1. J Mol ... Model, P. & Russel, M. ( 1988; ). Filamentous bacteriophages. In The Bacteriophages, vol. 2, pp. 375-456. Edited by R. Calendar ... Four kinds of bacteriophage (φRSL, φRSA, φRSM and φRSS) were isolated from Ralstonia solanacearum, a soil-borne Gram-negative ...
hypothetical protein of bacteriophage Pf1 Product Name Confidence: Class 4 Synonyms. Evidence for Translation. ...
The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1 pubmed doi rcsb ...
The bacteriophage Pf1 (1 mg/ml) significantly increased biofilm mass produced by Pseudomonas aeruginosa P14, Escherichia coli ... Addition of F-actin, DNA or Pf1 bacteriophage to 0.5% agar plates increased swarming motility of Pseudomonas aeruginosa Xen5. ... DNA, F-actin, NFs and Pf1 also increased biofilm mass of the fungal C. albicans 1409 strain. ... vimentin and purified Pf1 bacteriophage on biofilm formation and swarming motility of select pathogens including Pseudomonas ...
... bacteriophages ike, m13 and pf1. The plectrovirus genus comprises bacteriophages that infect Acholeplasma and Spiroplasma. [ ... bacteriophage is related to the Salmonella typhimurium bacteriophage MB78. The growth of φmF bacteriophage has been tested on ... Such bacteriophage can be selected as described previously. [0065]Determining an effective amount of the bacteriophage to be ... 0046]We use any bacteriophage, preferably bacteriophages that are virulent for the bacterial strain used in the method. As an ...
Pf1 coat protein in filamentous bacteriophage (at various temperatures) 1PJF. 1ZN5. 2XKM ...
Nuclear spin relaxation of sodium cations in bacteriophage Pf1 solutions. The binding increased in a dose-dependent manner and ...
Makowski, L., Caspar, D. L. D. & Marvin, D. A. (1980). Filamentous bacteriophage Pf1 structure determined at 7 Å resolution by ... Gonzalez, A., Nave, C. & Marvin, D. A. (1995). Pf1 filamentous bacteriophage: refinement of a molecular model by simulated ... Stark, W., Glucksman, M. J. & Makowski, L. (1988). Conformation of the coat protein of filamentous bacteriophage Pf1 determined ... Nambudripad, R., Stark, W. & Makowski, L. (1991). Neutron diffraction studies of the structure of filamentous bacteriophage Pf1 ...
  • Overall, the organization of the Pf1 genome differs from that of the other class II filamentous phage whose genome has been sequenced, Pf3, as much as it does from that of the class I phages Ff and IKe. (nih.gov)
  • The bacteriophage implicated in biofilm killing was closely related to the filamentous phage Pf1 and existed as a prophage within the genome of P. aeruginosa . (asm.org)
  • Current efforts are focused on understanding how bacteriophage interact with mammalian cells, how this infection influences local immunity, and how phage shape the immune response to commensal and pathogenic bacteria. (stanford.edu)
  • Filamentous bacteriophages are among the simplest living organisms known, with far fewer genes than the classical tailed bacteriophages studied by the phage group. (wikipedia.org)
  • This technical difference has little noticeable effect on the overall phage structure, but the extent of independent diffraction data is greater for symmetry Class II than for Class I. This assisted the determination of the Class II phage Pf1 structure, and by extension the Class I structure. (wikipedia.org)
  • inproceedings{Lim2016SmallCV, title={Small Colony Variants and Single Nucleotide Variations in Pf1 Region of PB1 Phage-Resistant Pseudomonas aeruginosa}, author={Wee Shiong Lim and Kevin K. S. Phang and Andy H.-M. Tan and Sam F.-Y. Li and Dave S.-W. Ow}, booktitle={Front. (semanticscholar.org)
  • Phage therapy involves the application of lytic bacteriophages for treatment of clinical infections but bacterial resistance may develop over time. (semanticscholar.org)
  • In this study, SCVs was derived from Pseudomonas aeruginosa exposed to the lytic bacteriophage PB1 and these cells were resistant to subsequent phage infection by PB1. (semanticscholar.org)
  • The Pf1 phage exists largely as bundles of long filamentous phages extending from the bacterial surface [ 19 ]. (biomedcentral.com)
  • Pseudomonas phage Pf1 NMR the suburbs and 5 to the country are using magnetically aligned bacteriophage. (laurenrossimakeup.com)
  • Filamentous bacteriophages were engineered to express foreign genes with the ultimate purpose of displaying transmission control anti-malarial peptides as in phage display. (vcu.edu)
  • Whole genome sequencing revealed several genetic variations between the BIM and phage-sensitive isolate of each strain, most notably in the prophage Pf1 region of the genome. (edu.au)
  • In summary, bacteriophage therapy holds promise for treating P. aeruginosa infections in CRS and CF. Specifically, the CT-PA phage cocktail appears to be safe and effective in treating P. aeruginosa sinus infections in an in vivo animal model. (edu.au)
  • Further investigations are required to determine whether the development of BIMs will hamper the efficacy of lytic bacteriophage therapy, or conversely whether the emergence of phage resistance may create evolutionary trade-offs that can be exploited to decrease resistance to conventional antibiotics. (edu.au)
  • Non-synonymous SNPs were mainly found in an integrated Pf1-like phage and in genes involved in transcriptional regulation, membrane and extracellular constituents, transport, and secretion. (frontiersin.org)
  • DNA sequence of the filamentous bacteriophage Pf1. (nih.gov)
  • The genome of the class II filamentous bacteriophage Pf1 has been sequenced by a combination of the chain termination and chemical degradation methods. (nih.gov)
  • The size and position of its open reading frames (ORFs) in general resemble those of other filamentous bacteriophage genomes. (nih.gov)
  • Filamentous bacteriophage is a family of viruses (Inoviridae) that infect bacteria. (wikipedia.org)
  • Three filamentous bacteriophages, fd, f1 and M13, were isolated and characterized by three different research groups in the early 1960s, but they are so similar that they are sometimes grouped under the common name "Ff", which are members of genus Inovirus, as acknowledged by the International Committee on Taxonomy of Viruses (ICTV). (wikipedia.org)
  • The primary immunity determinant in modulating the lysogenic immunity of the filamentous bacteriophage cf. (microbiologyresearch.org)
  • X-ray fibre diffraction patterns of well-aligned Pf1 filamentous bacteriophage show sharp layer-lines attributable to an ordered helical array of protein subunits. (kneegasp.top)
  • The effects of Pf1 on biofilm formation by bacterial strains that it cannot infect suggests that the physicochemical properties of Pf1 and similar polyelectrolytes, rather than any specific biological effect of the bacteriophage on the bacteria is required for it to support biofilm formation by different microorganisms. (biomedcentral.com)
  • Lytic bacteriophages are bacterial viruses that can infect, replicate within, and lyse bacteria, killing the host bacteria through lysis. (edu.au)
  • The NMR-Rosetta capsid model of M13 bacteriophage reveals a quadrupled hydrophobic packing epitope. (semanticscholar.org)
  • During the onset of biofilm killing and during biofilm development thereafter, a bacteriophage capable of superinfecting and lysing the P. aeruginosa parent strain was detected in the fluid effluent from the biofilm. (asm.org)
  • This study was designed to assess the impact of diverse natural polyelectrolytes, such as DNA, F-actin, neurofilaments (NFs), vimentin and purified Pf1 bacteriophage on biofilm formation and swarming motility of select pathogens including Pseudomonas aeruginosa associated with lung infections in CF patients. (biomedcentral.com)
  • The bacteriophage Pf1 (1 mg/ml) significantly increased biofilm mass produced by Pseudomonas aeruginosa P14, Escherichia coli RS218 and Bacillus subtilis ATCC6051. (biomedcentral.com)
  • DNA, F-actin, NFs and Pf1 also increased biofilm mass of the fungal C. albicans 1409 strain. (biomedcentral.com)
  • The PA strain PAO1 strongly up-regulates genes encoding Pf1-like phages at the start of biofilm formation, and Pf1-like virions are present at 100 to 1000 fold higher levels in biofilms when compared with planktonic PA cultures [ 18 ]. (biomedcentral.com)
  • This report indicates that addition of diverse natural polyelectrolytes, including purified Pf1 bacteriophage, to different bacteria or Candida albicans cultures results in increased biofilm formation. (biomedcentral.com)
  • The emergence of bacteriophage insensitive mutants (BIMs) in P. aeruginosa biofilms exposed to CT-PA was also explored in an in vitro biofilm model, using whole genome sequencing and antibiotic susceptibility testing. (edu.au)
  • The Pf1 genome contains no collection of potential stem-and-loop structures corresponding to those that initiate replication of Ff DNA and assembly of the Ff virion, although isolated structures of this kind are present. (nih.gov)
  • 2. The method according to claim 1, wherein the concentration of said antibiotic in the medium is in the range which causes about 1% to about 99% inhibition of the growth of said bacterial strain in the absence of said bacteriophage. (patentsencyclopedia.com)
  • From the compatible group of PGPR, we have selected one biofertilizer (Azospirillum brasilense strain TNAU) and one biocontrol agent (Pseudomonas fluorescens strain PF1) for further studies in the pot culture. (bvsalud.org)
  • We recently reported that bacteriophage present at sites of bacterial infection are internalized by mammalian cells and that they trigger anti-viral immune responses that antagonize anti-bacterial responses. (stanford.edu)
  • Four kinds of bacteriophage ( φ RSL, φ RSA, φ RSM and φ RSS) were isolated from Ralstonia solanacearum , a soil-borne Gram-negative bacterium that is the causative agent of bacterial wilt in many important crops. (microbiologyresearch.org)
  • A search for sequences related to known pseudomonad promoters suggests that the promoters in this bacteriophage may well be ntr-dependent, with the two strongest preceding the gene for the major coat protein (gene 8) and another ORF (430). (nih.gov)
  • As proof of principle, the bacteriophages Pf3, Pf1, and M13 were engineered in this way to successfully synthesize Enhanced Green Fluorescent Protein (EGFP). (vcu.edu)
  • Anodic aluminum oxide substrates with macroscopically aligned homogeneous nanopores of 80 nm in diameter enable two-dimensional, solid-state nuclear magnetic resonance studies of lipid-induced conformational changes of uniformly 15 N-labeled Pf1 coat protein in native-like bilayers. (infona.pl)
  • Although early aggressive and prolonged treatment with specific antibiotics can extend survival in patients with cystic fibrosis (CF) colonized by opportunistic Pseudomonas aeruginosa (PA), antibiotics fail to eradicate the infecting multidrug-resistant (MDR) PA strains in CF. Century-long research has suggested treating patients with bacteriophages (phages, prokaryotic viruses) naturally hosted by bacteria. (frontiersin.org)
  • The calculation is based on the measurements of Day and Wiseman [Day, L.A. and Wiseman, R.L.: A comparison of DNA packaging in the virions of fd, Xf, and Pf1. (abdesignlabs.com)
  • The use of lytic bacteriophages has been proposed as an alternative treatment for infections caused by antibiotic-resistant bacteria. (edu.au)
  • Disclosed methods include utilization of recombinant bacteriophage to deliver to pathogenic bacteria a translatable genetic sequence encoding an optically detectable marker or an enzyme capable of producing an optically detectable marker. (patentsencyclopedia.com)
  • Effects of bacteriophage fd infection on Escherichia coli HB11 envelope: a morphological and biochemical study. (semanticscholar.org)
  • Bacteriophage therapy for refractory Pseudomonas aeruginosa urinary tract infection. (semanticscholar.org)
  • Challenges and Promises for Planning Future Clinical Research Into Bacteriophage Therapy Against Pseudomonas aeruginosa in Cystic Fibrosis. (frontiersin.org)
  • Bacteriophages for the treatment of Pseudomonas aeruginosa infections. (semanticscholar.org)
  • Addition of F-actin, DNA or Pf1 bacteriophage to 0.5% agar plates increased swarming motility of Pseudomonas aeruginosa Xen5. (biomedcentral.com)
  • This thesis examines the suitability of anti-P. aeruginosa lytic bacteriophages as a treatment for P. aeruginosa infections in CRS and CF-associated CRS. (edu.au)
  • An in vitro study of the efficacy of a mixture of anti-P. aeruginosa bacteriophages (referred to as CT-PA) against a panel of 40 clinical P. aeruginosa respiratory isolates, from CRS and CF patients across 3 continents, was performed. (edu.au)
  • We have identified novel roles for bacteriophage (the 'Phageome') in the pathogenesis of wound and lung infections. (stanford.edu)
  • Sergeyev, Ivan V. & McDermott, Ann E. (2014) Studies of Water Populations in Pf1 Bacteriophage by NMR. (columbia.edu)
  • 2. The method according to claim 1, wherein the recombinant bacteriophage is held within a delivery vehicle during the step of locating the recombinant bacteriophage in the in vivo environment. (patentsencyclopedia.com)
  • 5. The method according to claim 2, further comprising degrading the delivery vehicle and releasing the recombinant bacteriophage from the delivery vehicle. (patentsencyclopedia.com)
  • 6. The method according to claim 1, wherein the recombinant bacteriophage is lysin deficient. (patentsencyclopedia.com)
  • 10. The method according to claim 9, wherein the bacteriophage carries genetic material encoding the cofactor. (patentsencyclopedia.com)
  • 14. The method according to claim 1, further comprising locating the recombinant bacteriophage in the in vivo environment in conjunction with a medical device. (patentsencyclopedia.com)