Viruses whose hosts are bacterial cells.
The transfer of bacterial DNA by phages from an infected bacterium to another bacterium. This also refers to the transfer of genes into eukaryotic cells by viruses. This naturally occurring process is routinely employed as a GENE TRANSFER TECHNIQUE.
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
A species of temperate bacteriophage in the genus P2-like viruses, family MYOVIRIDAE, which infects E. coli. It consists of linear double-stranded DNA with 19-base sticky ends.
A species of temperate bacteriophage in the genus P1-like viruses, family MYOVIRIDAE, which infects E. coli. It is the largest of the COLIPHAGES and consists of double-stranded DNA, terminally redundant, and circularly permuted.
A species of temperate bacteriophage in the genus P22-like viruses, family PODOVIRIDAE, that infects SALMONELLA species. The genome consists of double-stranded DNA, terminally redundant, and circularly permuted.
Enzymes that recombine DNA segments by a process which involves the formation of a synapse between two DNA helices, the cleavage of single strands from each DNA helix and the ligation of a DNA strand from one DNA helix to the other. The resulting DNA structure is called a Holliday junction which can be resolved by DNA REPLICATION or by HOLLIDAY JUNCTION RESOLVASES.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Strains of ESCHERICHIA COLI that are a subgroup of SHIGA-TOXIGENIC ESCHERICHIA COLI. They cause non-bloody and bloody DIARRHEA; HEMOLYTIC UREMIC SYNDROME; and hemorrhagic COLITIS. An important member of this subgroup is ESCHERICHIA COLI O157-H7.
A verocytotoxin-producing serogroup belonging to the O subfamily of Escherichia coli which has been shown to cause severe food-borne disease. A strain from this serogroup, serotype H7, which produces SHIGA TOXINS, has been linked to human disease outbreaks resulting from contamination of foods by E. coli O157 from bovine origin.
Infections with bacteria of the species ESCHERICHIA COLI.
A syndrome that is associated with microvascular diseases of the KIDNEY, such as RENAL CORTICAL NECROSIS. It is characterized by hemolytic anemia (ANEMIA, HEMOLYTIC); THROMBOCYTOPENIA; and ACUTE RENAL FAILURE.
Proteins obtained from ESCHERICHIA COLI.
A toxin produced by certain pathogenic strains of ESCHERICHIA COLI such as ESCHERICHIA COLI O157. It shares 50-60% homology with SHIGA TOXIN and SHIGA TOXIN 1.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Medicines whose effectiveness is unproven and whose ingredients are often secret.
The fraudulent misrepresentation of the diagnosis and treatment of disease.
Any tests that demonstrate the relative efficacy of different chemotherapeutic agents against specific microorganisms (i.e., bacteria, fungi, viruses).
Containers, packaging, and packaging materials for drugs and BIOLOGICAL PRODUCTS. These include those in ampule, capsule, tablet, solution or other forms. Packaging includes immediate-containers, secondary-containers, and cartons. In the United States, such packaging is controlled under the Federal Food, Drug, and Cosmetic Act which also stipulates requirements for tamper-resistance and child-resistance. Similar laws govern use elsewhere. (From Code of Federal Regulations, 21 CFR 1 Section 210, 1993) DRUG LABELING is also available.
Substances that reduce the growth or reproduction of BACTERIA.
A generic concept reflecting concern with the modification and enhancement of life attributes, e.g., physical, political, moral and social environment; the overall condition of a human life.
The presence of organisms, or any foreign material that makes a drug preparation impure.
The systematic study of the complete complement of proteins (PROTEOME) of organisms.
The systematic study of the complete DNA sequences (GENOME) of organisms.
Occupations of medical personnel who are not physicians, and are qualified by special training and, frequently, by licensure to work in supporting roles in the health care field. These occupations include, but are not limited to, medical technology, physical therapy, physician assistant, etc.
Development of a library collection, including the determination and coordination of selection policy, assessment of needs of users and potential users, collection use studies, collection evaluation, identification of collection needs, selection of materials, planning for resource sharing, collection maintenance and weeding, and budgeting.
Books used in the study of a subject that contain a systematic presentation of the principles and vocabulary of a subject.
The protein complement of an organism coded for by its genome.
A group I chaperonin protein that forms a lid-like structure which encloses the non-polar cavity of the chaperonin complex. The protein was originally studied in BACTERIA where it is commonly referred to as GroES protein.
A group I chaperonin protein that forms the barrel-like structure of the chaperonin complex. It is an oligomeric protein with a distinctive structure of fourteen subunits, arranged in two rings of seven subunits each. The protein was originally studied in BACTERIA where it is commonly referred to as GroEL protein.
A plant genus of the family ARECACEAE. It is a tropical palm tree that yields a large, edible hard-shelled fruit from which oil and fiber are also obtained.
A family of cellular proteins that mediate the correct assembly or disassembly of polypeptides and their associated ligands. Although they take part in the assembly process, molecular chaperones are not components of the final structures.
A family of multisubunit protein complexes that form into large cylindrical structures which bind to and encapsulate non-native proteins. Chaperonins utilize the energy of ATP hydrolysis to enhance the efficiency of PROTEIN FOLDING reactions and thereby help proteins reach their functional conformation. The family of chaperonins is split into GROUP I CHAPERONINS, and GROUP II CHAPERONINS, with each group having its own repertoire of protein subunits and subcellular preferences.
A class of MOLECULAR CHAPERONES whose members act in the mechanism of SIGNAL TRANSDUCTION by STEROID RECEPTORS.
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
A form of GENE LIBRARY containing the complete DNA sequences present in the genome of a given organism. It contrasts with a cDNA library which contains only sequences utilized in protein coding (lacking introns).
DNA molecules capable of autonomous replication within a host cell and into which other DNA sequences can be inserted and thus amplified. Many are derived from PLASMIDS; BACTERIOPHAGES; or VIRUSES. They are used for transporting foreign genes into recipient cells. Genetic vectors possess a functional replicator site and contain GENETIC MARKERS to facilitate their selective recognition.
A large collection of DNA fragments cloned (CLONING, MOLECULAR) from a given organism, tissue, organ, or cell type. It may contain complete genomic sequences (GENOMIC LIBRARY) or complementary DNA sequences, the latter being formed from messenger RNA and lacking intron sequences.
Hereditary disorder transmitted by an autosomal dominant gene and characterized by multiple exostoses (multiple osteochondromas) near the ends of long bones. The genetic abnormality results in a defect in the osteoclastic activity at the metaphyseal ends of the bone during the remodeling process in childhood or early adolescence. The metaphyses develop benign, bony outgrowths often capped by cartilage. A small number undergo neoplastic transformation.
Enzymes that catalyze the transfer of N-acetylglucosamine from a nucleoside diphosphate N-acetylglucosamine to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.-.
Benign hypertrophy that projects outward from the surface of bone, often containing a cartilaginous component.
Enzymes that catalyze the transfer of N-acetylhexosaminyl groups to an acceptor molecule which is frequently another carbohydrate. EC 2.4.1.
A cartilage-capped benign tumor that often appears as a stalk on the surface of bone. It is probably a developmental malformation rather than a true neoplasm and is usually found in the metaphysis of the distal femur, proximal tibia, or proximal humerus. Osteochondroma is the most common of benign bone tumors.
A heteropolysaccharide that is similar in structure to HEPARIN. It accumulates in individuals with MUCOPOLYSACCHARIDOSIS.

Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones. (1/133)

A total of 17 Pl and TAC clones each representing an assigned region of chromosome 5 were isolated from P1 and TAC genomic libraries of Arabidopsis thaliana Columbia, and their nucleotide sequences were determined. The length of the clones sequenced in this study summed up to 1,081,958 bp. As we have previously reported the sequence of 9,072,622 bp by analysis of 125 P1 and TAC clones, the total length of the sequences of chromosome 5 determined so far is now 10,154,580 bp. The sequences were subjected to similarity search against protein and EST databases and analysis with computer programs for gene modeling. As a consequence, a total of 253 potential protein-coding genes with known or predicted functions were identified. The positions of exons which do not show apparent similarity to known genes were also assigned using computer programs for exon prediction. The average density of the genes identified in this study was 1 gene per 4277 bp. Introns were observed in 74% of the potential protein genes, and the average number per gene and the average length of the introns were 4.3 and 168 bp, respectively. The sequence data and gene information are available on the World Wide Web database KAOS (Kazusa Arabidopsis data Opening Site) at http://www.kazusa.or.jp/arabi/.  (+info)

The Doc toxin and Phd antidote proteins of the bacteriophage P1 plasmid addiction system form a heterotrimeric complex. (2/133)

The toxin (Doc) and antidote (Phd) proteins of the plasmid addiction system of bacteriophage P1 were purified as a complex. Cocrystals of the complex contained a 2:1 molar ratio of Phd:Doc as assayed by dye binding following SDS-polyacrylamide gel electrophoresis and as determined by amino acid analysis. Gel filtration and analytical ultracentrifugation revealed that the two addiction proteins interact in solution to form a P2D trimer composed of one Doc and two Phd molecules. These results support a model in which Phd inhibits the toxic activity of Doc by direct binding. Circular dichroism experiments showed that changes in secondary structure accompany formation of the heterotrimeric complex, raising the possibility that Phd may act by an allosteric mechanism. Studies of Phd and Doc molecules labeled with fluorescent energy donor and acceptor groups gave an equilibrium dissociation constant of about 0.8 microM(2) and a very short, sub second half-life of complex dissociation. As a consequence, low concentrations of free Doc toxin are likely to be present both transiently and in the steady state in cells containing the Phd antidote, making mechanisms of single-hit Doc toxicity improbable.  (+info)

The CMT2D locus: refined genetic position and construction of a bacterial clone-based physical map. (3/133)

Charcot-Marie-Tooth (CMT) disease is a progressive neuropathy of the peripheral nervous system, typically characterized by muscle weakness of the distal limbs. CMT is noted for its genetic heterogeneity, with four distinct loci already identified for the axonal form of the disease (CMT2). In 1996, linkage analysis of a single large family revealed the presence of a CMT2 locus on chromosome 7p14 (designated CMT2D). Additional families have been linked subsequently to the same genomic region, including one with distal spinal muscular atrophy (dSMA) and one with mixed features of dSMA and CMT2; symptoms in both of these latter families closely resemble those seen in the original CMT2D family. There is thus a distinct possibility that CMT2 and dSMA encountered in these families reflect allelic heterogeneity at a single chromosome 7 locus. In the study reported here, we have performed more detailed linkage analysis of the original CMT2D family based on new knowledge of the physical locations of various genetic markers. The region containing the CMT2D gene, as defined by the original family, overlaps with those defined by at least two other families with CMT2 and/or dSMA symptoms. Both yeast artificial chromosome (YAC) and bacterial clone-based [bacterial artificial chromosome (BAC) and P1-derived artificial chromosome (PAC)] contig maps spanning approximately 3.4 Mb have been assembled across the combined CMT2D critical region, with the latter providing suitable clones for systematic sequencing of the interval. Preliminary analyses have already revealed at least 28 candidate genes and expressed-sequence tags (ESTs). The mapping information reported here in conjunction with the evolving sequence data should expedite the identification of the CMT2D/dSMA gene or genes.  (+info)

Finding new human minisatellite sequences in the vicinity of long CA-rich sequences. (4/133)

Microsatellites and minisatellites are two classes of tandem repeat sequences differing in their size, mutation processes, and chromosomal distribution. The boundary between the two classes is not defined. We have developed a convenient, hybridization-based human library screening procedure able to detect long CA-rich sequences. Analysis of cosmid clones derived from a chromosome 1 library show that cross-hybridizing sequences tested are imperfect CA-rich sequences, some of them showing a minisatellite organization. All but one of the 13 positive chromosome 1 clones studied are localized in chromosomal bands to which minisatellites have previously been assigned, such as the 1pter cluster. To test the applicability of the procedure to minisatellite detection on a larger scale, we then used a large-insert whole-genome PAC library. Altogether, 22 new minisatellites have been identified in positive PAC and cosmid clones and 20 of them are telomeric. Among the 42 positive PAC clones localized within the human genome by FISH and/or linkage analysis, 25 (60%) are assigned to a terminal band of the karyotype, 4 (9%) are juxtacentromeric, and 13 (31%) are interstitial. The localization of at least two of the interstitial PAC clones corresponds to previously characterized minisatellite-containing regions and/or ancestrally telomeric bands, in agreement with this minisatellite-like distribution. The data obtained are in close agreement with the parallel investigation of human genome sequence data and suggest that long human (CA)s are imperfect CA repeats belonging to the minisatellite class of sequences. This approach provides a new tool to efficiently target genomic clones originating from subtelomeric domains, from which minisatellite sequences can readily be obtained. [The sequence data described in this paper have been submitted to the EMBL data library under accession nos. AJ000377-AJ000383.]  (+info)

A 3-Mb high-resolution BAC/PAC contig of 12q22 encompassing the 830-kb consensus minimal deletion in male germ cell tumors. (5/133)

Cytogenetic and molecular genetic analyses have shown that the 12q22 region is recurrently deleted in male germ cell tumors (GCTs), suggesting that this site may harbor a tumor suppressor gene (TSG). Previous loss of heterozygosity (LOH) analyses identified a consensus minimal deleted region between the markers D12S377 and D12S296, and a YAC clone contig covering the region was generated. Here, we describe a high-resolution sequence-ready physical map of this contig covering a 3-Mb region. The map comprised of 52 cosmids, 49 PACs, and 168 BACs that were anchored to the previous YAC contig; 99 polymorphic, nonpolymorphic, EST, and gene-based markers are now placed on this map in a unique order. Of these, 61 markers were isolated in the present study, including one that was polymorphic. In addition, we have narrowed the minimal deletion to approximately 830 kb between D12S1716 (proximal) and P382A8-AG (distal) by LOH analysis of 108 normal-tumor DNAs from GCT patients using 21 polymorphic STSs. These physical and deletion maps should prove useful for identification of the candidate TSG in GCTs, provide framework to generate complete DNA sequence, and ultimately generate a gene map of this segment of the chromosome 12. [The sequence data described in this paper have been submitted to the Genome Survey Sequence under accession nos. AQ254896-AQ254955 and AQ269251-AQ269266. Online supplementary material is available at http://www.genome.org]  (+info)

P1 ParB domain structure includes two independent multimerization domains. (6/133)

ParB is one of two P1-encoded proteins that are required for active partition of the P1 prophage in Escherichia coli. To probe the native domain structure of ParB, we performed limited proteolytic digestions of full-length ParB, as well as of several N-terminal and C-terminal deletion fragments of ParB. The C-terminal 140 amino acids of ParB form a very trypsin-resistant domain. In contrast, the N terminus is more susceptible to proteolysis, suggesting that it forms a less stably folded domain or domains. Because native ParB is a dimer in solution, we analyzed the ability of ParB fragments to dimerize, using both the yeast two-hybrid system and in vitro chemical cross-linking of purified proteins. These studies revealed that the C-terminal 59 amino acids of ParB, a region within the protease-resistant domain, are sufficient for dimerization. Cross-linking and yeast two-hybrid experiments also revealed the presence of a second self-association domain within the N-terminal half of ParB. The cross-linking data also suggest that the C terminus is inhibitory to multimerization through the N-terminal domain in vitro. We propose that the two multimerization domains play distinct roles in partition complex formation.  (+info)

Identification and characterization of the single-stranded DNA-binding protein of bacteriophage P1. (7/133)

The genome of bacteriophage P1 harbors a gene coding for a 162-amino-acid protein which shows 66% amino acid sequence identity to the Escherichia coli single-stranded DNA-binding protein (SSB). The expression of the P1 gene is tightly regulated by P1 immunity proteins. It is completely repressed during lysogenic growth and only weakly expressed during lytic growth, as assayed by an ssb-P1/lacZ fusion construct. When cloned on an intermediate-copy-number plasmid, the P1 gene is able to suppress the temperature-sensitive defect of an E. coli ssb mutant, indicating that the two proteins are functionally interchangeable. Many bacteriophages and conjugative plasmids do not rely on the SSB protein provided by their host organism but code for their own SSB proteins. However, the close relationship between SSB-P1 and the SSB protein of the P1 host, E. coli, raises questions about the functional significance of the phage protein.  (+info)

The bacteriophage P1 HumD protein is a functional homolog of the prokaryotic UmuD'-like proteins and facilitates SOS mutagenesis in Escherichia coli. (8/133)

The Escherichia coli umuD and umuC genes comprise an operon and encode proteins that are involved in the mutagenic bypass of normally replication-inhibiting DNA lesions. UmuD is, however, unable to function in this process until it undergoes a RecA-mediated cleavage reaction to generate UmuD'. Many homologs of umuDC have now been identified. Most are located on bacterial chromosomes or on broad-host-range R plasmids. One such putative homolog, humD (homolog of umuD) is, however, found on the bacteriophage P1 genome. Interestingly, humD differs from other umuD homologs in that it encodes a protein similar in size to the posttranslationally generated UmuD' protein and not UmuD, nor is it in an operon with a cognate umuC partner. To determine if HumD is, in fact, a bona fide homolog of the prokaryotic UmuD'-like mutagenesis proteins, we have analyzed the ability of HumD to complement UmuD' functions in vivo as well as examined HumD's physical properties in vitro. When expressed from a high-copy-number plasmid, HumD restored cellular mutagenesis and increased UV survival to normally nonmutable recA430 lexA(Def) and UV-sensitive DeltaumuDC recA718 lexA(Def) strains, respectively. Complementing activity was reduced when HumD was expressed from a low-copy-number plasmid, but this observation is explained by immunoanalysis which indicates that HumD is normally poorly expressed in vivo. In vitro analysis revealed that like UmuD', HumD forms a stable dimer in solution and is able to interact with E. coli UmuC and RecA nucleoprotein filaments. We conclude, therefore, that bacteriophage P1 HumD is a functional homolog of the UmuD'-like proteins, and we speculate as to the reasons why P1 might require the activity of such a protein in vivo.  (+info)

Biotechnical production processes often operate with plasmid-based expression systems in well-established prokaryotic and eukaryotic hosts such as Escherichia coli or Saccharomyces cerevisiae, respectively. Genetically engineered organisms produce important chemicals, biopolymers, biofuels and high-value proteins like insulin. In those bioprocesses plasmids in recombinant hosts have an essential impact on productivity. Plasmid-free cells lead to losses in the entire product recovery and decrease the profitability of the whole process. Use of antibiotics in industrial fermentations is not an applicable option to maintain plasmid stability. Especially in pharmaceutical or GMP-based fermentation processes, deployed antibiotics must be inactivated and removed. Several plasmid addiction systems (PAS) were described in the literature. However, not every system has reached a full applicable state. This review compares most known addiction systems and is focusing on biotechnical applications.. ...
Many canonical processes in molecular biology rely on the dynamic assembly of higher-order nucleoprotein complexes. In bacteria, the assembly mechanism of ParABS, the nucleoprotein super-complex that actively segregates the bacterial chromosome and many plasmids, remains elusive. We combined super-resolution microscopy, quantitative genome-wide surveys, biochemistry, and mathematical modeling to investigate the assembly of ParB at the centromere-like sequences parS. We found that nearly all ParB molecules are actively confined around parS by a network of synergistic protein-protein and protein-DNA interactions. Interrogation of the empirically determined, high-resolution ParB genomic distribution with modeling suggests that instead of binding only to specific sequences and subsequently spreading, ParB binds stochastically around parS over long distances. We propose a new model for the formation of the ParABS partition complex based on nucleation and caging: ParB forms a dynamic lattice with the DNA
Hi All, Does anyone know if your undergraduate transcript from a Canadian U is accepted at par when you apply to US grad schools or do you need to get it evaluated through one of those services?
The Canadian Dollar and the US Dollar are at par, once again! The last time this happened was back in September 2007, and the time before that was in November 1976. Great… Im Canadian! So now what can I do? Well, if you dont live far from the U.S. border, now might be a good… [Read More]. ...
A plasmid partition system is a mechanism that assures the stable transmission of plasmids during bacterial cell division. Each plasmid has its independent replication system which controls the number of copies of the plasmid in a cell. The higher the copy number is, the more likely the two daughter cells will contain the plasmid. Generally, each molecule of plasmid diffuses randomly, so the probability of having a plasmid-less daughter cell is 21−N, where N is the number of copies. For instance, if there are 2 copies of a plasmid in a cell, there is a 50% chance of having one plasmid-less daughter cell. However, high-copy number plasmids have a cost for the hosting cell. This metabolic burden is lower for low-copy plasmids, but those have a higher probability of plasmid loss after a few generations. To control vertical transmission of plasmids, in addition to controlled-replication systems, bacterial plasmids use different maintenance strategies, such as multimer resolution systems, ...
Read more about Indian IT BPM now at par with customers after tech shift: Roy on Business Standard. Emergence of new technology has brought Indian business process management (BPM) at par with their customers during business discussions, IT industry body Nasscom Chairman Raman Roy said today. Earlier as we sat on table with our customers we were
The segregational stability of bacterial, low-copy-number plasmids is promoted primarily by active partition. The plasmid-specified components of the prototypical P1 plasmid partition system consist of two proteins, ParA (44.3 kDa) and ParB (38.5 kDa), which, in conjunction with integration host fac …
CiteSeerX - Scientific documents that cite the following paper: Bacteriophage P1 cloning system for the isolation, amplification and recovery of DNA fragments as large as 100 kilobases pairs
The bacterial genome is organized in a structure called the nucleoid by a variety of associated proteins. These proteins can form complexes on DNA that play a central role in various biological processes, including chromosome segregation. A prominent example is the large ParB-DNA complex, which forms an essential component of the segregation machinery in many bacteria. ChIP-Seq experiments show that ParB proteins localize around centromere-like parS sites on the DNA to which ParB binds specifically, and spreads from there over large sections of the chromosome. Recent theoretical and experimental studies suggest that DNA-bound ParB proteins can interact with each other to condense into a coherent 3D complex on the DNA. However, the structural organization of this protein-DNA complex remains unclear, and a predictive quantitative theory for the distribution of ParB proteins on DNA is lacking. Here, we propose the Looping and Clustering (LC) model, which employs a statistical physics approach to describe
At the bottom of the GeneCards homepage are gene statistics. The first column contains the total number of genes and the total number of HGNC approved genes. The numbers link to graphs showing the gene distributions. The first column also has links to both the most popular GeneCards genes (hot genes and disease genes) The second and third columns list the number of genes in each category, with links to the statistics page which includes both gene distribution graphs and tools to search for genes within a particular category. The rightmost column contains links to sample genes for each category. The bottom of each page has links to the GeneCards gene index, which lists all of the GeneCards genes. ...
The Future of Work - Trends at Work and Workplace study highlights employer sentiments on the trends that will impact the future of work, enabled by disruptive technologies. The study purports to identify the leading elements impacting the workforce, and its immediate ramifications for organisations.
Thank you for your interest in spreading the word about Biochemical Journal.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
A free platform for explaining your research in plain language, and managing how you communicate around it - so you can understand how best to increase its impact.
36bp LoxP site: the LoxP site is the naturally-occurring substrate for the Cre recombinase. In nature (and in previous biobricks) it is a palindromic sequence 34 base pairs long. Because this is not a multiple of three, when used inside a transcribed ORF the 34bp LoxP site can throw off the frame of the translated parts. To get around this, previous teams had to either add or take away bases from surrounding parts to keep their systems in frame (painstakingly and sometimes unsuccessfully). To get around this restriction, we designed and Biobricked a 36bp LoxP site that Registry users can include in transcribed regions without worrying about keeping everything in frame ...
36bp LoxP site: the LoxP site is the naturally-occurring substrate for the Cre recombinase. In nature (and in previous biobricks) it is a palindromic sequence 34 base pairs long. Because this is not a multiple of three, when used inside a transcribed ORF the 34bp LoxP site can throw off the frame of the translated parts. To get around this, previous teams had to either add or take away bases from surrounding parts to keep their systems in frame (painstakingly and sometimes unsuccessfully). To get around this restriction, we designed and Biobricked a 36bp LoxP site that Registry users can include in transcribed regions without worrying about keeping everything in frame ...
Tornadoes, the ultimate manufacturer, begins at par. 8. This hub uses limits to define e, and it explains why 1 raised to an infinite power may not be anywhere near one when limits are involved.
The country has come a long way in the development of its infrastructure, which is now almost at par with many developed countries. The installation, operation and maintenance of these facilities do not come free of charge. They come at a cost. This cost has to be paid either by the Government or the private sector. Truly the Government does not have the funds to build all the infrastructure for the people from taxes collected. If we wait until the Government has the funds, then it would take a long time for the infrastructure to the built. Because of this the private sector will have to invest. They will not invest unless they get a reasonable return. Users must therefore be prepared to pay a reasonable fee for the services rendered. Nevertheless the Government will support to the extent that it can. In fact the payment by Malaysian consumers is very much lower than is paid by consumers in other countries. For the good of everyone consumers must accept the concept of user pays. It is grossly ...
The purpose of Symbiosis is to deliver full spectrum Therapy services within a fun and therapeutic environment by creating an atmosphere of warmth, caring and assurance for the children as well as the parents. Our mission is to provide excellent therapy services to children with special needs. We strive to enhance the lives of children, so they can play and learn at par with their peers ...
Predlagan je bil drug aktiven mehanizem (mehanizem sistema parABS), ki je podoben mehanizmu delitvenega vretena pri mitozi. Sistem parABS sodeluje pri razporejanju celih kromosomov kot tudi plazmidov po citoplazmi pred celično delitvijo. Sistem je zgrajen iz proteina ParA z ATP-aznim delovanjem, iz DNA vezavnega proteinskega dimera ParB in parS zaporedja. Kromosom ima več takih zaporedij (lahko tudi 22). ParA in parB gena se nahajata na istem operonu, za katerim takoj leži zaporedje parS. ParB protein se veže na parS zaporedje in DNA v okolici parS. ParB-DNA kompleks se veže na ATP-vezan ParA protein, pri čemer vzpodbudi ATP-azno aktivnost ParA proteina. Od ATP-ja se odcepi fosfatni ion, ADP-ParA pa se tudi odcepi od ParB-DNA kompleksa, ki se veže na naslednji ATP-vezan ParA protein. Ta interakcija pripomore k usmerjanju oriC regij kromosoma in njegovemu premikanju proti celičnima poloma. Pri podrobnejši razlagi mehanizma in nahajanju ATP-ParA proteina v celici so si maloštevilni ...
Specificity of the Mnt protein determined by binding to randomized operators.: The relative binding affinities of Mnt protein from bacteriophage P22 are determi
It appears that your web browser doesnt support JavaScript or JavaScript is disabled. You must enable JavaScript or upgrade to a newer web browser to shop at our online store. If you continue to have trouble, please contact customer service to place an order for you ...
Gene disruption by targeted integration of transfected constructs becomes increasingly popular for studies of gene function. The chicken B cell line DT40 has been widely used as a model for gene knock-outs due to its high targeted integration activity. Disruption of multiple genes and complementation of the phenotypes is, however, restricted by the number of available selectable marker genes. It is therefore highly desirable to recycle the selectable markers using a site-specific recombination system like Cre/loxP. We constructed three plasmid vectors (neoR, puroR and bsr), which carry selectable marker genes flanked by two different mutant loxP sites. After stable transfection, the marker genes can be excised from the genome by transient induction of Cre recombinase expression. This excision converts the two mutant loxP sites to an inactive double-mutant loxP. Furthermore we constructed a versatile expression vector to clone cDNA expression cassettes between mutant loxP sites. This vector can also be
Cre-Lox recombination is a special type of site-specific recombination. The Cre protein is a site-specific DNA recombinase. It can catalyze the recombination of DNA between specific sites in a DNA molecule. These sites, known as loxP sequences, contain specific binding sites for Cre that surround a directional core sequence where recombination can occur. It is often used in the generation of knockout and conditional knockout animals. - Cre-Lox Recombination - AbVideo™ - Support - Abnova
MICER is a method developed by Allan Bradley. It consists of four sets of genomic clones that contain a loxP site in either orientation site and either the proximal or the distal half of a HPRT mini gene. After Cre mediated recombination between the loxP sites of two different MICER clones a complete HPRT mini gene is reconstituted and one can select for the Cre induced alteration of the genome. If the two loxP sites are located within the same chromosome and have the same orientation one will end up with a deletion of the sequences located between the loxP sites. If the loxP sites are inversely orientated Cre mediated recombination will induce an inversion of the sequences between the two loxP sites (it should be noticed though, that without selection prolonged presence of Cre can lead to a reversion of the fragment). If the loxP sites are situated on different chromosomes Cre mediated recombination will lead to reciprocal translocation between the two chromosomes, which is indeed the situation ...
Uppsala University, Teknisk-naturvetenskapliga vetenskapsområdet, Faculty of Science and Technology, Biology, Department of Cell and Molecular Biology. Uppsala University, Teknisk-naturvetenskapliga vetenskapsområdet, Faculty of Science and Technology, Biology, Department of Cell and Molecular Biology, Microbiology. mikrobiologi. ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
FRT flanked, Pro and Euk. Neomycin Selection Cassette plus loxP site(FRT-PGK-gb2-neo-FRT-loxP) from Gene Bridges GmbH,The with a eukaryotic promoter (PGK) for expression of n,biological,biology supply,biology supplies,biology product
I absolutely believe that the digital product out of India is at par with the best in the world and in many cases, even better. We are an incubator of digital talent.
you didnt get the gist. its a commonplace today that the average young lady (not the useless feminists/lesbians) prioritizes education and white collar job in a bid be at par or even surpass the average man........but the irony is, when she eventually attains the age of marriage she settles with a man old enough to be her father or a guy in the fine-boy-no-money class. its no only war that reduces the number of men but the growing number of women competing with men in work environment ...
Svartrygget sjakal regnes som døgnaktiv, men den er gjerne mest aktiv i grålysningen og skumringen. I områder der de gjerne forfølges av mennesker blir de gjerne nattaktive. Det har også blitt registrert at denne sjakalen er mest aktiv i den intermediære månefasen natterstid, mens de blir mindre aktive når det er fullmåne eller nymåne (Ferguson m.fl.[11], 1988). Svartryggsjakalen er kjent for å være svært vokale og har et stort forråd av lyder. Svartryggsjakaler er monogame og danner parforhold som normalt varer livet ut. De er svært territoriale og forsvarer reviret aggressivt mot inntrengere. Territoriene varierer i størrelse etter tilgangen på mat. I sør er gjennomsnittet cirka 18,2 km², mens det i Kalahari er cirka 4,3 km². Sjakalene danner små grupper, som består av foreldre og deres nærmeste avkom. Eldre søsken fungerer som «hjelpere» og bidrar til oppdragelsen og pass av valper. Studier har vist at par som ikke har slike hjelpere i større grad taper valpene til ...
Priced a private offering to eligible purchases of 7.750% senior unsecured notes due 2029 at par. Proceeds will be used for general corporate purposes, including repaying the borrowings outstanding under its senior secured credit facility.
We also use the Cre-loxP system, in which a gene of interest is engineered to contain loxP sites flanking a critical region of the gene. A mouse containing the floxed gene is normal, because the loxP sites are silent. Upon expression of the Cre recombinase, which removes DNA sequences flanked by loxP sites, that gene is inactivated. We use three methods for inducing Cre in a region-specific manner in brain. In one, we breed mice containing a floxed gene to mice in which Cre is inducibly expressed under the tetracycline system described above. In the second, we breed them to mice that express modified forms of Cre, which can be activated upon local injection of a chemical in brain. In the third, we use viral vectors encoding Cre to create localized knockouts of the floxed gene. Together, these various approaches enable us to exert powerful control over a drug- or stress-regulated protein ...
道客巴巴(doc88.com)是一个在线文档分享平台。你可以上传论文,研究报告,行业标准,设计方案,电子书等电子文档,可以自由交换文档,还可以分享最新的行业资讯。
道客巴巴(doc88.com)是一个在线文档分享平台。你可以上传论文,研究报告,行业标准,设计方案,电子书等电子文档,可以自由交换文档,还可以分享最新的行业资讯。
道客巴巴(doc88.com)是一个在线文档分享平台。你可以上传论文,研究报告,行业标准,设计方案,电子书等电子文档,可以自由交换文档,还可以分享最新的行业资讯。
Amino Acid Sequence, Bacteriophage P2/genetics/*metabolism, DNA/metabolism, DNA-Binding Proteins/genetics/isolation & purification/*metabolism, Molecular Sequence Data, Mutagenesis, Oligopeptides/genetics/isolation & purification/*metabolism, Research Support; Non-U.S. Govt, Trans-Activation (Genetics), Viral Proteins/genetics/isolation & purification/*metabolism ...
We have mapped determinants for species‐specific interactions of Par components (Figure 6). Operon repression involves a specific interaction between ParA and the operator DNA. The specific determinant includes a HTH motif in the N‐terminal region of ParA and probably contacts the operator directly. Direct binding of ParA to the operator sequence has been shown previously (Davis et al., 1992).. Specific enhancement of repression by ParB was shown to be due to a protein-protein interaction with ParA rather than direct recognition of the operator by ParB. This is consistent with the observation that ParB does not appear to bind to the operator by itself, and does not cause any qualitative modification of the footprint of ParA bound to operator DNA (Davis et al., 1992). The ParA-ParB interaction involves determinants in the C‐terminal region of ParA and the N‐terminal end of ParB (Figure 6). ParA and ParB interact directly in vitro (Davis et al., 1992). Thus it is likely that the mapped ...
It is well known that genomic materials (long DNA chains) of living organisms are often packed compactly under extreme confining conditions using macromolecular self-assembly processes but the general DNA packing mechanism remains an unsolved problem. It has been proposed that the topology of the packed DNA may be used to study the DNA packing mechanism. For example, in the case of (mutant) bacteriophage P4, DNA molecules packed inside the bacteriophage head are considered to be circular since the two sticky ends of the DNA are close to each other. The DNAs extracted from the capsid without separating the two ends can thus preserve the topology of the (circular) DNAs. It turns out that the circular DNAs extracted from bacteriophage P4 are non-trivially knotted with very high probability and with a bias toward chiral knots. In order to study this problem using a systematic approach based on mathematical modeling, one needs to introduce a DNA packing model under extreme volume confinement ...
Eligibility: Passed Intermediate/ 10+2/ equivalent examination in any stream/subjects approved by Central/State Education Boards, with minimum of 50% marks in aggregate and 50% marks in English. Passed two year Vocational Course affiliated/recognised by CBSE / State Education Boards/Councils duly recognised at par with 10+2 by AIU with minimum 50% marks in aggregate and 50% marks in English in Vocational Course or in Intermediate / Matriculation, if English is not a subject in Vocational Course. ...
Every time I pass a relatively green patch here in Ahmedabad, I can immediately feel the coolness on my skin and the freshness of the air I breathe in. Guess, everyone must be experiencing the same thing. If not better, the impact is at par when compared to that of ACs ...
The NucleoBond BAC 100 Kit is designed to purify large DNA fragments such as cosmids, bacteriophage P1 clones, PACs, and BACs, without phenol/chloroform extraction. 1 hour protocol accomodates vectors up to to 300 kb.
5crx_A mol:protein length:343 PROTEIN (BACTERIOPHAGE P1 CRE GENE) MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLN NRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMR RIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTLLRIAEI ARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNN YLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGA ARDMARAGVSIPEIMQAGGWTNVNIVMNFIRNLDSETGAMVRLLEDGD ...
Doc. V. Ščemeliovas - Vilniaus universiteto Hidrologijos ir klimatologijos katedros ilgametis darbuotojas, žymus Lietuvos klimatologas ir mokslo apie orus populiarintas.. Didelį ačiū jums taria mokiniai, linki tvirtos sveikatos ir dar ne vieno atradimo tiriant tėviškės orus.. Sveikinimą galite perskaityti čia.. ...
① 주어와 동사, 목적어 및 보어군에 핵심 메시지를 표현하라. ② 명사의 과도한 연결을 피하라. ③ 짧은 문장을 사용하라. ④ 명확한 대명사를 사용하라. ⑤ 대비되는 개념은 대비되는 형태로 배열하라. 우리는..
The Developmental Cognitive Neuroscience Unit at the UCL Institute of Child Health has embarked on a major programme to help children with memory problems resulting from brain damage.
Generalized transduction is commonly used to move transposon-induced mutations among bacterial strains by selecting for inheritance of a transposonencoded resistance determinant. Although complete cotransduction of the resistance determinant and the chromosomal mutation might be expected, it is often found that when Tn5(Kan) insertion mutations are transduced by bacteriophage P1 most of the nonmutant kanamycin-resistant transductants are due to specialized transduction of Tn5. Such P1::Tn5 specialized transducing phage are not found when a mutant Tn5 element lacking a functional transposase is employed.. ...
Amino Acid Sequence, Animals, Bacteriophage P2/*genetics/physiology/ultrastructure, Base Sequence, Capsid/genetics/ultrastructure, Cloning; Molecular, DNA Primers/chemistry, DNA; Viral/analysis, Electrophoresis; Polyacrylamide Gel, Gene Expression Regulation; Viral, Genes; Viral/*genetics, Genome; Viral, Molecular Sequence Data, Mutation, Rabbits, Recombinant Proteins, Research Support; Non-U.S. Govt, Research Support; U.S. Govt; P.H.S., Transcription; Genetic, Viral Proteins/genetics/metabolism, Viral Structural Proteins/*genetics, Virus Assembly/*physiology ...
Addresses: Mosig G, VANDERBILT UNIV, DEPT MOL BIOL, NASHVILLE, TN 37235. UNIV CALIF BERKELEY, DEPT MOL & CELL BIOL, BERKELEY, CA 94720. UNIV STOCKHOLM, DEPT GENET, S-10691 STOCKHOLM, SWEDEN. UNIV UPPSALA, DEPT MICROBIOL, S-75105 UPPSALA, SWEDEN.Available from: 2008-10-17 Created: 2008-10-17 Last updated: 2011-01-15 ...
Legal tender status guaranteed that creditors would have to accept the notes despite the fact that they were not backed by gold, bank deposits, or government reserves, and had no interest. However, the First Legal Tender Act did not make the notes an unlimited legal tender as they could not be used by merchants to pay customs duties on imports and could not be used by the government to pay interest on its bonds. The Act did provide that the notes be receivable by the government for short term deposits at 5% interest, and for the purchase of 6% interest 20-year bonds at par. The rationale for these terms was that the Union government would preserve its credit-worthiness by supporting the value of its bonds by paying their interest in gold. Early in the war, customs duties were a large part of government tax revenue and by making these payable in gold, the government would generate the coin necessary to make the interest payments on the bonds. Lastly, by making the bonds available for purchase at ...
CDH an ISO 9001: 2008 and cGMP certified company has been serving the scientific community with the largest range of Laboratory Fine Chemicals & Dehydrated Culture Media since 1981. CDH is presently manufacturing and marketing over 9000 products. CDH is recognised as a benchmark for wide range of products of high purity. We are having the best combination of Bio chemicals, Research Chemicals, Rare Earth Metals, Laboratory Reagents, HPLC/AAS/EL/DRY Solvents, Stains & Indicators and Dehydrated Culture Media. Our Dehydrated Culture Media products are manufactured and marketed under the brand name as Microgen awarded with CE certification to prove its quality at par with International Standards.. ...
crispgg: I expect ANAN to take advantage of this situation. All those with ACCA need is the ability to set up there own firms in Nigeria. With ANAN membership, they can do that. Imagine the credibility that they will gain when they have a huge number of ACCA members joining them. In a few years, they will be at par with ICAN ...
Discover Médoc wines the wine-lovers way. Explore its unique characteristics through reviews, discussions, and one of the largest inventories of wine from Médoc.
We offer expert advice and tips on how to stop smoking for good at 121doc. To find out more and for information on treatments available online visit 121doc.
"Bacteriophage P1". In The Bacteriophages, Vol. 1, ed. Richard Calendar, pp. 291-438 (Plenum; 1988) Research papers Nat ... "Bacteriophage P1 Cloning System for the Isolation, Amplification, and Recovery of DNA Fragments as Large as 100 Kilobase Pairs ... "Bacteriophage P1 site-specific recombination. I. Recombination between loxP sites", Journal of Molecular Biology, 150 (4): 467- ... where he started to study the phage P1. From 1981 he directed his own group, continuing to research the P1 phage, as well as ...
P1' had a unique site specific recombination system. EcoRI fragments of the P1 bacteriophage genome were generated and cloned ... Cre recombinase plays important roles in the life cycle of the P1 bacteriophage. Upon infection of a cell the Cre-loxP system ... The enzyme plays important roles in the life cycle of the P1 bacteriophage, such as cyclization of the linear genome and ... Cre recombinase is a tyrosine recombinase enzyme derived from the P1 bacteriophage. The enzyme uses a topoisomerase I-like ...
"Three functions of bacteriophage P1 involved in cell lysis". Journal of Bacteriology. 178 (4): 1099-1104. doi:10.1128/jb.178.4. ...
Bacteriophage P1 vectors can hold inserts 70 - 100kb in size. They begin as linear DNA molecules packaged into bacteriophage P1 ... P1 artificial chromosomes (PACs) have features of both P1 vectors and Bacterial Artificial Chromosomes (BACs). Similar to P1 ... Unlike P1 vectors, they do not need to be packaged into bacteriophage particles for transduction. Instead they are introduced ... P1 vectors also contain a P1 plasmid replicon, which ensures only one copy of the vector is present in a cell. However, there ...
Lennox, E. S. (1955). "Transduction of linked genetic characters of the host by bacteriophage P1". Virology. 1 (2): 190-206. ... In this article he described the modified single-burst experiment and the isolation of the phages P1, P2, and P3. He had ... P1, P2, and other experimental systems". Journal of Bacteriology. 186 (3): 595-600. doi:10.1128/JB.186.3.595-600.2004. PMC ...
"Visualization of bacteriophage P1 infection by cryo-electron tomography of tiny Escherichia coli". Virology. 417 (2): 304-311. ...
"Site-Specific DNA Recombination in Mammalian Cells by the Cre Recombinase of Bacteriophage P1". Proceedings of the National ... The founding member of the YR family is the lambda integrase, encoded by bacteriophage λ, enabling the integration of phage DNA ... The enzyme recognizes 34 base pair DNA sequences called loxP ("locus of crossover in phage P1"). Depending on the orientation ... This dream became reality when groups in the USA were able to introduce bacteriophage and yeast-derived site-specific ...
Citron M, Schuster H (August 1990). "The c4 repressors of bacteriophages P1 and P7 are antisense RNAs". Cell. 62 (3): 591-598. ... It was initially identified in the P1 and P7 phages of E. coli. The identification of c4 antisense RNAs solved the mystery of ... The presence of c4 antisense RNAs in bacteria is to be expected, since the P1 and P7 phages are temperate and can stably ...
A similar cloning vector called a PAC has also been produced from the DNA of P1 bacteriophage. BACs are often used to sequence ...
P1 is a major capsid protein which is responsible of forming the skeleton of the polymerase complex. In the interior of the ... Φ6 and its relatives have a lipid membrane around their nucleocapsid, a rare trait among bacteriophages. It is a lytic phage, ... Φ6 (Phi 6) is the best-studied bacteriophage of the virus family Cystoviridae. It infects Pseudomonas bacteria (typically plant ... its structure has been studied by scientists interested in lipid-containing bacteriophages, and it has been used as a model ...
Some proteins known to contain a KilA-N domain are listed below: Bacteriophage P1 protein kilA Fowlpox virus (FPV) protein ...
To determine the anti-viral capacity of beeswax wrap bacteriophages M13 and P1 were incubated in a liquid phase with the ...
... p1 bacteriophage MeSH A11.284.187.178.200 - chromosomes, artificial, yeast MeSH A11.284.187.190 - chromosomes, bacterial MeSH ...
... bacteriophage p1 MeSH B04.123.205.305 - bacteriophage p2 MeSH B04.123.205.320 - bacteriophage phi x 174 MeSH B04.123.205.350 - ... bacteriophage mu MeSH B04.280.090.500.300 - bacteriophage p1 MeSH B04.280.090.500.305 - bacteriophage p2 MeSH B04.280.090.500. ... bacteriophage p1 MeSH B04.123.150.500.305 - bacteriophage p2 MeSH B04.123.150.500.350 - bacteriophage t4 MeSH B04.123.150.700 ... bacteriophage t4 MeSH B04.123.205.891.230 - bacteriophage t7 MeSH B04.123.230.070 - bacteriophage phi 6 MeSH B04.123.370.400 - ...
"Bacteriophage P1", in Richard Calendar (ed.), The Bacteriophages, Oxford University Press, p. 350, ISBN 0195148509 Viralzone: ... "DNA Inversion Regions Min of Plasmid p15B and Cin of Bacteriophage P1: Evolution of Bacteriophage Tail Fiber Genes". Journal of ... The genome of P1 encodes 112 proteins and 5 untranslated genes and is this about twice the size of bacteriophage lambda. The ... P1 is a temperate bacteriophage that infects Escherichia coli and some other bacteria. When undergoing a lysogenic cycle the ...
A P1-derived artificial chromosome is a DNA construct that was derived from the DNA of P1 bacteriophage. It can carry large ... Online Medical Dictionary P1-derived artificial chromosome P1-derived artificial chromosome (PAC) definition v t e v t e c. ... Sternberg N (January 1990). "Bacteriophage P1 cloning system for the isolation, amplification, and recovery of DNA fragments as ... P1 was developed as a cloning vector by Nat Sternberg and colleagues in the 1990s. It is capable of Cre-Lox recombination. ...
Actinomyces virus Av1 Mycoplasma virus P1 Two bacteriophages in this family have been found to infect and lyse Clostridium ... Kleppen HP, Holo H, Jeon SR, Nes IF, Yoon SS (2012). "Novel Podoviridae family bacteriophage infecting Weissella cibaria ... "Molecular characterization of podoviral bacteriophages virulent for Clostridium perfringens and their comparison with members ...
N4 phage P1 phage P2 phage P4 phage R17 phage T2 phage T4 phage (169 kbp genome, 200 nm long) T7 phage T12 phage Viruses portal ... coli bacteria Phage.org general information on bacteriophages bacteriophages illustrations and genomics Bacteriophages get a ... The largest bacteriophage genomes reach a size of 735 kb. Bacteriophage genomes can be highly mosaic, i.e. the genome of many ... Bacteriophages are among the most common and diverse entities in the biosphere. Bacteriophages are ubiquitous viruses, found ...
The high level of similarities in the tail fiber genes of phage P2, P1, Mu, λ, K3 and T2, which belong to different families, ... The P2-like bacteriophages. In R. Calendar (ed.), The bacteriophages. Oxford Press, Oxford, 2005: p. 365-390 Lindahl, G., ... Bacteriophage P2 was first isolated by G. Bertani from the Lisbonne and Carrère strain of E. coli in 1951. Since that time, a ... Bacteriophage P2, scientific name Escherichia virus P2, is a temperate phage that infects E. coli. It is a tailed virus with a ...
The p1 protein of Ff phage (i. e. genus Inovirus), which is required for phage assembly at the membrane, has a membrane- ... species Escherichia virus M13 M13 bacteriophage f1 phage species Filamentous bacteriophage fd (proposal) fd phage genus ... inactivated infectivity as predicted for a filamentous bacteriophage morphology. Three filamentous bacteriophages, fd, f1 and ... Filamentous bacteriophage is a family of viruses (Inoviridae) that infect bacteria. The phages are named for their filamentous ...
Eqolosins prefer bulky amino acid residues at the P1 site and small amino acid residues at the P1′ site. A characteristic of ... A convergently evolved glutamic peptidase, the pre-neck appendage protein (bacteriophage phi-29), uses a Glu and Asp dyad at ...
The bacteriophages used for cloning are the λ phage and M13 phage. There is an upper limit on the amount of DNA that can be ... BACs are based on F plasmid, another artificial chromosome called the PAC is based on the P1 phage. Yeast artificial chromosome ... Some plasmids contain an M13 bacteriophage origin of replication and may be used to generate single-stranded DNA. These are ... Cosmids are plasmids that incorporate a segment of bacteriophage λ DNA that has the cohesive end site (cos) which contains ...
During an infection, bacteriophages hijack transcription and translation, which could prevent antitoxin replenishment and ... "Escherichia coli mazEF-mediated cell death as a defense mechanism that inhibits the spread of phage P1". Molecular Genetics and ... Dy RL, Przybilski R, Semeijn K, Salmond GP, Fineran PC (April 2014). "A widespread bacteriophage abortive infection system ... Type III toxin-antitoxin (AbiQ) systems have been shown to protect bacteria from bacteriophages altruistically. ...
Bacteriophages are among the most common and diverse entities in the biosphere.[1] Bacteriophages are ubiquitous viruses, found ... A bacteriophage (/bækˈtɪərioʊfeɪdʒ/), also known informally as a phage (/feɪdʒ/), is a virus that infects and replicates within ... 2×108 bacteriophages per mL.[47] Bacteriophages are thought to extensively contribute to horizontal gene transfer in natural ... Main article: Marine bacteriophage. Metagenomics has allowed the in-water detection of bacteriophages that was not possible ...
... a variant of the 1923 P-1 Hawk biplane fighter of the United States Army Air Corps P-2 Neptune, known as "P2V Neptune" until ... a 2007 flash memory based Yepp portable media player P2 audio connector Bacteriophage P2, a temperate phage of the family ...
The bacteriophage λ-red operon consists of the exo, bet, and gam genes which, together, are responsible for recombineering. ... recombineering and P1 transduction in Escherichia coli". Nucleic Acids Research. 41 (22): e204. doi:10.1093/nar/gkt1075. ISSN ... In this system, the red operon from bacteriophage λ is transfected into E. coli cells to facilitate incorporation of linear ... In this system, sequences matching foreign bacteriophage or plasmid DNA are incorporated as "spacer" sequences into the ...
Bacteriophage T12 infection of S. pyogenes enables the production of speA, and increases virulence. SpeB was identified in 1919 ... It requires three amino acids before the cleavage site, known as P1, P2 and P3. Of these, SpeB has a preference for hydrophobic ... In contrast, speA, speC and speH-M are encoded by bacteriophages. There is a lack of consensus over the location of the speG ... Bacteriophages, Part A. 82. pp. 91-118. doi:10.1016/b978-0-12-394621-8.00014-5. ISBN 9780123946218. PMID 22420852. Media ...
As proteins homologous to Beta and RecT are found in many bacteria and bacteriophages (>100 as of February 2010), ... recombineering and P1 transduction in Escherichia coli". Nucleic Acids Research. 41 (22): e204. doi:10.1093/nar/gkt1075. PMC ... Murphy K. C. (1998). "Use of bacteriophage λ recombination functions to promote gene replacement in Escherichia coli". Journal ... Recombineering is based on homologous recombination in Escherichia coli mediated by bacteriophage proteins, either RecE/RecT ...
E2F (1, 2, 3, 4, 5) • FOX proteini (C1, C2, D3, E1, G1, H1, K2, L2, M1, N3, O1, O3, O4, P1, P2, P3) ... Anderson WF, Ohlendorf DH, Takeda Y, Matthews BW (1981). "Structure of the cro repressor from bacteriophage lambda and its ...
... bacteriophages) is to avoid the restriction enzymes present in bacteria. This enzyme system acts at least in part as a ... "Independent functions of viral protein and nucleic acid in growth of bacteriophage". The Journal of General Physiology. 36 (1 ...
Bacteriophages are able to infect most bacteria and are easily found in most environments colonized by bacteria, and have been ... "Boycott on Meat is Rapidly Spreading; Men Who Are Blamed For High Price", Atlanta Constitution, 25 January 1910, p1 ... Joerger R.D. (2003). "Alternatives to antibiotics: bacteriocins, antimicrobial peptides and bacteriophages". Poultry Science. ... "150,000 at Cleveland Stop the Use of Meat" Syracuse Herald-Journal, 25 January 1910, p1 ...
The genes of bacteriophage (phage) T4 that encode proteins with a role in determining phage T4 structure were identified using ... Mammalian HSP60 was first reported as a mitochondrial P1 protein. It was subsequently cloned and sequenced by Radhey Gupta and ... Snustad DP (August 1968). "Dominance interactions in Escherichia coli cells mixedly infected with bacteriophage T4D wild-type ... Mitochondrial matrix protein P1, P60 lymphocyte protein, HSPD1 Heat shock protein 60 (HSP60) is a mitochondrial chaperonin that ...
Depending on the lattice symmetry, each morphological unit of the S-layer is composed of one (p1), two (p2), three (p3), four ( ... Additional functions associated with S-layers include: protection against bacteriophages, Bdellovibrios, and phagocytosis ... In general, S-layers exhibit either an oblique (p1, p2), square (p4) or hexagonal (p3, p6) lattice symmetry. ...
Kleppen HP, Holo H, Jeon SR, Nes IF, Yoon SS (2012) A novel bacteriophage of the Podoviridae family infecting Weissella cibaria ... Actinomyces virus Av1 and Mycoplasma virus P1 Rakietenvirinae Andhravirus Rosenblumvirus Sepvirinae Diegovirus Oslovirus ... Discovery of an expansive bacteriophage family that includes the most abundant viruses from the human gut, in: Nature ... "The Genome of Cronobacter sakazakii Bacteriophage vB_CsaP_GAP227 Suggests a New Genus within the Autographivirinae". Genome ...
The bacteriophage T4 DNA polymerase (family A) was also initially used in PCR. It has a higher fidelity of replication than the ... automatable amplification and sequencing of insert end fragments from P1 and YAC clones for chromosome walking". Genomics. 25 ( ...
P1(xQ) 62.5%. While other studies identify this as R(xR2)/R1b, the subject remains controversial (see Hammer, Michael F. et al ... Hershey A, Chase M (1952). "Independent functions of viral protein and nucleic acid in growth of bacteriophage". J Gen Physiol ...
Buy our Bacteriophage P1 Cre recombinase peptide. Ab41101 is a Synthetic peptide for ab40011. Abcam provides free protocols, ... Cre-recombinase is a 38 kDa DNA recombinase derived from the P1 bacteriophage. It is highly specific for a 34 bp DNA sequence ( ... Bacteriophage P1 Cre recombinase peptide. See all Cre recombinase proteins and peptides. ... loxP) found in P1 DNA. It catalyzes site-specific recombination between two 34-base-pair LOXP sites. Its role is to maintain ...
TRANSDUCTIONAL INSTABILITY OF Tn5-INDUCED MUTATIONS: GENERALIZED AND SPECIALIZED TRANSDUCTION OF Tn5 BY BACTERIOPHAGE P1. ... TRANSDUCTIONAL INSTABILITY OF Tn5-INDUCED MUTATIONS: GENERALIZED AND SPECIALIZED TRANSDUCTION OF Tn5 BY BACTERIOPHAGE P1. ... TRANSDUCTIONAL INSTABILITY OF Tn5-INDUCED MUTATIONS: GENERALIZED AND SPECIALIZED TRANSDUCTION OF Tn5 BY BACTERIOPHAGE P1. ... TRANSDUCTIONAL INSTABILITY OF Tn5-INDUCED MUTATIONS: GENERALIZED AND SPECIALIZED TRANSDUCTION OF Tn5 BY BACTERIOPHAGE P1 ...
Isolation of bacteriophage-P1-derived constructs using the QIAGEN® Plasmid Midi Kit - (EN). ... The procedure has been used successfully for isolation of 110 kb P1 DNA (pAdsacBII with an 80 kb insert) from Escherichia coli ... Yield of P1 DNA was typically 10-50 µg from 500 ml culture. ...
Bacteriophage P1 cloning system for the isolation, amplification, and recovery of DNA fragments as large as 100 kilobase pairs ... Bacteriophage P1 cloning system for the isolation, amplification, and recovery of DNA fragments as large as 100 kilobase pairs ... Bacteriophage P1 cloning system for the isolation, amplification, and recovery of DNA fragments as large as 100 kilobase pairs ... Bacteriophage P1 cloning system for the isolation, amplification, and recovery of DNA fragments as large as 100 kilobase pairs ...
Bacteriophage P1 cloning system for the isolation, amplification and recovery of DNA fragments as large as 100 kilobases pairs ... such as P1 bacteriophage (=-=Sternberg, 1990-=-), bacterial artificial chromosomes (BACs) (Shizuya et al., 1992) and P1 ... The genome of bacteriophage P1 by Malgorzata B. Lobocka, Debra J. Rose, Guy Plunkett Iii, Marek Rusin, Arkadiusz Samojedny, ... Bacteriophage P1 cloning system for the isolation, amplification and recovery of DNA fragments as large as 100 kilobases pairs ...
Productive infection and transduction by bacteriophage P1 in the species Salmonella bongori ... Productive infection and transduction by bacteriophage P1 in the species Salmonella bongori ... Productive infection and transduction by bacteriophage P1 in the species Salmonella bongori ... Conclusion: Therefore, bacteriophage P1 can be used as a tool for the genetic manipulation in the species S. bongori. ...
Use of a biotinylated DNA probe to detect bacteria transduced by bacteriophage P1 in soil.. L R Zeph, G Stotzky ... Presumptive bacteriophage P1 transductants of Escherichia coli, isolated from soil inoculated with lysates of transducing phage ... Use of a biotinylated DNA probe to detect bacteria transduced by bacteriophage P1 in soil. ... Use of a biotinylated DNA probe to detect bacteria transduced by bacteriophage P1 in soil. ...
Bacteriophage LM33_P1, a fast-acting weapon against the pandemic ST131-O25b: H4 Escherichia coli clonal complex. ... Bacteriophage LM33_P1 exclusively infects O25b E. coli strains with a 70% coverage on sequence types associated with high ... A large panel of E. coli strains (n = 283) was used to assess both the specificity and the activity of bacteriophage LM33_P1. ... Bacteriophage LM33_P1 represents the first weapon that specifically and quickly kills O25b E. coli strains. Therapeutic ...
P1 adsorption and sensitivity assays.P1 adsorption assays were performed using a P1 lysate grown on E. coli K-12 strain MC4100 ... Wild-type EHEC O157:H7 strains are resistant to P1, but O157:H7 gal mutants were found to be P1 sensitive and permitted P1- ... To test for sensitivity of strains to P1 lysis, each strain was cross-streaked against P1. A single line of P1 (100 μl; ∼109 ... serves as the receptor for bacteriophage P1. Phage P1 has been a workhorse for genetic manipulation of E. coli K-12 for many ...
In the lysogenic state, bacteriophage P1 is maintained as a low copy-number circular plasmid. Site-specific recombination at ... PepA and ArgR do not regulate Cre recombination at the bacteriophage P1 loxP site ... PepA and ArgR do not regulate Cre recombination at the bacteriophage P1 loxP site. Plasmid, 59(2), pp. 119-126. (doi:10.1016/j. ... It has been suggested that ArgR and PepA play a similar role in P1 maintenance, regulating Cre recombination by binding to DNA ...
A restriction fragment of the bacteriophage P1 genome known to serv ... The sequence of the bacteriophage P1 genome region serving as hot target for IS2 insertion.: ... The sequence of the bacteriophage P1 genome region serving as hot target for IS2 insertion.. Authors * C Sengstag ... A restriction fragment of the bacteriophage P1 genome known to serve as a hot target for IS2 insertion in its host, Escherichia ...
Since the ban gene of bacteriophage P1 suppresses a number of conditionally lethal dnaB mutations in Escherichia coli, it was ... Genome of bacteriophage P1.. *Małgorzata B Łobocka, Debra J Rose, +5 authors Frederick R Blattner ... Phylogenetic and functional analysis of the bacteriophage P1 single-stranded DNA-binding protein.. *Jannick Dyrløv Bendtsen, ... Bacteriophage P1 Ban protein is a hexameric DNA helicase that interacts with and substitutes for Escherichia coli DnaB.. @ ...
"Bacteriophage P1". In The Bacteriophages, Vol. 1, ed. Richard Calendar, pp. 291-438 (Plenum; 1988) Research papers Nat ... "Bacteriophage P1 Cloning System for the Isolation, Amplification, and Recovery of DNA Fragments as Large as 100 Kilobase Pairs ... "Bacteriophage P1 site-specific recombination. I. Recombination between loxP sites", Journal of Molecular Biology, 150 (4): 467- ... where he started to study the phage P1. From 1981 he directed his own group, continuing to research the P1 phage, as well as ...
Characterization of a P1-like bacteriophage carrying CTX-M-27 in Salmonella spp. resistant to third generation cephalosporins ... Corrigendum: Characterization of a P1-like bacteriophage carrying CTX-M-27 in Salmonella spp. resistant to third generation ... Rights & permissionsfor article Characterization of a P1-like bacteriophage carrying CTX-M-27 in ,i,Salmonella spp.,/i, ... Rights & permissionsfor article Corrigendum: Characterization of a P1-like bacteriophage carrying CTX-M-27 in ,i,Salmonella spp ...
Escherichia coli bacteriophage P1 (ATCC® 25404-B1™) ATCC® Number: 25404-B1™ Deposited As P1 ... Escherichia coli bacteriophage MS2 (ATCC® 15597-B1™) ATCC® Number: 15597-B1™ Deposited As MS2 ... Escherichia coli bacteriophage T2 (ATCC® 11303-B2™) ATCC® Number: 11303-B2™ Deposited As T2 ... Escherichia coli bacteriophage T4 (ATCC® 11303-B4™) ATCC® Number: 11303-B4™ Deposited As T4 ...
"Bacteriophage P1", in Richard Calendar (ed.), The Bacteriophages, Oxford University Press, p. 350, ISBN 0195148509 Viralzone: ... "DNA Inversion Regions Min of Plasmid p15B and Cin of Bacteriophage P1: Evolution of Bacteriophage Tail Fiber Genes". Journal of ... The genome of P1 encodes 112 proteins and 5 untranslated genes and is this about twice the size of bacteriophage lambda. The ... P1 is a temperate bacteriophage that infects Escherichia coli and some other bacteria. When undergoing a lysogenic cycle the ...
Recombinant bacteriophage p1 Cre recombinase protein (ab134845) 636898869970000000. Product. Recombinant E. coli RecQ DNA ...
4.4 Bacteriophage P1 derived vector. 4.5 P1 derived artificial chromosome (PAC). 4.6 Bacterial artificial chromosomes (BAC) ...
... a P1 genomic library of 17-fold coverage and a cosmid library of 8 genome equivalents, both made from S. pombe strain 972h-, ... High resolution cosmid and P1 maps spanning the 14 Mb genome of the fission yeast S. pombe Cell. 1993 Apr 9;73(1):109-20. doi: ... Gridded on high density filters, a P1 genomic library of 17-fold coverage and a cosmid library of 8 genome equivalents, both ...
Bacterial and Bacteriophage Strains. Bacteriophage P1 lysates of galR::kanR (from Keio collection; (Baba et al., 2006)) were ... E. coli MG1655 galR-TAP (AMD032) was constructed by bacteriophage P1 transduction of the kanR-linked TAP tag cassette from ... coli K-12 MG1655 galR deletion strains were constructed from MG655 by bacteriophage P1 transduction using the lysate. Cells ... For galE the tsps are indicated as (+1) for P1 and (−5) for P2. The amino terminus of the first protein in each operon is ...
Bacteriophage P1-mediated transduction experiments: Bacteriophage P1-mediated transduction was carried out essentially as ... cotransducible with the groESgroEL operon by bacteriophage P1 (Fayetet al. 1989). P1 lysates were grown on the putative Tr+ ... Each culture was supplemented with 5 × 10-3 m CaCl2 to ensure efficient bacteriophage P1 adsorption. Infected cultures were ... 1984 Bacteriophage T4 bypass31 mutations that make gene 31 nonessential for bacteriophage T4 replication: mapping bapass31 ...
Bacteriophage P1 / enzymology * Cell Line * Chromosomes, Bacterial * Cloning, Molecular / methods* * DNA Transposable Elements ... By combining a mapped transposon mutation from each of the mutant pools into the same chromosome using phage P1 transduction ...
1984) Bacteriophage P1 site-specific recombination. Purification and properties of the Cre recombinase protein. J Biol Chem 259 ... 1984) Site-specific recombination by the bacteriophage P1 lox-Cre system. Cre-mediated synapsis of two lox sites. J Mol Biol ...
Bacteriophage P1 vectors can hold inserts 70 - 100kb in size. They begin as linear DNA molecules packaged into bacteriophage P1 ... P1 artificial chromosomes (PACs) have features of both P1 vectors and Bacterial Artificial Chromosomes (BACs). Similar to P1 ... Unlike P1 vectors, they do not need to be packaged into bacteriophage particles for transduction. Instead they are introduced ... P1 vectors also contain a P1 plasmid replicon, which ensures only one copy of the vector is present in a cell. However, there ...
About half of it was isolated in P1 and PAC clones. The region harbors the genes FGR, SLC9A1, HMG17, EXTL1, AML2, RH, OP18, ...
We studied the effect of mazEF on the development of bacteriophage P1 upon thermoinduction of the prophage P1CM c1ts and upon ... Iida S, Arber W (1977) Plaque forming specialized transducing phage P1: isolation of P1 CmSmSu, a precursor of P1 Cm. Mol Gen ... Lehnherr H, Magnuson E, Jafri S, Yarmolinsky MB (1993) Plasmid addiction genes of bacteriophage P1: doc, which causes cell ... Bacterial programmed cell death Bacteriophage P1 Phage exclusion Multicellular behavior of bacteria ...
... coli temperate bacteriophages P1 and N15. P1 and N15 are temperate bacteriophages that are stably maintained as a circular ... the antitoxin and the toxin in bacteriophage P1 (38). The bacteriophage N15 encodes a TA system homologous to the tad-ata ... Plasmid addiction genes of bacteriophage P1: doc, which causes cell death on curing of prophage, and phd, which prevents host ... the sequences of new bacteriophage genomes will help to ascertain the implication of temperate bacteriophages in the virulence ...
cre, cre recombinase, bacteriophage P1. Site of Expression. vascular smooth muscle cells. ...
cre, cre recombinase, bacteriophage P1. Site of Expression. female germline as well as tyrosine endothelial and hematopoietic ... cre, cre recombinase, bacteriophage P1. Site of Expression. female germline as well as tyrosine endothelial and hematopoietic ...
... of bacteriophage P1. Evidence for control of the P1 dam methylase by Op68. J. Biol. Chem. 264, 3611-3617. ... 2004). Genome of bacteriophage P1. J. Bacteriol. 186, 7032-7068. doi: 10.1128/jb.186.21.7032-7068.2004 ... Sternberg, N., Sauer, B., Hoess, R., and Abremski, K. (1986). Bacteriophage P1 cre gene and its regulatory region. Evidence for ... Sternberg, N., and Coulby, J. (1990). Cleavage of the bacteriophage P1 packaging site (pac) is regulated by adenine methylation ...
  • The generation of a complete physical map of the human genome should be achieved by the use of large segments of DNA contained in yeast artificial chromosomes (18), P1 clones =-=(34)-=-, and cosmid or phage contigs (32, 33). (psu.edu)
  • The sequence of the bacteriophage P1 genome region serving as. (mysciencework.com)
  • A restriction fragment of the bacteriophage P1 genome known to serve as a hot target for IS2 insertion in its host, Escherichia coli K12, was entirely sequenced. (mysciencework.com)
  • He and his coworkers also developed P1-derived cloning vectors, enabling the cloning of very long stretches of DNA, which have been used in mapping the human genome. (wikipedia.org)
  • The genome of the P1 phage is moderately large, around 93Kbp in length (compared to the genomes of e.g. (wikipedia.org)
  • The genome of P1 encodes three tRNAs which are expressed in the lytic stage. (wikipedia.org)
  • The genome of P1 encodes 112 proteins and 5 untranslated genes and is this about twice the size of bacteriophage lambda. (wikipedia.org)
  • The genome of the P1 phage is maintained as a low copy number plasmid in the bacterium. (wikipedia.org)
  • Gridded on high density filters, a P1 genomic library of 17-fold coverage and a cosmid library of 8 genome equivalents, both made from S. pombe strain 972h-, were ordered by hybridizing genetic markers and individual clones from the two libraries. (nih.gov)
  • consists of a toxin (Doc) and an antidote (Phd). Cells that have lost the P1 genome will die because the antidote is gradually degraded. (igem.org)
  • One possibility would be to modify the plasmid addiction system of bacteriophage P1 which consists of a toxin (Doc) and an antidote (Phd). Cells that have lost the P1 genome will die because the antidote is gradually degraded while the toxin is stable. (igem.org)
  • Site-specific recombination at loxP by the phage-encoded Cre protein keeps P1 monomeric, thus helping to ensure stable plasmid inheritance. (gla.ac.uk)
  • Daniel Hamilton (1981), "Bacteriophage P1 site-specific recombination. (wikipedia.org)
  • N. Sternberg and D. Hamilton, "Bacteriophage P1 site-specific recombination. (hindawi.com)
  • It catalyzes site-specific recombination and is highly specific for a 34-bp DNA sequence motif called loxP (locus of X-over P1) found in P1 DNA. (sigmaaldrich.com)
  • Although complete cotransduction of the resistance determinant and the chromosomal mutation might be expected, it is often found that when Tn 5 (Kan) insertion mutations are transduced by bacteriophage P1 most of the nonmutant kanamycin-resistant transductants are due to specialized transduction of Tn 5 . (genetics.org)
  • The gal mutants could easily be reverted to a wild-type Gal + strain using P1 transduction. (asm.org)
  • P1-mediated generalized transduction enables movement of mutations for generation of isogenic bacterial strains, which is often required for proving the linkage between particular genotypes and phenotypes. (asm.org)
  • The P1 phage has gained research interest because it can be used to transfer DNA from one bacterial cell to another in a process known as transduction. (wikipedia.org)
  • By combining a mapped transposon mutation from each of the mutant pools into the same chromosome using phage P1 transduction and then excising the flanked genomic segment by Cre-mediated loxP recombination, we obtained E. coli strains in which large genomic fragments (59-117 kilobases) were deleted. (nih.gov)
  • At least two of the broad-host-range bacteriophages mediated generalized transduction. (asm.org)
  • In this article, we describe a virulent bacteriophage, LM33_P1, which specifically infects O25b strains, and provide data related to its therapeutic potential. (ovid.com)
  • The virulent bacteriophages T4 and RB49 are independent of the host GroES function, because they encode their own cochaperone proteins, Gp31 and CocO, respectively. (genetics.org)
  • We studied the effect of mazEF on the development of bacteriophage P1 upon thermoinduction of the prophage P1CM c1 ts and upon infection with virulent phage particles (P1 vir ). (springer.com)
  • Use of a biotinylated DNA probe to detect bacteria transduced by bacteriophage P1 in soil. (asm.org)
  • No P1 lysogens of indigenous soil bacteria were detected with the DNA probe. (asm.org)
  • In addition, two techniques for the lysis and deproteinization of bacteria and bacteriophages on nitrocellulose filters were compared. (asm.org)
  • The inner region of the LPS core oligosaccharide, which is conserved in many enteric bacteria, serves as the receptor for bacteriophage P1. (asm.org)
  • P1 is a temperate bacteriophage that infects Escherichia coli and some other bacteria. (wikipedia.org)
  • E. coli groEL 44 mutant bacteria do not form colonies above 42° nor do they propagate bacteriophages λ, T4, or RB49. (genetics.org)
  • Bacteriophages are viral parasites of bacteria first recognized early in the 20th century ( 8 , 13 ). (asm.org)
  • P1 is a temperate bacteriophage (phage) that infects Escherichia coli and a some other bacteria. (cbd.int)
  • Enterobacteria phage T3 is a bacteriophage that infects Escherichia coli bacteria. (cbd.int)
  • P1 bacteriophages lysogenize bacteria as independent plasmid-like elements. (jove.com)
  • This property offered the chance to investigate recombination between different mutants and between different microbial strains, i.e. , to carry out genetic experiments with bacteria as well as with bacteriophages. (mdpi.com)
  • Bacteriophages are viruses that infect bacteria. (golden.com)
  • MacDonald, A.I. , Lu, Y. , Kilbride, E.A. , Akopian, A. and Colloms, S.D. (2008) PepA and ArgR do not regulate Cre recombination at the bacteriophage P1 loxP site. (gla.ac.uk)
  • It has been suggested that ArgR and PepA play a similar role in P1 maintenance, regulating Cre recombination by binding to DNA sequences upstream of loxP . (gla.ac.uk)
  • Here, we show that ArgR does not bind to its proposed binding site upstream of loxP , and that Cre recombination at loxP in its natural P1 context is not affected by PepA and ArgR in vitro. (gla.ac.uk)
  • Our results demonstrate that PepA requires specific DNA sequences for binding, and that PepA and ArgR have no direct role in Cre recombination at P1 loxP . (gla.ac.uk)
  • Nat L. Sternberg (August 2, 1942 - September 26, 1995) was an American molecular biologist and bacteriophage researcher, particularly known for his work on DNA recombination and the phage P1. (wikipedia.org)
  • From 1981 he directed his own group, continuing to research the P1 phage, as well as branching out to study DNA recombination in mammalian cells. (wikipedia.org)
  • P1 encodes a site-specific recombinase, Cre, that is widely used to carry out cell-specific or time-specific DNA recombination by flanking the target DNA with loxP sites (see Cre-Lox recombination). (wikipedia.org)
  • Cre (Causes recombination with Cyclization recombinase), a 38 kDa DNA recombinase of the ′phage′ integrase family, is derived from the P1 bacteriophage. (sigmaaldrich.com)
  • This is a mechanism for gene transmission mediated by a bacteriophage that functions both as a reservoir and as a vector of exogenous genes, which remain protected from environmental effects in the bacteriophage's capsid. (ejbiotechnology.info)
  • Since the ban gene of bacteriophage P1 suppresses a number of conditionally lethal dnaB mutations in Escherichia coli, it was assumed that Ban protein is a DNA helicase (DnaB analogue) that can substitute for DnaB in the host replication machinery. (semanticscholar.org)
  • Engelberg-Kulka H, Reches M, Narasimhan S, Schoulaker-Schwarz R, Klemes Y, Aizenman E, Glaser G (1998) rexB of bacteriophage lambda is an anti-cell death gene. (springer.com)
  • We suggest that broad-host-range bacteriophages play a key role in phage ecology and gene transfer in nature. (asm.org)
  • Bacteriophages able to interact with a wide range of host species would be significant in the control of the composition and genetic diversity of microbial communities as well as the processes of transductional gene exchange and the transfer of antibiotic resistance genes through those communities. (asm.org)
  • We describe here a P1-like bacteriophage, RCS47, carrying a blaSHV-2 gene, isolated from a clinical strain of Escherichia coli from phylogroup B1, and we report the prevalence of P1-like prophages in natural E. coli isolates. (jove.com)
  • The reference P1 prophage plasmid replication gene belonged to the IncY incompatibility group, whereas that of RCS47 was from an unknown group. (jove.com)
  • In Pseudomonas syringae, YajQ functions as a host protein involved in the temporal control of bacteriophage Phi6 gene transcription. (ebi.ac.uk)
  • also known as Cre) is encoded by the cre gene (Gene ID: 2777477) in Escherichia phage P1 (Bacteriophage P1). (sigmaaldrich.com)
  • We could establish that a derivative of bacteriophage P1, P1Cm, infects strains of S. bongori with frequencies of lysogenization in the order of ~10-2 lysogens/UFP. (ejbiotechnology.info)
  • A large panel of E. coli strains (n = 283) was used to assess both the specificity and the activity of bacteriophage LM33_P1. (ovid.com)
  • Bacteriophage LM33_P1 exclusively infects O25b E. coli strains with a 70% coverage on sequence types associated with high antibiotic resistance (ST131 and ST69). (ovid.com)
  • Bacteriophage LM33_P1 represents the first weapon that specifically and quickly kills O25b E. coli strains. (ovid.com)
  • These strains were able to adsorb P1. (asm.org)
  • P1 lysates grown on the gal mutant strains could be used to move chromosomal markers between EHEC strains, thereby facilitating genetic manipulation of E. coli O157:H7. (asm.org)
  • We thank Dr. M. Yarmolinsky for his advice and for supplying us with P1 strains, and Dr H. Lehnherr for advice. (springer.com)
  • lactamase (ESBL)-producing and non-ESBL-producing strains (P = 0.69), but this prevalence was lower in phylogroup B2 than in the other phylogroups (P = 0.008), suggesting epistatic interactions between P1 family phages and the genetic background of E. coli strains. (jove.com)
  • Presumptive bacteriophage P1 transductants of Escherichia coli, isolated from soil inoculated with lysates of transducing phage P1 and E. coli, were confirmed to be lysogenic for phage P1 by hybridization with a biotinylated DNA probe prepared from the 1.2-kilobase-pair HindIII 3 fragment of bacteriophage P1. (asm.org)
  • Nine of 10 phages studied were found to be broad-host-range bacteriophages. (asm.org)
  • Of these broad-host-range phages, P1 and Mu are the best studied. (asm.org)
  • Two important questions concern the relative frequencies with which bacteriophages exhibiting a wide host range may be isolated from nature and the percentages of broad-host-range phages that can be identified in existing virus collections. (asm.org)
  • Mainly through the Science Education Alliance Phage Hunters Advancing Genomics and Evolutionary Science (SEA-PHAGES) program, more than 17,000 bacteriophages infecting hosts of the phylum Actinobacteria have been isolated, of which more than 3,000 have been sequenced ( https://phagesdb.org ). (asm.org)
  • These bacteriophages can be sorted into related groups (clusters A, B, C, etc.) according to their overall relatedness ( 2 , 3 ), and ∼50% of these contain phages that are likely to be temperate, coding for predicted repressor and integrase genes ( 4 ). (asm.org)
  • P1-like phages are part of the mobile elements that carry antibiotic resistance. (jove.com)
  • Within this context, this investigation aimed to evaluate the ability of the generalized transducing bacteriophage P1 to productively infect and transduce in the bacterial species Salmonella bongori. (ejbiotechnology.info)
  • In contrast, it is clear that some bacteriophages do productively infect a range of bacterial species. (asm.org)
  • Therefore, bacteriophage P1 can be used as a tool for the genetic manipulation in the species S. bongori. (ejbiotechnology.info)
  • Two bacteriophage collections were examined with regard to their ability to form plaques on multiple bacterial host species. (asm.org)
  • Bacteriophage P1 is a generalized transducing virus capable of plaque formation on several enteric species in addition to Escherichia coli ( 40 ), while bacteriophage Mu produces progeny virions capable of adsorption to and plaque production on different bacterial species ( 12 ) due to the differential orientation of the invertible viral G segment region ( 12 , 36 ). (asm.org)
  • The following genera are recognized: Cepunavirus (formerly Cp1virus, with species Streptococcus virus Cp1 aka Complutense phage 1, Cp-1) Negarvirus Salasvirus The following species are unassigned to a genus: Actinomyces virus Av1 Mycoplasma virus P1 Two bacteriophages in this family have been found to infect and lyse Clostridium perfringens. (wikipedia.org)
  • Cre-recombinase is a 38 kDa DNA recombinase derived from the P1 bacteriophage. (abcam.com)
  • CRE is a fragment from the Cre recombinase derived from E. coli bacteriophage P1. (currentprotocols.com)
  • Dp-1 and Cp-1 are lytic bacteriophages, whereas MM1 is a temperate pneumophage ( 45 , 50 , 52 ). (asm.org)
  • Temperate bacteriophages are common and establish lysogens of their bacterial hosts in which the prophage is stably inherited. (asm.org)
  • In the lysogenic state, bacteriophage P1 is maintained as a low copy-number circular plasmid. (gla.ac.uk)
  • Bacteriophage P1 Ban protein is a hexameric DNA helicase that interacts with and substitutes for Escherichia coli DnaB. (semanticscholar.org)
  • Phylogenetic and functional analysis of the bacteriophage P1 single-stranded DNA-binding protein. (semanticscholar.org)
  • The P1 plasmid combats this by several methods: The plasmid replication is tightly regulated by a RepA protein dependent mechanism. (wikipedia.org)
  • The present invention relates to vaccines comprising a bacteriophage which has been engineered to express an immunogenic protein/peptide and wherein the surface of the bacteriophage has not been modified to contain proteins/peptides designed to target the phage to receptors on the surface of specific cell types. (patentgenius.com)
  • It has been shown to bind to the phage's major structural core protein P1, most likely activating transcription by acting indirectly on the RNA polymerase. (ebi.ac.uk)
  • Interaction of a host protein with core complexes of bacteriophage phi6 to control transcription. (ebi.ac.uk)
  • The role of host protein YajQ in the temporal control of transcription in bacteriophage Phi6. (ebi.ac.uk)
  • P1 can also be used to create the P1-derived artificial chromosome cloning vector which can carry relatively large fragments of DNA. (wikipedia.org)
  • It is typical for such prophages to be integrated into the bacterial chromosome, but extrachromosomally replicating prophages have been described also, with the best characterized being the Escherichia coli phage P1 system. (asm.org)
  • Corrigendum: Characterization of a P1-like bacteriophage carrying CTX-M-27 in Salmonella spp . (nature.com)
  • It was shown that all groES mutations isolated originally as blocking bacteriophage λ growth map in the DNA segment encoding the GroES mobile loop. (genetics.org)
  • Studies of bacteriophage infection have revealed that the process is initiated when the virion interacts with host cell surface receptor molecules ( 14 ). (asm.org)
  • protective Immune Responses Induced by the Immunization of Mice with a Recombinant Bacteriophage Displaying a Epitope of the Human Respiratory Syncytial Virus" Virology 234: 118-122 (1997). (patentgenius.com)
  • It is highly specific for a 34 bp DNA sequence (loxP) found in P1 DNA. (abcam.com)
  • Casadaban MJ, Cohen SA (1979) Lactose genes fused to exogenous promoters in one step using a Mu -lac bacteriophage: in vivo probe for transcriptional control sequence. (springer.com)
  • We found that 70% of the sequence of RCS47, a 115-kb circular molecule, was common to the reference P1 bacteriophage under GenBank accession no. (jove.com)
  • It is doing this at a specific target sequence, called the Lox sequence, found in the bacteriophage P1. (sciencephoto.com)
  • Unfortunately, E. coli O157 cannot be genetically manipulated using the generalized transducing phage P1, presumably because its extensive O antigen obscures the P1 receptor, the lipopolysaccharide (LPS) core subunit. (asm.org)
  • I believe the P1 origins use the par set of genes to maintain single copy whereas the F origins use the sop set of genes. (openwetware.org)
  • Two Escherichia coli DNA-binding proteins, PepA and ArgR, were recently reported to be necessary for maintenance or establishment of P1 lysogeny. (gla.ac.uk)
  • To address how the antitoxin IDR is involved in transcription regulation, we studied the phd-doc operon from bacteriophage P1. (rcsb.org)
  • While virion particles are capable of independent existence outside the host, all bacteriophages are obligate intracellular parasites and must enter a host bacterium to replicate. (asm.org)
  • In 1976, Sternberg joined the group being established by Michael Yarmolinsky in the Laboratory of Molecular Biology of the National Cancer Institute's Frederick Cancer Research Center at Fort Detrick, Frederick, Maryland, where he started to study the phage P1. (wikipedia.org)
  • The high prevalence of P1-like prophages suggests their role may be underestimated. (jove.com)
  • S. marcescens bacteriophages were chosen as the focus of our research because of the growing importance of the host and its increasing prevalence as a nosocomial pathogen. (biomedcentral.com)
  • Streptococcus pneumoniae is an important human pathogen that often carries temperate bacteriophages. (asm.org)
  • It is in the first half of the 20th century that microbiologists became aware that bacterial isolates and bacterial viruses (bacteriophages) under study could spontaneously produce phenotypic variants. (mdpi.com)
  • Only three S. pneumoniae bacteriophage genomes have been characterized in detail, and their sequences have been determined. (asm.org)
  • Temperate bacteriophages are major players in the evolution of bacterial genomes. (prolekare.cz)
  • Bertani G (2004) Lysogeny at mid-twentieth century: P1, P2, and other experimental systems. (springer.com)
  • The procedure has been used successfully for isolation of 110 kb P1 DNA (pAdsacBII with an 80 kb insert) from Escherichia coli strain NS3529. (qiagen.com)
  • Our results suggest that a multiple-host enrichment protocol may be more effective for the isolation of broad-host-range bacteriophages by avoiding the selection bias inherent in single-host methods. (asm.org)
  • Virology methods and sequencing were used to characterize this bacteriophage in vitro, while three relevant mouse models were employed to show its in vivo efficacy. (ovid.com)
  • Bacteriophage Lambda Vector for Transducing a cDNA Clone Library into Mammalian Cells", Molecular and Cellular Biology 5:1136-1142 (1985). (patentgenius.com)
  • I actually dated the man who gave P1 bacteriophage/Lambda Red research to NIH/USA. (abovetopsecret.com)
  • The P1 plasmid partition locus, P1 par , actively distributes plasmid copies to Escherichia coli daughter cells. (embopress.org)
  • Phage P1 has been a workhorse for genetic manipulation of E. coli K-12 for many decades. (asm.org)
  • Genetic experiments have shown that the GroEL/GroES chaperone machine of Escherichia coli is absolutely essential, not only for bacterial growth but also for the propagation of many bacteriophages including λ. (genetics.org)
  • IMPORTANCE Bacteriophages are the most abundant biological entities in the biosphere and are a source of uncharacterized biological mechanisms and genetic tools. (asm.org)
  • Presumably, the combined size of the latter fragment and the vector DNA (13 kbp) exceeds the headful capacity of P1. (pnas.org)
  • strain PWH3a was infected with a lytic virus (PWH3a-P1) and the resulting 36.0 µ mol L −1 of dissolved organic N (DON) in the lysate was added to cultures containing cyanobacteria ( Synechococcus sp. (biogeosciences.net)
  • Surprisingly, systematic studies of broad-host-range interactions of bacteriophages and of the relative frequencies with which such bacteriophages may be isolated are lacking. (asm.org)
  • Thus, although mazEF action causes individual cells to die, upon phage growth this is generally beneficial to the bacterial culture because it causes P1 phage exclusion from the bacterial population. (springer.com)
  • The phd/doc module of bacteriophage P1 is being used to study transcription regulation by conditional co-operativity. (vib.be)
  • P1 and P2 indicate promoters. (asm.org)