Fields of science encompassing studies and research from the disciplines of PHYSICS; CHEMISTRY; BIOLOGICAL SCIENCES; and MATHEMATICS; that are related to the planet EARTH. Subfields include atmospheric chemistry; CLIMATOLOGY; ENVIRONMENTAL SCIENCES; GEOGRAPHY; GEOLOGY; geophysics; METEOROLOGY; OCEANOGRAPHY; PALEONTOLOGY; mineralogy; and seismology.
The study of natural phenomena by observation, measurement, and experimentation.
Physicochemical property of fimbriated (FIMBRIAE, BACTERIAL) and non-fimbriated bacteria of attaching to cells, tissue, and nonbiological surfaces. It is a factor in bacterial colonization and pathogenicity.
The study of those aspects of energy and matter in terms of elementary principles and laws. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)
A loose confederation of computer communication networks around the world. The networks that make up the Internet are connected through several backbone networks. The Internet grew out of the US Government ARPAnet project and was designed to facilitate information exchange.
A short thick vein formed by union of the superior mesenteric vein and the splenic vein.
Adherence of cells to surfaces or to other cells.
The protein components of a number of complexes, such as enzymes (APOENZYMES), ferritin (APOFERRITINS), or lipoproteins (APOLIPOPROTEINS).
An iron-binding beta1-globulin that is synthesized in the LIVER and secreted into the blood. It plays a central role in the transport of IRON throughout the circulation. A variety of transferrin isoforms exist in humans, including some that are considered markers for specific disease states.
Exclusive legal rights or privileges applied to inventions, plants, etc.
Encrustations, formed from microbes (bacteria, algae, fungi, plankton, or protozoa) embedding in extracellular polymers, that adhere to surfaces such as teeth (DENTAL DEPOSITS); PROSTHESES AND IMPLANTS; and catheters. Biofilms are prevented from forming by treating surfaces with DENTIFRICES; DISINFECTANTS; ANTI-INFECTIVE AGENTS; and antifouling agents.
Artificial substitutes for body parts, and materials inserted into tissue for functional, cosmetic, or therapeutic purposes. Prostheses can be functional, as in the case of artificial arms and legs, or cosmetic, as in the case of an artificial eye. Implants, all surgically inserted or grafted into the body, tend to be used therapeutically. IMPLANTS, EXPERIMENTAL is available for those used experimentally.
Infections resulting from the use of catheters. Proper aseptic technique, site of catheter placement, material composition, and virulence of the organism are all factors that can influence possible infection.
Compounds formed by the joining of smaller, usually repeating, units linked by covalent bonds. These compounds often form large macromolecules (e.g., BIOPOLYMERS; PLASTICS).
One of the three domains of life (the others being Eukarya and ARCHAEA), also called Eubacteria. They are unicellular prokaryotic microorganisms which generally possess rigid cell walls, multiply by cell division, and exhibit three principal forms: round or coccal, rodlike or bacillary, and spiral or spirochetal. Bacteria can be classified by their response to OXYGEN: aerobic, anaerobic, or facultatively anaerobic; by the mode by which they obtain their energy: chemotrophy (via chemical reaction) or PHOTOTROPHY (via light reaction); for chemotrophs by their source of chemical energy: CHEMOLITHOTROPHY (from inorganic compounds) or chemoorganotrophy (from organic compounds); and by their source for CARBON; NITROGEN; etc.; HETEROTROPHY (from organic sources) or AUTOTROPHY (from CARBON DIOXIDE). They can also be classified by whether or not they stain (based on the structure of their CELL WALLS) with CRYSTAL VIOLET dye: gram-negative or gram-positive.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Proteins obtained from ESCHERICHIA COLI.
The degree of pathogenicity within a group or species of microorganisms or viruses as indicated by case fatality rates and/or the ability of the organism to invade the tissues of the host. The pathogenic capacity of an organism is determined by its VIRULENCE FACTORS.
A species of gliding bacteria found on soil as well as in surface fresh water and coastal seawater.
A group of PROTEOBACTERIA represented by morphologically diverse, anaerobic sulfidogens. Some members of this group are considered bacterial predators, having bacteriolytic properties.
An anchoring junction of the cell to a non-cellular substrate. It is composed of a specialized area of the plasma membrane where bundles of the ACTIN CYTOSKELETON terminate and attach to the transmembrane linkers, INTEGRINS, which in turn attach through their extracellular domains to EXTRACELLULAR MATRIX PROTEINS.
A family of non-receptor, PROLINE-rich protein-tyrosine kinases.
A non-receptor protein tyrosine kinase that is localized to FOCAL ADHESIONS and is a central component of integrin-mediated SIGNAL TRANSDUCTION PATHWAYS. Focal adhesion kinase 1 interacts with PAXILLIN and undergoes PHOSPHORYLATION in response to adhesion of cell surface integrins to the EXTRACELLULAR MATRIX. Phosphorylated p125FAK protein binds to a variety of SH2 DOMAIN and SH3 DOMAIN containing proteins and helps regulate CELL ADHESION and CELL MIGRATION.
Paxillin is a signal transducing adaptor protein that localizes to FOCAL ADHESIONS via its four LIM domains. It undergoes PHOSPHORYLATION in response to integrin-mediated CELL ADHESION, and interacts with a variety of proteins including VINCULIN; FOCAL ADHESION KINASE; PROTO-ONCOGENE PROTEIN PP60(C-SRC); and PROTO-ONCOGENE PROTEIN C-CRK.
An order of rod-shaped, gram-negative fruiting gliding bacteria found in SOIL; WATER; and HUMUS.

Role of antibodies against Bordetella pertussis virulence factors in adherence of Bordetella pertussis and Bordetella parapertussis to human bronchial epithelial cells. (1/5458)

Immunization with whole-cell pertussis vaccines (WCV) containing heat-killed Bordetella pertussis cells and with acellular vaccines containing genetically or chemically detoxified pertussis toxin (PT) in combination with filamentous hemagglutinin (FHA), pertactin (Prn), or fimbriae confers protection in humans and animals against B. pertussis infection. In an earlier study we demonstrated that FHA is involved in the adherence of these bacteria to human bronchial epithelial cells. In the present study we investigated whether mouse antibodies directed against B. pertussis FHA, PTg, Prn, and fimbriae, or against two other surface molecules, lipopolysaccharide (LPS) and the 40-kDa outer membrane porin protein (OMP), that are not involved in bacterial adherence, were able to block adherence of B. pertussis and B. parapertussis to human bronchial epithelial cells. All antibodies studied inhibited the adherence of B. pertussis to these epithelial cells and were equally effective in this respect. Only antibodies against LPS and 40-kDa OMP affected the adherence of B. parapertussis to epithelial cells. We conclude that antibodies which recognize surface structures on B. pertussis or on B. parapertussis can inhibit adherence of the bacteria to bronchial epithelial cells, irrespective whether these structures play a role in adherence of the bacteria to these cells.  (+info)

Role of Bordetella pertussis virulence factors in adherence to epithelial cell lines derived from the human respiratory tract. (2/5458)

During colonization of the respiratory tract by Bordetella pertussis, virulence factors contribute to adherence of the bacterium to the respiratory tract epithelium. In the present study, we examined the roles of the virulence factors filamentous hemagglutinin (FHA), fimbriae, pertactin (Prn), and pertussis toxin (PT) in the adherence of B. pertussis to cells of the human bronchial epithelial cell line NCI-H292 and of the laryngeal epithelial cell line HEp-2. Using B. pertussis mutant strains and purified FHA, fimbriae, Prn, and PT, we demonstrated that both fimbriae and FHA are involved in the adhesion of B. pertussis to laryngeal epithelial cells, whereas only FHA is involved in the adherence to bronchial epithelial cells. For PT and Prn, no role as adhesion factor was found. However, purified PT bound to both bronchial and laryngeal cells and as such reduced the adherence of B. pertussis to these cells. These data may imply that fimbriae play a role in infection of only the laryngeal mucosa, while FHA is the major factor in colonization of the entire respiratory tract.  (+info)

Enhanced adhesion of Pasteurella multocida to cultured turkey peripheral blood monocytes. (3/5458)

Capsular hyaluronic acid (HA) mediates adhesion of serogroup A strains of Pasteurella multocida to elicited turkey air sac macrophages (TASM). In contrast, freshly isolated turkey peripheral blood monocytes (TPBM) do not bind serogroup A strains. Following culture of TPBM for 6 days in chamber slides, adhesion of the bacteria to TPBM increased gradually. Incubation in chamber slides coated with entactin-collagen IV-laminin (ECL) attachment matrix or exposure to phorbol myristate acetate (PMA) further enhanced the adhesion of P. multocida to TPBM. Addition of HA, but not Arg-Gly-Asp peptide, to TPBM culture inhibited bacterial adherence similarly to the inhibition previously reported for TASM. Exposure of TPBM to monoclonal antibody directed against HA-binding cell surface proteoglycan (CD44) decreased binding of P. multocida. Collectively, these findings indicate that P. multocida adhesion to TPBM is mediated by capsular HA and can be increased by culture on ECL attachment matrix or PMA exposure. Additionally, the findings suggest that the capsular mucopolysaccharide of serogroup A strains of P. multocida recognizes an isoform of CD44 expressed on cultured TPBM.  (+info)

Genetic characterization of a new type IV-A pilus gene cluster found in both classical and El Tor biotypes of Vibrio cholerae. (4/5458)

The Vibrio cholerae genome contains a 5.4-kb pil gene cluster that resembles the Aeromonas hydrophila tap gene cluster and other type IV-A pilus assembly operons. The region consists of five complete open reading frames designated pilABCD and yacE, based on the nomenclature of related genes from Pseudomonas aeruginosa and Escherichia coli K-12. This cluster is present in both classical and El Tor biotypes, and the pilA and pilD genes are 100% conserved. The pilA gene encodes a putative type IV pilus subunit. However, deletion of pilA had no effect on either colonization of infant mice or adherence to HEp-2 cells, demonstrating that pilA does not encode the primary subunit of a pilus essential for these processes. The pilD gene product is similar to other type IV prepilin peptidases, proteins that process type IV signal sequences. Mutational analysis of the pilD gene showed that pilD is essential for secretion of cholera toxin and hemagglutinin-protease, mannose-sensitive hemagglutination (MSHA), production of toxin-coregulated pili, and colonization of infant mice. Defects in these functions are likely due to the lack of processing of N termini of four Eps secretion proteins, four proteins of the MSHA cluster, and TcpB, all of which contain type IV-A leader sequences. Some pilD mutants also showed reduced adherence to HEp-2 cells, but this defect could not be complemented in trans, indicating that the defect may not be directly due to a loss of pilD. Taken together, these data demonstrate the effectiveness of the V. cholerae genome project for rapid identification and characterization of potential virulence factors.  (+info)

Molecular basis for the enterocyte tropism exhibited by Salmonella typhimurium type 1 fimbriae. (5/5458)

Salmonella typhimurium exhibits a distinct tropism for mouse enterocytes that is linked to their expression of type 1 fimbriae. The distinct binding traits of Salmonella type 1 fimbriae is also reflected in their binding to selected mannosylated proteins and in their ability to promote secondary bacterial aggregation on enterocyte surfaces. The determinant of binding in Salmonella type 1 fimbriae is a 35-kDa structurally distinct fimbrial subunit, FimHS, because inactivation of fimHS abolished binding activity in the resulting mutant without any apparent effect on fimbrial expression. Surprisingly, when expressed in the absence of other fimbrial components and as a translational fusion protein with MalE, FimHS failed to demonstrate any specific binding tropism and bound equally to all cells and mannosylated proteins tested. To determine if the binding specificity of Salmonella type 1 fimbriae was determined by the fimbrial shaft that is intimately associated with FimHS, we replaced the amino-terminal half of FimHS with the corresponding sequence from Escherichia coli FimH (FimHE) that contains the receptor binding domain of FimHE. The resulting hybrid fimbriae bearing FimHES on a Salmonella fimbrial shaft exhibited binding traits that resembled that of Salmonella rather than E. coli fimbriae. Apparently, the quaternary constraints imposed by the fimbrial shaft on the adhesin determine the distinct binding traits of S. typhimurium type 1 fimbriae.  (+info)

P fimbriae and other adhesins enhance intestinal persistence of Escherichia coli in early infancy. (6/5458)

Resident and transient Escherichia coli strains were identified in the rectal flora of 22 Pakistani infants followed from birth to 6 months of age. All strains were tested for O-antigen expression, adhesin specificity (P fimbriae, other mannose-resistant adhesins or type 1 fimbriae) and adherence to the colonic cell line HT-29. Resident strains displayed higher mannose-resistant adherence to HT-29 cells, and expressed P fimbriae (P = 0.0036) as well as other mannose-resistant adhesins (P = 0.012) more often than transient strains. In strains acquired during the first month of life, P fimbriae were 12 times more frequent in resident than in transient strains (P = 0.0006). The O-antigen distribution did not differ between resident and transient strains, and none of the resident P-fimbriated strains belonged to previously recognized uropathogenic clones. The results suggest that adhesins mediating adherence to intestinal epithelial cells, especially P fimbriae, enhance the persistence of E. coli in the large intestine of infants.  (+info)

Roles of Pseudomonas aeruginosa las and rhl quorum-sensing systems in control of twitching motility. (7/5458)

Pseudomonas aeruginosa is a ubiquitous environmental bacterium and an important human pathogen. The production of several virulence factors by P. aeruginosa is controlled through two quorum-sensing systems, las and rhl. We have obtained evidence that both the las and rhl quorum-sensing systems are also required for type 4 pilus-dependent twitching motility and infection by the pilus-specific phage D3112cts. Mutants which lack the ability to synthesize PAI-1, PAI-2, or both autoinducers were significantly or greatly impaired in twitching motility and in susceptibility to D3112cts. Twitching motility and phage susceptibility in the autoinducer-deficient mutants were partially restored by exposure to exogenous PAI-1 and PAI-2. Both twitching motility and infection by pilus-specific phage are believed to be dependent on the extension and retraction of polar type 4 pili. Western blot analysis of whole-cell lysates and enzyme-linked immunosorbent assays of intact cells were used to measure the amounts of pilin on the cell surfaces of las and rhl mutants relative to that of the wild type. It appears that PAI-2 plays a crucial role in twitching motility and phage infection by affecting the export and assembly of surface type 4 pili. The ability of P. aeruginosa cells to adhere to human bronchial epithelial cells was also found to be dependent on the rhl quorum-sensing system. Microscopic analysis of twitching motility indicated that mutants which were unable to synthesize PAI-1 were defective in the maintenance of cellular monolayers and migrating packs of cells. Thus, PAI-1 appears to have an essential role in maintaining cell-cell spacing and associations required for effective twitching motility.  (+info)

Cell surface-associated lipoteichoic acid acts as an adhesion factor for attachment of Lactobacillus johnsonii La1 to human enterocyte-like Caco-2 cells. (8/5458)

The influence of pH on the adhesion of two Lactobacillus strains to Caco-2 human intestinal cells was investigated. One strain, Lactobacillus johnsonii La1, was adherent at any pH between 4 and 7. The other one, L. acidophilus La10, did not attach to this cell line under the same experimental conditions. On the basis of these results, we used the monoclonal antibody technique as a tool to determine differences on the surface of these bacteria and to identify a factor for adhesion. Mice were immunized with live La1, and the hybridomas produced by fusion of spleen cells with ONS1 cells were screened for the production of antibodies specific for L. johnsonii La1. A set of these monoclonal antibodies was directed against a nonproteinaceous component of the L. johnsonii La1 surface. It was identified as lipoteichoic acid (LTA). This molecule was isolated, chemically characterized, and tested in adhesion experiments in the same system. The adhesion of L. johnsonii La1 to Caco-2 cells was inhibited in a concentration-dependent way by purified LTA as well as by L. johnsonii La1 culture supernatant that contained LTA. These results showed that the mechanism of adhesion of L. johnsonii La1 to human Caco-2 cells involves LTA.  (+info)

TY - JOUR. T1 - Effects of material properties on bacterial adhesion and biofilm formation. AU - Song, F.. AU - Koo, H.. AU - Ren, D.. PY - 2015/8/25. Y1 - 2015/8/25. N2 - Adhesion of microbes, such as bacteria and fungi, to surfaces and the subsequent formation of biofilms cause multidrug-tolerant infections in humans and fouling of medical devices. To address these challenges, it is important to understand how material properties affect microbe-surface interactions and engineer better nonfouling materials. Here we review the recent progresses in this field and discuss the main challenges and opportunities. In particular, we focus on bacterial biofilms and review the effects of surface energy, charge, topography, and stiffness of substratum material on bacterial adhesion. We summarize how these surface properties influence oral biofilm formation, and we discuss the important findings from nondental systems that have potential applications in dental medicine.. AB - Adhesion of microbes, such as ...
Objective: Relevant animal models to study effects of bacterial aggregates on wound healing are lacking. We aimed at establishing an equine wound model with bacterial aggregates to investigate the impact of bacterial inoculation on normal (thorax) and impaired (limb) wound healing. Approach: Wounds were created on three limbs and both thorax sides of six horses. Twelve out of 20 wounds per horse were inoculated with 104 Staphylococcus aureus and 105 Pseudomonas aeruginosa on day 4. Healing was monitored until day 27 by clinical assessment, including wound scoring, surface pH measurements, and digital photography for area determination. Biopsies were used for bacterial culture and for peptide nucleic acid fluorescence in situ hybridization to detect bacterial aggregates. Results: Inoculated limb wounds healed slower than noninoculated limb wounds from day 10 onward ( p , 0.0001). Inoculated and noninoculated thorax wounds healed equally well and faster than limb wounds. The odds ratio of ...
TY - JOUR. T1 - Aggregative adherence fimbriae II of enteroaggregative Escherichia coli are required for adherence and barrier disruption during infection of human colonoids. AU - Gonyar, Laura A.. AU - Smith, Rachel M.. AU - Giron, Jorge A.. AU - Zachos, Nicholas C.. AU - Ruiz-Perez, Fernando. AU - Nataro, James P.. N1 - Funding Information: This work was supported by the National Institutes of Health (P01-AI125181) to J.P.N. and by the Hartwell Foundation through a postdoctoral research fellowship to L.A.G. We acknowledge the Integrated Physiology Core of the Hopkins Conte Digestive Disease Basic and Translational Research Core Center (NIH P30 DK-089502).. PY - 2020/9. Y1 - 2020/9. N2 - Symptomatic and asymptomatic infection with the diarrheal pathogen enteroaggregative Escherichia coli (EAEC) is associated with growth faltering in children in developing settings. The mechanism of this association is unknown, emphasizing a need for better understanding of the interactions between EAEC and the ...
Purpose: Bacterial adhesion and colonization play a crucial function in the pathogenesis of peri-implant tissue infection, which is considered the main cause of fixture loss. The aim of this study is to evaluate the differences in bacterial adhesion between a machined titanium surface, a double acid etched surface (Osseotite®) and an Osseotite surface with Nanometer-scale Discrete Crystalline Deposition (DCD™) of calcium phosphate (CaP)(Nanotite®).Methods: Surface roughness properties of each sample were determined by a laser profilometer and scanning electron microscopy (SEM) observation. Bacterial adhesion on machined, Osseotite®, and Nanotite® discs were performed using the following bacterial strains: Streptococcus mutans CCUG 35176, Streptococcus sanguis CCUG 17826, Streptococcus salivarius CCUG 11878, Actinobacillus actinomycetecomitans CCUG 37002, Porphyromonas gingivalis CCUG 2521. The assessment of bacterial adhesion was performed by comparing two methods: Total Viable Count (TVC) ...
TY - JOUR. T1 - Examination of the effect of urine conditioning film on bacterial adherence and encrustation development on urinary biomaterials. AU - Hamill, T.M.. AU - Jones, David. AU - Gorman, Sean. AU - Gilmore, Brendan. PY - 2006. Y1 - 2006. M3 - Article. VL - 58. SP - A90-A90. JO - Journal of Pharmacy and Pharmacology. JF - Journal of Pharmacy and Pharmacology. SN - 0022-3573. ER - ...
An Escherichia coli strain (serotype O127a:H2) that had been isolated from a child with diarrhea in Thailand and that was negative for the virulence factors of the four categories of diarrheagenic E. coli (enterotoxigenic, enteropathogenic, enteroinvasive, and enterohemorrhagic) and that showed an aggregative pattern of adherence to HeLa cells was investigated for adherence to native or Formalin-fixed human and animal mucosa. The hemagglutinating activity and adherence ability of the bacteria were resistant to D-mannose and were strictly regulated by environmental conditions. Genetic data supported the close relation between the hemagglutinating activity and adherence ability. In accordance with the adherence pattern on tissue-cultured cells, the bacteria adhered to human and animal mucosa, as evidenced by a direct gold-labeling analysis. In human intestines, Formalin-fixed mucous coatings, epithelial cells of colonic mucosa, epithelial cells of ileal single lymphoid follicles and Peyers ...
Enteroaggregative Escherichia coli (EAEC) is a recognized cause of acute diarrhea among both children and adults worldwide. EAEC strains are characterized by the presence of aggregative adherence fimbriae (AAF), which play a key role in pathogenesis by mediating attachment to the intestinal mucosa and by triggering host inflammatory responses. The aggregative adherence fimbria II (AAF/II) is the most important adherence factor of EAEC prototype strain 042 (EAEC042) to intestinal cells. Multiple receptors for AAF/II on epithelial cells have been identified including the transmembrane signaling mucin Muc1. This protocol describes a method to measure adherence of EAEC strains to HEK293 cells expressing the Muc1 glycoprotein.
These studies support a central role for mucosally adherent bacteria in the pathogenesis of Crohns disease and colon cancer. Soluble plant fibers that inhibit their adherence have therapeutic potential.
Background and purpose: The aim of this study was to examine the influence of subminimal inhibitory concentrations (subMICs) of ceftazidime, ciprofloxacin and gentamicin on the adherence ability and morphology of wild-type Pseudomonas...
Many bacteria, both environmental and pathogenic, exhibit the property of autoaggregation. In autoaggregation (sometimes also called autoagglutination or flocculation), bacteria of the same type form multicellular clumps that eventually settle at the bottom of culture tubes. Autoaggregation is generally mediated by self-recognising surface structures, such as proteins and exopolysaccharides, which we term collectively as autoagglutinins. Although a widespread phenomenon, in most cases the function of autoaggregation is poorly understood, though there is evidence to show that aggregating bacteria are protected from environmental stresses or host responses. Autoaggregation is also often among the first steps in forming biofilms. Here, we review the current knowledge on autoaggregation, the role of autoaggregation in biofilm formation and pathogenesis, and molecular mechanisms leading to aggregation using specific examples ...
The adhesin involved in diffuse adherence (AIDA) is an autotransporter protein that confers the diffuse adherence phenotype to certain diarrheagenic Escherichia coli strains. It consists of a 49 amino acid signal peptide, a 797 amino acid passenger domain, and a 440 amino acid beta-domain integrated into the outer membrane. The beta-domain consists of two parts: the beta(1)-domain, which is predicted to form two beta-strands on the bacterial cell surface, and the beta(2)-domain, which constitutes the transmembrane domain. We have previously shown that the beta-domain can be folded from the urea-denatured state when bound to a nickel column during purification. It has not been possible to achieve proper refolding of the beta-domain in solution; instead, a misfolded state C is formed. Here, we characterize this misfolded state in greater detail, showing that despite being misfolded, C can be analyzed as a conventional conformational state, with cooperative unfolding in urea and SDS as well as ...
Structural studies of biological macromolecular assemblies are providing an understanding of cellular function. In our laboratory, we utilize electron microscopy and image reconstruction to investigate questions about how adhesion pili aid pathogenic bacterial survival under harsh physiological conditions. Work in the lab currently focuses on bacterial adhesion pili and poliovirus polymerase. These projects address basic medical research questions directed at understanding bacterial adhesion to human host tissue and viral replication. Our data support development of novel therapeutics targeting these important health issues including, for example, development of a vaccine against travelers diarrhea ...
Fingerprint Dive into the research topics of Inhibition of bacterial adhesion by subinhibitory concentrations of antibiotics. Together they form a unique fingerprint. ...
PhD Project - Molecular mechanisms modulating host epithelial integrity in response to bacterial adhesion at University of Birmingham, listed on FindAPhD.com
Working with a pathogenic strain of E. coli, the researchers found that the bacteria can sense attachment to the human intestinal cells and activate gene expression in response. This was demonstrated by engineering one of these genes to express a protein that stains the expressing bacteria to appear green under the microscope. Under microscopic examination, the researchers observed that only the attached bacteria fluoresce in bright green, whereas non-attached bacteria remain dark ...
Bacterial resistance to antibiotics is increasing at a high rate in both developing and developed countries. To circumvent the problem of drug-resistant bacterial pathogens, we need to develop new effective methods, substances, and materials that can disarm and prevent them from causing infections. However, to do this we first need to find new possible targets in bacteria to approach and novel strategies to apply.Escherichia coli (E. coli) bacteria is a normal member of the intestinal microflora of humans and mammals, but frequently cause diverse intestinal and external diseases by means of virulence factors, which leads to hundreds of million sick people each year with a high mortality rate. An E. coli bacterial infection starts with adhesion to a host cell using cell surface expressed adhesion polymers, called adhesion pili. Depending on the local environment different types of pili are expressed by the bacteria. For example, bacteria found in the gastrointestinal tract commonly express ...
Mannose, Apoptosis, Bacteria, Bacterial Adhesion, Bladder, Cell, Cells, Clathrin, Colitis, Contract, Crohns Disease, Cytoplasm, Diabetes Mellitus, Disease, E Coli, Endoplasmic Reticulum, Epithelial Cell, Epithelial Cells, Escherichia, Escherichia Coli
Fang B, Gon S, Park M, Kumar K-N, Rotello VM, Nusslein K, Santore MM. 2011. Bacterial adhesion on hybrid cationic nanoparticle-polymer brush surfaces: ionic strength tunes capture from monovalent to multivalent binding.. Colloids Surf B Biointerfaces. 87(1):109-15. ...
Biofilms are ubiquitous in aquatic environments. Biofilms have been shown to attract and harbor pathogens such as P. aeruginosa and Legionella pneumophila in premise plumbing system. The fact that biofilms can protect attached bacterial cells from disinfectants raises rudimentary questions regarding interactions of bacterial cells with biofilm surfaces. Consequently, the main objectives of this study were to: 1) investigate the mechanisms that govern E. coli S17, E. coli 14f and Legionella cells adhesion on clean PVC, copper and biofilms; 2) examine the role of disinfectants on biofilms structure and subsequent effect on bacterial adhesion. Mechanisms of three strains of bacteria attachment on biofilms grown on PVC and copper surfaces were investigated. Biofilms were grown in CDC reactors using different types of feed water such as groundwater, monochloramine-treated groundwater, dechlorinated tap water and tap water. Biofilm physical structure was characterized at micro- and meso-scales using ...
The global issue of nosocomial infection is owing to bacterial colonization and biofilm formation on medical devices which primarily affects critically ill and/or immuno-compromised patients and also leads to malfunctioning of the devices. Therefore, it is desirable to prevent bacterial colonization on these devices by coating with a non toxic antimicrobial agent or bacterial adherence inhibitor. Here we have shown Bacillus licheniformis JS2 derived selenium nanoparticles (SeNPs) inhibit Staphylococcus aureus adherence and micro-colony formation on polystyrene, glass, and catheter surface. Results indicated that, the coating of these non toxic biogenic SeNPs, at a concentration of 0.5mgSe/ml, prohibits bacterial load to more than 60% on glass and catheter surface, when incubated at 4°C for 24h in phosphate buffered saline. Furthermore, confocal and electron microscopic observations strongly suggested the inhibition of biofilm and micro-colony formation on SeNP coated glass and catheter surfaces ...
Adherence ability of Staphylococcus epidermidis on prosthetic biomaterials: an in vitro study [Corrigendum] Â Shida T, Koseki H, Yoda I, et al. Int J Nanomed. 2013;8(1):3955â 3961.On page 3955, please note that the first affiliation has changed from Department of Orthopedic Surgery, Graduate School of Medicine, Nagasaki University, Nagasaki, Japan to Department of Orthopedic Surgery, Nagasaki University Graduate School of Biomedical Sciences, Nagasaki, Japan.Read the original article
Ileal lesions in Crohns disease (CD) patients are colonized by pathogenic adherent-invasive Escherichia coli (AIEC) able to adhere to and invade intestinal epithelial cells (IEC), and to survive within macrophages. The interaction of AIEC with IEC depends on bacterial factors mainly type 1 pili, flagella, and outer membrane proteins. In humans, proteases can act as host defence mechanisms to counteract bacterial colonization. The protease meprin, composed of multimeric complexes of the two subunits alpha and beta, is abundantly expressed in IECs. Decreased levels of this protease correlate with the severity of the inflammation in patients with inflammatory bowel disease. The aim of the present study was to analyze the ability of meprin to modulate the interaction of AIEC with IECs. In patients with ileal CD we observed decreased levels of meprins, in particular that of meprin β. Dose-dependent inhibition of the abilities of AIEC strain LF82 to adhere to and invade intestinal epithelial T84 cells was
PubMed Central Canada (PMC Canada) provides free access to a stable and permanent online digital archive of full-text, peer-reviewed health and life sciences research publications. It builds on PubMed Central (PMC), the U.S. National Institutes of Health (NIH) free digital archive of biomedical and life sciences journal literature and is a member of the broader PMC International (PMCI) network of e-repositories.
Pappelbaum, Karin I.; Gorzelanny, Christian; Graessle, Sandra; Suckau, Jan; Laschke, Matthias W.; Bischoff, Markus; Bauer, Corinne; Schorpp-Kistner, Marina; Weidenmaier, Christopher; Schneppenheim, Reinhard; Obser, Tobias; Sinha, Bhanu; Schneider, Stefan W. ...
Bacterial biofilms are sessile microbial communities that cause serious problems, such as antibiotic resistant chronic infections in humans, and persistent biofouling of engineering facilities. Biofilm formation is initiated by bacterial adhesion to a surface followed by the formation of microcolonies and further development of heterogeneous structures with water channels between cell clusters. The mechanism of biofilm structural heterogeneity and the bacterial genes involve in structural organization are still poorly understood. Nevertheless, once microbes adhere to a surface and form biofilm on it, they are up to 10-1,000 times more resistant to antimicrobial agents than their free-swimming counterparts. It is well accepted that biofilm formation involves multicellular behaviors, associated with major changes in microbial gene expression and protein synthesis. These changes are influenced by many environmental factors such as surface hydrophobicity, topography, chemistry, and charge. To better
Structural studies of biological macromolecular assemblies are providing an understanding of cellular function. In our laboratory, we utilize electron microscopy and image reconstruction to investigate questions about microbial virulence.. Work in the lab currently focuses on bacterial adhesion pili (fimbriae), type III secretion system needles, and virus replication. These projects address basic medical research questions directed at understanding bacterial adhesion to human host tissue and viral replication. Our data support development of novel therapeutics targeting these important health issues including, for example, development of a vaccine against travelers diarrhea.. ...
In this paired case-control study of infants with diarrhea in São Paulo, we examined the association between HEp-2-adherent Escherichia coli strains and diarrhea. We tested isolates from stool specimens of infants with diarrhea and matched controls in an HEp-2 cell adherence assay; we then hybridized isolates with DNA probes and identified enteropathogenic E. coli (EPEC), enteroaggregative E. coli (EAEC), and diffusely adherent E. coli (DAEC). From 100 patient-control pairs, we isolated 78 HEp-2-adherent strains; of these, 61 strains were single pathogens identified in stools of infants with diarrhea. While typical EPEC was significantly associated with diarrhea ( ...
Attached versus free living.Our results, as well as some previous reports (1-3, 7, 13, 29, 30), indicated that the bacterial community in aquatic environments is, in terms of species composition, markedly different for cells associated with particles and those that are free living. The attached community shows amazingly little diversity, with most clones belonging to the γProteobacteria and highly similar to the cultivated marine bacterium A. macleodii IAM 12920T, a strain isolated in the 1970s from coastal waters near Oahu, Hawaii (6). The pelagic assemblage is dominated by a more heterogeneous population that varies with depth. Here the best matches correspond to uncultivated entries only known by sequence, as shown in many previous studies. Amorphous aggregates that appear in natural aquatic environments can have various origins, e.g., bacteria attached to zooplankton fecal pellets, bacteria attached to each other by polymers, or bacteria attached to animal debris, such as the cast houses of ...
Stinson, Murray W. and Jen Ren Wang (1997) Lectin inhibition of bacterial adhesion to animal cells. [Publication] Full text not available from this repository ...
BioFilm Pharma and BIOASTER (www.bioaster.org), the French Institute for Technological Research in Infectious Diseases and Microbiology, announced today the signature of a research contract.. To address the challenge of antibiotic resistance, this collaboration will lead to the deciphering of the mode of action of a new class of drugs.. This first project aims at identifying the mode of action of non-antibiotic anti-biofilms molecules through an integrated multi-omic analysis.. Anti-biofilm candidates of the study have already shown very promising results thanks to the BioFilm Ring Test® technology patented by the BioFilm Technologies group. As of today, this key technology is the only reliable and standardized in vitro biofilm method focusing on bacterial adhesion. Find more information on BIOASTER Press Release here.. ...
Search Indian Sodium Metaperiodate Manufacturers and Suppliers Details - Contact to Sodium Metaperiodate Exporters in India, Sodium Metaperiodate Wholesalers, Sodium Metaperiodate Distributors and Traders from India.
Get potassium metaperiodate at best price with product specifications. Listed potassium metaperiodate manufacturers, suppliers, dealers & exporters are offering best deals for potassium metaperiodate at your nearby location.
Much work on bacterial adhesion has focussed on the colonisation of surfaces and the removal of mature biofilms. Little attention has been devoted to interactions within mature biofilms and how these might be manipulated in the cause of novel therapies. Calcium binding to oral streptococci displays …
The mechanisms by which bacteria adhere to inert surfaces are not well understood. The aim of this work was to elucidate the structural and genetic changes induced in a classical E. coli K-12 strain by a mutation allowing surface colonization. Electron microscopy of negatively stained bacteria revealed the presence of thin fibrillar pili at the surfaces of the mutant cells (Fig. 6). These particular pili seemed to be identical to the Congo red-binding structures described by Olsén and coworkers (22) as curli. When grown on CFA-Congo red indicator plates, the mutant strains were more intensely stained, indicating curli overproduction. The curli subunits are encoded by the csgA gene (21). Insertion of a reporter cassette into this gene revealed a 3.5-fold-higher transcription in the presence of the mutation responsible for the adherent phenotype. Furthermore, the introduction of a csgAnull mutation totally suppressed the biofilm-forming properties (Fig.2), demonstrating that curli production is ...
casSAR Dugability of Q2FUY2 | clfB | Clumping factor B - Also known as CLFB_STAA8, clfB. Cell surface-associated protein implicated in virulence by promoting bacterial attachment to both alpha- and beta-chains of human fibrinogen and inducing the formation of bacterial clumps. Partly responsible for mediating bacterial attachment to the highly keratinized squamous epithelial cells from the nasal cavity via an interaction with cytokeratin K10 (K10). Also promotes bacterial attachment to cultured keratinocytes, possibly through an interaction with cytokeratin K10. Binds mouse cytokeratin K10. Activates human platelet aggregation.
Microtiter plate-based bacterial biofilm assay is frequently used to study bacterial biofilm development and growth. While this assay is simple and relatively high-throughput, it frequently shows difficulty in establishing robust biofilm attachment in the wells. We report that the consistency of bacterial biofilm a
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
es found that the beads and the bacterial aggregates collided up to a ... The Penn State engineer explains that the fact that large aggregates...Now using the new approach developed by Logan researchers not only ...In addition in studying the ocean processes Logan has identified a ......,Faster,coagulation,rates,found,in,natural,systems,could,impact,industrial,processing,biological,biology news articles,biology news today,latest biology news,current biology news,biology newsletters
Supplementary Materialsmicroorganisms-08-00221-s001. owes its PTC124 cost virulence to its capability to type solid biofilms on oral areas [8]. The bacterial adhesion to the top, which relates to its cariogenic activity extremely, is certainly mediated by the formation of extracellular polysaccharides (EPS) with the extracellular enzymes glucosyltransferase (GTF) and fructosyltransferase (FTF) [9,10]. Deposition of and various other dental bacterias being a biofilm may be the total consequence of the bacterias self-adhesion systems, nonetheless it is highly reliant on dietary components [6] also. Furthermore, towards the gain access to of nutrition therefore, organic acids are generated with the bacterial fermentation, which bring about the acidification of the surroundings and provide a primary risk for the teeth enamel integrity [11]. Hence, caries would depend on eating elements extremely, that may influence bacterial biofilm and adhesion formation [6]. Previous research indicated the ...
Thank you for your interest in spreading the word about Biochemical Society Transactions.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address.. ...
Spi-Ceramic coatings are highly adherent nanocrystalline thin films deposited using N2 Biomedicals low temperature ion beam assisted deposition process. Al
Methods for treating patients in which damaged tissue or an indwelling prosthetic device or catheter has a bacterial biofilm growing thereon, to at least partially disrupt said biofilm, by administering at least one antibacterial enzyme that is lethal or damaging to the biofilm-forming bacteria in an amount that is effective to at least partially disrupt the biofilm upon contact therewith. Methods for prophylactically treating a patient, and methods for disinfecting or sterilizing a surface ex-vivo to remove a biofilm or prevent biofilm growth are also disclosed, as well as implantable articles susceptible to biofilm growth to which a prophylactic coating of an antibacterial enzyme has been applied.
How to treat HEK293 with S9 fraction? - posted in Tissue and Cell Culture: Hi, everyone In my experiment, i need to treat HEK293 cells with drug including S9 fraction. In the protocol of S9. The medium including S9 have to remove and wash with PBS after treating in 4 hours. But the adhesion ability of HEK293 cells are very week. The cells will be lost if i wash them. What can i do to improve it? Thanks a lot.
W]hile many behavioral traits have a heritable component, its not anything like what the naive extremists among the cognitive science crowd think. There are no genes that specify what you will name your dog [WTF? -ed]- in fact, most of the genes associated with the brain have very wide patterns of expression and functions that are not neatly tied to behaviors: how does an allele of an adhesion factor map to your performance on a math test? It doesnt, not directly. ...
Viral surface protein implicated in the binding to specific host surface molecule(s). This binding can lead to virion entry into the host cell, it can trigger signaling pathways, or it can allow the virion to be carried by the host cell to a specific organ ...
A community-based life style is the normal mode of growth and survival for many bacterial species. These cellular accretions or biofilms are initiated upon reco
whats a Eucaryotic cell?http://library.thinkquest.org/C004535/eukaryotic_cells.html. thanx, you guys are awesome!!. Any time!. eucaryote= no nucleu...
Methicillin resistant Staphylococcus aureus adhesion to human umbilical vein endothelial cells demonstrates wall shear stress dependent ...
The O26 serogroup of enteropathogenic Escherichia coli (EPEC) is one of the serogroups most frequently implicated in infant diarrhea and is also common among enterohemorrhagic E. coli (EHEC) strains. the most common O26 strains belong to EPEC/EHEC serotype O26:H11 and are generally Shiga toxin (Stx) positive. Stx-negative E. coli strains that are negative for the EPEC EAF plasmid and bundle-forming pilus (Bfp) are classified as atypical EPEC. Here, we report a novel adhesin present in an stx-negative bfpA-negative atypical EPEC O26:H11 strain isolated from an infant with diarrhea. A cloned 15-kb genomic region from this strain, designated the locus for diffuse adherence (lda), confers diffuse adherence on HEp-2 cells when expressed in E. coli K-12. Sequence analysis of lda revealed a G+C content of 46.8% and 15 open reading frames sharing homology with the E. coli K88 fae and CS31A clp fimbrial operons. the lda region is part of a putative 26-kb genomic island inserted into the proP gene of the ...
Enteroaggregative Escherichia coli is a major cause of diarrhea in diverse populations worldwide. EAEC has a characteristic stacked-brick adherence pattern to intestinal epithelial cells which is mediated the aggregative adherence fimbria (AAF). The AraC-like regulator AggR has been found to regulate expression of the genes encoding the AAF and several other virulence associated genes. Multiple epidemiologic studies have found an association between possession of aggR and EAEC disease. However, the exact factor(s) responsible for diarrheal disease remain unclear. A microarray approach was used to identify AggR-regulated genes in EAEC strain 042. Nineteen previously unrecognized genes were found to be regulated by AggR. Three of these genes were chosen for further study based on a high prevalence in an EAEC strain collection. Two of the genes (orf3 and orf4) were found to cause an increase in resistance to cationic antimicrobial peptides. The third (orf61) is a novel membrane damaging toxin ...
Enteropathogenic Escherichia coli (EPEC) strains possess genes for attaching and effacing (eae) and EPEC adherence factor (EAF) plasmid. It is necessary to develop molecular techniques for the evaluation of EPEC isolates. A total of 183 E. coli isolates from neonates admitted to Pusan National University Hospital were investigated by polymerase chain reaction (PCR) and DNA colony hybridization. Of the 183 isolates tested, 10 (5.5%) were positive for eae by PCR and DNA colony hybridization and confirmed to be EPEC. Ten EPEC isolates showed 3 different adherence patterns: seven strains had diffuse adherence, two localized adherence-like adherence, and one aggregative adherence. They were also examined by antimicrobial susceptibility tests, serotyping, and molecular epidemiological typing such as pulsed field gel electrophoresis (PFGE) and random amplified polymorphic DNA (RAPD) analysis. The EPEC isolates could be divided into 9 different antimicrobial resistance patterns, 6 serotypes, 4 PFGE ...
Numerous studies have demonstrated the effects of laser-induced heat on demineralization of enamel; however, no studies have investigated the link between heat/laser-induced changes in physicochemical properties and bacterial adhesion. In this study, we investigated the effects of thermal treatment on surface properties of enamel such as hydrophobicity and zeta potential. Bacterial adhesion to treated surfaces was characterized by confocal laser scanning microscopy, and adhesion force was quantified by atomic force microscopy. The hydrophobicity of enamel increased after heating (p < 0.05), and the zeta potential of heated enamel became more negative than that of the control (p < 0.01). Streptococcus oralis and S. mitis were more hydrophilic than S. sanguis, with more negative zeta potential (all p < 0.01). S. mitis and S. oralis occupied significantly less area on enamel after being heated (p < 0.05). Heating reduced the adhesion force of both S. mitis and S. oralis to enamel with ...
View Stock Photo of Branhamella Catarrhalis Bacteria Bound To The Surface Of A Human Red Blood Cell Sem X9401. Find premium, high-resolution photos at Getty Images.
TY - JOUR. T1 - Quantification of Staphylococcus aureus cell surface adhesins using flow cytometry. AU - Mohamed, Nehal. AU - Visai, Livia. AU - Speziale, Pietro. AU - Ross, Julia M.. PY - 2000. Y1 - 2000. N2 - The initiation of many infectious diseases involves specific adhesion of bacteria to host tissue proteins and carbohydrates. Staphylococcus aureus is known to bind specifically to several proteins in the extracellular matrix (ECM). We report the quantification of the collagen and fibronectin adhesin densities on the staphylococcal surface using flow cytometry. Our results are in agreement with previous reports on the transcription of the respective genes and demonstrate different patterns of temporal expression for the two adhesins in the strains studied. We demonstrate a convenient technique for quantification of bacterial adhesins that can be used in studies aimed at characterization of bacterial adhesion to ECM components and understanding expression of adhesins during the course of an ...
Definition : Solutions designed to act as a temporary barrier inhibiting postsurgical adhesion between tissues and organs. These solutions are applied to the surface of tissues and organs at the end of surgery, before surgical closure, and are typically resorbed by the body in a short period (e.g., several days). Postsurgical adhesion inhibition solutions are intended for use in pelvic and gynecological surgery, both in open and laparoscopic procedures.. Related Terms : Films, Postsurgical Adhesion Inhibition , Gel, Postsurgical Adhesion Inhibition. Entry Terms : Surgical Adhesion Barrier Solutions , Adhesion Inhibition Solutions , Adhesion Barrier Solutions , Scarring Inhibitors , Postsurgical Scarring Inhibitors , Barriers, Adhesion, Resorbable. UMDC code : 20374 ...
Debate regarding the co-existence of Staphylococcus aureus and Pseudomonas aeruginosa in wounds remains contentious, with the dominant hypothesis describing a situation akin to niche partitioning, whereby both microorganisms are present but occupy distinct regions of the wound without interacting. In contrast, we hypothesised that these microorganisms do interact during early co-colonisation in a manner beneficial to both bacteria. We assessed competitive interaction between S. aureus and P. aeruginosa in biofilm cultured for 24-72 h and bacterial aggregates analogous to those observed in early (,24h) biofilm formation, and interaction with human keratinocytes. We observed that S. aureus predominated in biofilm and non-attached bacterial aggregates, acting as a pioneer for the attachment of P. aeruginosa. We report for the first time that S. aureus mediates a significant (P,0.05) increase in the attachment of P. aeruginosa to human keratinocytes, and that P. aeruginosa promotes an invasive ...
J. Saunier, J.M. Herry, C. Marliere, M. Renault, M.-N. Bellon-Fontaine, et al.. Modification of the bacterial adhesion of Staphylococcus aureus by antioxidant blooming on polyurethane films. Materials Science & Engineering. C, Materials for Biological Applications, 2015, 56, pp.522-531. 〈hal-01569038〉 ...
In natural environments, bacteria are often found as sessile communities known as biofilms (8, 10). To date, the bacterial structures of adherence (25, 40-42, 56) and the physiological processes involved in bacterial surface colonization (15, 40, 41) are better understood than the genetic responses of bacteria adhering to a surface. By using a library oflacZ fusions and a reliable screen for identifying genes whose expression changes in biofilm versus planktonic cells, the transcription of 38% of the E. coli genes was shown to be modified during the colonization process. Several genes with altered expression in biofilms were identified. Different cellular functions were induced in attached bacteria: the OmpC porin, the high-affinity transport system of glycine betaine, colanic acid production (theE. coli class I exopolysaccharide), tripeptidase T, and synthesis of a nickel high-affinity transport system. On the other hand, the syntheses of flagella and of a putative protein of 92 amino acids ...
Background Diarrhoea due to can be an important reason behind baby mortality and morbidity in developing countries. dairy, lf and fSC could actually inhibit the adhesion of EPEC. -lactalbumin was isolated, but demonstrated no activity on EPEC UNC-1999 supplier adhesion. Conclusions This scholarly research confirmed the fact that immunoglobulin small percentage, the free secretory lactoferrin and element of human milk inhibit EPEC adhesion to HeLa UNC-1999 supplier cells. These outcomes indicate that fSC and Lf may be important non-specific defence factors against EPEC infections. Background Enteropathogenic (EPEC) strains comprise one of the various categories of diarrhoeagenic and are the leading aetiological agent of infant acute diarrhoea in Brazil [1,2]. Contamination by EPEC entails initial adherence of the bacteria to the intestinal epithelial cells via bundle-forming pilus (BFP), and subsequent intimate contact mediated by an outer membrane protein, intimin. This process leads to the ...
Methods of inhibiting bacterial adhesion to medical implants and reducing device-associated infection are effectuated by administering an effective amount of apo-transferrin to an individual with such an implant. Preferably the apo-transferrin is administered by controlled release at or near the implant.
The Scientific World Journal is a peer-reviewed, Open Access journal that publishes original research, reviews, and clinical studies covering a wide range of subjects in science, technology, and medicine. The journal is divided into 81 subject areas.
Streptococcus pneumoniae (pneumococci) are Gram-positive cocci and commensals of the human upper respiratory tract. Pneumococcal pathogenesis requires adherence to host cells and dissemination through cellular barriers and to evade host defense mechanisms. The Pneumococcal surface protein C (PspC) is an important virulence factor which has a crucial role in pneumococcal adhesion to host cells and immune evasion by manipulating the host complement system. To elucidate the pneumococcal adherence and uptake mechanism via factor H glycosaminoglycans (dermatan sulfate and heparin) were employed as competitive inhibitors in infection experiments with epithelial cells or human polymorphonuclear leukocytes (PMNs). Glycosaminoglycans significantly inhibited the FH mediated pneumococcal adherence and subsequent invasion to host epithelial cells. Furthermore, the short consensus repeats of FH which promotes the adhesion of pneumococci to host cells were identified by blocking experiments with domain mapped
Streptococcus pneumoniae (pneumococci) are Gram-positive cocci and commensals of the human upper respiratory tract. Pneumococcal pathogenesis requires adherence to host cells and dissemination through cellular barriers and to evade host defense mechanisms. The Pneumococcal surface protein C (PspC) is an important virulence factor which has a crucial role in pneumococcal adhesion to host cells and immune evasion by manipulating the host complement system. To elucidate the pneumococcal adherence and uptake mechanism via factor H glycosaminoglycans (dermatan sulfate and heparin) were employed as competitive inhibitors in infection experiments with epithelial cells or human polymorphonuclear leukocytes (PMNs). Glycosaminoglycans significantly inhibited the FH mediated pneumococcal adherence and subsequent invasion to host epithelial cells. Furthermore, the short consensus repeats of FH which promotes the adhesion of pneumococci to host cells were identified by blocking experiments with domain mapped
Bacterial adherence to host epithelial cells is proposed to be critical for chicken colonization, as cell attachment may prevent clearance of the bacteria via host-mediated mechanical force. The goal of this study was to assess the conservation of the putative C. jejuni adhesin-encoding genes cadF, capA, jlpA, peb1A, porA, Cj1279c (flpA), and Cj1349c and the contribution of the corresponding proteins in C. jejuni host cell interactions. In this study, we found that the cadF, jlpA, porA, peb1A, flpA, and Cj1349c genes were conserved among the isolates, whereas the presence of the capA gene was variable. We found that the C. jejuni CadF, CapA, FlpA, and Cj1349c proteins contribute to the bacteriums in vitro adherence to chicken LMH hepatocellular carcinoma epithelial cells, while CadF, PEB1, and FlpA contribute to the bacteriums in vivo colonization of broiler chicks. This is the first study to show that FlpA promotes the binding of C. jejuni to host cells and plays a role in C. jejuni ...
Adherence of M. pneumoniae to a host cell (usually a respiratory tract cell, but occasionally an erythrocyte or urogenital lining cell) is the initiating event for pneumonic disease and related symptoms. The specialized attachment organelle is a polar, electron dense and elongated cell extension that facilitates motility and cytadherence to host cells. It is composed of a central filament surrounded by an intracytoplasmic space, along with a number of adhesins and structural and accessory proteins localized at the tip of the organelle. A variety of proteins are known to contribute to the formation and functionality of the attachment organelle, including the accessory proteins HMW1â HMW5, P30, P56, and P90 that confer structure and adhesin support, and P1, P30 and P116 which are involved directly in attachment. This network of proteins participates not only in the initiation of attachment organelle formation and adhesion but also in motility. The P1 adhesin (trypsin-sensitive protein) is a 120 ...
Large externalized, repeat-rich proteins are emerging as important factors in the attachment of bacteria to biotic and abiotic surfaces. An intriguing new study of the plant-associated terrestrial microbe Pseudomonas putida by Manuel Espinosa-Urgels group that is reported in this issue of Molecular Microbiology has revealed that LapF, a huge protein (, 6000 aa) associated with the cell surface, is required for microcolony assembly from single attached cells, and in turn, formation of biofilms. Mutants defective in IapF exhibit competitive deficiencies in the rhizosphere. On both biotic and abiotic surfaces, these mutants undergo normal irreversible attachment, but cannot advance beyond this point to form multicellular clusters. The lapF phenotype is nutritionally conditional and is only manifested under a subset of growth regimes. Accordingly, lapF gene expression is controlled by the stress-responsive sigma factor RpoS and is elevated within growing microcolonies on abiotic surfaces and plant ...
Bacterial adhesins promote colonization at the initial stages of an infection by mediating attachment to host tissues, thus avoiding nonspecific host defenses such as mechanical clearance and allowing bacterial multiplication to occur within the host (1). To exert these functions, adhesins need to be presented at the surface of the bacterium. Like typical adhesins, B. pertussis FHA attaches the bacterium to receptors in the respiratory tract (17-21, 28). However, in addition to being surface-associated, large amounts of FHA are also released into the extracellular milieu (15). This has so far only been observed in vitro. In this work, we show for the first time that FHA is likely to also be released in vivo, and that its secretion is necessary for efficient colonization in a mouse model of infection. Our results support the paradigm that the secreted form of bacterial adhesins may participate in pathogenesis.. The use of B. pertussis strains deficient in FHA release but presenting FHA ...
Abstract Expression of the platelet-activating factor receptor is upregulated in the respiratory epithelium of smokers and chronic obstructive pulmonary disease patients. We have recently determined that increased expression of PAFr cor - relates with higher levels of adhesion to human bronchial epithelial cells by non-typable Haemophilus influenzae and Streptococcus pneumoniae which are major bacterial pathogens in acute exacerbations of COPD. In addition, we found that a PAFr antagonist decreased the adhesion of both respiratory bacterial pathogens to non-cigarette exposure con - trol levels. This highlights the possibility that epithelial receptors, that are upregulated in response to cigarette smoke, could be targeted to specifically block chronic bacterial infections of the lower respiratory tract. In this commentary, we explore the question of whether adhesion to a temporally-upregulated host receptor is a common event in chronic bacterial disease, and as such, could represent a putative ...
Biofilm Growth - Pseudomonas aeruginosa. Rocks in a stream bed are often slippery due to the growth of a mixed population of attached bacteria, algae and fungi. These Pseudomonas aeruginosa (bacteria) are shown growing on the surface of a fiber and forming a single species biofilm. - Stock Video Clip K003/2837
Infections by biofilm forming bacteria continue to be a major health challenge costing an estimated additional $11 billion in health care costs in the USA annually. Bacterial biofilms consist of surface attached bacteria encased in an extracellular polymeric substance (EPS) composed of exported polysaccharides, proteins and extracellular DNA that facilitates both cell-cell and cell-surface attachment, and serves as a protective barrier for the encased cells. The breakdown of biofilm EPS components using enzyme bio-catalysts has emerged as a promising strategy to disrupt and treat biofilms. One of the most common biofilm exopolysaccharides consists of partially de-N-acetylated b-(1®6)-poly-N-acetylglucosamine (dPNAG) and is found in the EPS of both gram-positive and gram-negative human pathogens, including Staphylococcus epidermidis and Staphylococcus aureus. There are two enzymes that specifically hydrolyze dPNAG known, and relatively little information about the specific interactions required ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Wounds are known to serve as portals of entry for group A Streptococcus (GAS). Subsequent tissue colonization is mediated by interactions between GAS surface proteins and host extracellular matrix components. We recently reported that the streptococcal collagen-like protein-1, Scl1, selectively binds the cellular form of fibronectin (cFn) and also contributes to GAS biofilm formation on abiotic su
Invasin and intimin are major virulence factors of enteropathogenic Yersiniae and Escherichia coli, mediating invasion into and intimate adherence to host cells, respectively. Several studies have hinted that extracellular portion of these homologous proteins might be exported via an autotransport mechanism, but rigorous experimental proof has been lacking. Here, we present a topology model for invasin and intimin, consistent with the hypothesis that the N-terminal β-barrel domain acts as a translocation pore to secrete the C-terminal passenger domain. We confirmed this topology model by inserting epitope tags into the loops of the β-barrel. We further show that obstructing the pore of β-barrel hinders the export of the passenger domain. As for classical autotransport, the biogenesis of invasin and intimin is dependent on the Bam complex and the periplasmic chaperone SurA, whereas the chaperone/protease DegP is involved in quality control. However, compared to classical autotransporters (Type Va
The aim of this in-vitro study was to investigate the influence of fillers in resin composites on the initial bacterial adhesion. For this investigation the strains of S. mutans and S. sanguinis ere used. Additionally, the influence of a pellicle, the inhibitor BHT and silane-treatment of the filler on the bacterial adhesion were examined. The adhesion of the two strains S. mutans and S. sanguinis was also compared. The 13 tested materials were experimental composites, based on the same monomer matrix. One of the composites was without fillers (Grundmasse). The other twelve composites showed a filler-weight fraction of 30%. Two different materials of fillers were used (SiO2, Ba-Al-B-Silikat) with different specific surfaces (0,6 to 150 m2/g). Two materials (K6 0% BHT, K6 1% BHT) differed in silane-treatment of the fillers (silane-treated or not silane-treated). For six composites (Ox 50, R709, DT4, GK 0,7 UF silane-treated, K6 silane-treated, K6 not silane-treated) there was a difference in the ...
Close The Infona portal uses cookies, i.e. strings of text saved by a browser on the users device. The portal can access those files and use them to remember the users data, such as their chosen settings (screen view, interface language, etc.), or their login data. By using the Infona portal the user accepts automatic saving and using this information for portal operation purposes. More information on the subject can be found in the Privacy Policy and Terms of Service. By closing this window the user confirms that they have read the information on cookie usage, and they accept the privacy policy and the way cookies are used by the portal. You can change the cookie settings in your browser. ...
Phys.org internet news portal provides the latest news on science including: Physics, Space Science, Earth Science, Health and Medicine
Facial mask pack for anti-wrinkle made by Bio-cellulose. Bio-cellulose is made by fermenting coconut juice with a microorganism, and it has excellent adherence ability and delivery ability for solutions. Also, since it has a cooling effect, it would be very good addtion for your catalog and your customers. Separetely from this, since we are handling... Learn More ...
Calculate cost per different volumes and weights of Potassium metaperiodate. Materials, substances and compounds price conversions and cost calculator
Research groupsCell biology and Biotechnology Mechanisms of gene regulation and bacterial biofilm development Dr Fernando Govantes. ..
Long-acting ART has the potential to improve survival of HIV patients, especially those with barriers to adherence, the investigators concluded. With a high cost, long-acting ART will be a good value when used selectively in poorly-adherent patients with multiple failures. With a cost near that of currently available regimens, long-acting ART could be cost-effective as second-line therapy.. The researchers stressed that because survival benefits of long-acting ART could be negligible for highly adherent patient groups, studies of this strategy may underestimate its value if they do not include individuals with barriers to adherence.. They also noted that this model did not incorporate the potential effect of long-acting ART on reducing the risk of HIV transmission, which would likely improve its value. Some experts have suggested that long-acting antiretrovirals may be ideal for pre-exposure prophylaxis, or PrEP, which depends on excellent adherence.. The historical 85% cost increase for ...
H-Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val-OH or H-FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV- ...
Biofilm formation - posted in Microbiology: Hello to forum members, I have 2 questions and your input is greatly appreciated. 1- What is the best way to grow bacterial biofilm on a plate and food? I am doing some reading on that and have not been able yet to tell the best way. Any one worked in biofilm??? Thx in advance!
Encounters with Epithelial Cells Over the past decade, many bacterial pathogens have been shown to enter epithelial cells (Fig. 114-2); the bacteria often use specialized surface structures that bind to receptors, with consequent internalization. However, the exact role and the importance of this process in infection and disease are not well defined for most of these pathogens. Bacterial entry into host epithelial cells is seen as a means for dissemination to adjacent or deeper tissues or as a route to sanctuary to avoid ingestion and killing by professional phagocytes. ...
Define adhesin: any of various specialized molecular components (such as proteins) on the surface of a bacterial cell that… - adhesin in a sentence
NBIC are hosting a third workshop, on Biofilm Management, after the success of previous workshops on Biofilm Detection and Biofilm Engineering, to explore challenges, opportunities and advances in Biofilm Management.
Spontaneous bacterial colonization by CONS in Mgb-/- females versus Mgb+/- and WT controls.Bacteria recovered from urine (CFU/ml), bladders, and kidneys (CFU/or
Buy the ADJ O-Clamp 1 for 1 Truss at Full Compass. ADJs O-Clamp 1 is a 360° wrap-around tube truss clamp that securely mounts fixtures to truss. This particular unit is designed to fit 1 Truss when using the supplied adapter, and is non-s
... mucin adhesion blocks bacterial adhesion on surfaces. Consequently, the risk of bacterial attachment and infection is reduced. ... Due to the adsorption of BSM, the hydrophobicity of the surface decreases as well as the incidence of bacterial adhesion. Drug ... Just like the application above, the PAA polymer improved the adsorption of BSM on its surface to prevent bacterial adhesion ... While bacterial infections are common concerns in the medical, dental, and food industries, they are the primary cause of ...
Bacterial adhesion force quantification by fluidic force microscopy. (2015) Nanoscale, 7 (9), 4070 - 4079. doi:10.1039/ ... By measuring the adhesion of single cells, important information for different topics in biology and materialscience can be ... With FluidFM it is possible to increase the rate in which these experiments can be performed, and even to assess the adhesion ... By raising the probe, the force of the adhesion can be measured with pN resolution. The method to perform a single bacteria ...
Bacterial adhesion is particularly important for oral bacteria. Oral bacteria have evolved mechanisms to sense their ... However, a highly efficient innate host defense system constantly monitors the bacterial colonization and prevents bacterial ... In equilibrium, the bacterial biofilm produced by the fermentation of sugar in the mouth is quickly swept away by the saliva, ... Most of the bacterial species found in the mouth belong to microbial communities, called biofilms, a feature of which is inter- ...
Besides bacterial adhesion and cleaning, micro and nano pollutants (biological and manmade) is an area of contact lens research ... "Bacterial Adhesion to Worn Silicone Hydrogel Contact Lenses". Optometry and Vision Science. 85 (7): 520-525. doi:10.1097/OPX. ... "Bacterial adhesion to conventional hydrogel and new silicone hydrogel contact lens materials". Graefes Arch Clin Exp Ophthalmol ... Bacterial keratitis and conjunctivitis. In: Smolin G, Thoft RA, editors. The Cornea. Scientific Foundations and Clinical ...
Thomas WE, Trintchina E, Forero M, Vogel V, Sokurenko EV (June 2002). "Bacterial adhesion to target cells enhanced by shear ... Leukocyte adhesion deficiency[edit]. Main article: Leukocyte adhesion deficiency. Leukocyte adhesion deficiency (LAD) is a ... Thomas WE, Trintchina E, Forero M, Vogel V, Sokurenko EV (June 2002). "Bacterial adhesion to target cells enhanced by shear ... Tight adhesion[edit]. At the same time, chemokines released by macrophages activate the rolling leukocytes and cause surface ...
Fasciclin I is an insect neural cell adhesion molecule involved in axonal guidance that is attached to the membrane by a GPI- ... Bacterial immunogenic protein MPT70 (1 FAS1 domain). The FAS1 domains of both human periostin and BIgH3 proteins were found to ... Kim JE, Kim SJ, Lee BH, Park RW, Kim KS, Kim IS (October 2000). "Identification of motifs for cell adhesion within the repeated ... Fasciclin 2 Huber O, Sumper M (September 1994). "Algal-CAMs: isoforms of a cell adhesion molecule in embryos of the alga Volvox ...
Mignot, T.; Shaevitz, J.; Hartzell, P.; Zusman, D. (2007). "Evidence that focal adhesion complexes power bacterial gliding ... Bacterial gliding is a type of gliding motility that can also use pili for propulsion. The speed of gliding varies between ... Bacterial gliding is a process of motility whereby a bacterium can move under its own power. Generally, the process occurs ... "Focal adhesion complexes" and "treadmilling" of surface adhesins distributed along the cell body. The gliding motility of ...
"Evidence that focal adhesion complexes power bacterial gliding motility". Science. 315 (5813): 853-856. Bibcode:2007Sci...315.. ... He is known for his work in single-molecule biophysics, bacterial growth and motility, and animal behavior. Shaevitz completed ... His group also studies bacterial cell mechanics, including bending rigidity, turgor pressure and cell wall stiffness, and ... "The bacterial actin MreB rotates, and rotation depends on cell-wall assembly". Proceedings of the National Academy of Sciences ...
These glycoproteins include proline-rich proteins that allow bacterial adhesion. Pellicle somewhat protects enamel, but not to ... The surface of enamel and dentin attracts salivary glycoproteins and bacterial products creating the pellicle layer. This thin ...
The bacterial adhesion reduction is reached by Met I ad concentration similar to the plasmatic peak obtained after a single 300 ... Antiadhesive activity Erdosteine is able to interfere with bacterial adhesion. In fact, Met I can affect the integrity of the ... Erdosteine showed in vivo and in vitro synergistic activity with antibiotics, against bacterial adhesiveness, in patients with ... the opening of this bond can induce a morphological change that interferes with the binding of bacterial adhesin (fimbriae) to ...
Because of their antimicrobial activity, thiolated polymers are also used as coatings that avoid bacterial adhesion. Thiomers ... "N-acetylcysteine-functionalized coating avoids bacterial adhesion and biofilm formation". Sci. Rep. 7 (1): 17374. Bibcode: ... Interaction with a bacterial membrane model". React. Funct. Polym. 73 (10): 1384-1390. doi:10.1016/j.reactfunctpolym.2013.01. ...
"A-type cranberry proanthocyanidins and uropathogenic bacterial anti-adhesion activity". Phytochemistry. 66 (18): 2281-91. doi: ... In vitro, A-type proanthocyanidins isolated from cranberry juice cocktail demonstrated anti-adhesion activity against E. coli ... and reduction of the risk of urinary tract infection by inhibiting the adhesion of certain bacteria in the urinary tract ...
1994). "CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the ... The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. ... Carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) also known as CD66d (Cluster of Differentiation 66d), is a ... "Entrez Gene: CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3". CEACAM3: an innate immune receptor directed ...
In the next 24 hours, this layer allows the process of bacterial adhesion to occur, with both diatoms and bacteria (e.g. vibrio ... 2001), "Hydrophobicity in Bacterial Adhesion", Biofilm community interactions: chance or necessity? (PDF), BioLine, ISBN 978- ... Biofouling is divided into microfouling - biofilm formation and bacterial adhesion - and macrofouling - attachment of larger ... demonstrate a high correlation between their resistance to bacterial adhesion and their hydrophobicity. A study of the ...
"Bacterial Adhesion to Worn Silicone Hydrogel Contact Lenses". Optometry and Vision Science. 85 (7): 520-525. doi:10.1097/OPX. ... "Bacterial adhesion to conventional hydrogel and new silicone hydrogel contact lens materials". Graefes Arch Clin Exp Ophthalmol ... and octyl glucoside used as a lens surfactant significantly decreases bacterial adhesion.[98] These compounds are of particular ... Bacterial keratitis and conjunctivitis. In: Smolin G, Thoft RA, editors. The Cornea. Scientific Foundations and Clinical ...
YadA bacterial adhesin protein domain Type V secretion system Virulence factor Cell adhesion Outer membrane Gram negative ... they are a complex that aids adhesion to the ECM. Secretion is one method of transferring substances across the bacterial outer ... Bacteria use TAAs in order to infect their host cells via a process called cell adhesion. TAAs also go by another name, ... Function: Their role is to act as spacers by moving the head domains away from the bacterial cell surface and toward the ...
Simulation of bacterial attraction and adhesion to falling particles in an aquatic environment. Limnol. Oceanogr. 34: 514-530. ... In 2003, a new bacterial species was discovered that swim sideways and respond to differences in oxygen concentration at the ... The gradient-sensing mechanism in bacterial chemotaxis. Proc. Natl. Acad. Sci. U.S.A. 69: 2509 -2512. Adler, J. 1975. ... Mathematical modeling and quantitative characterization of bacterial motility and chemotaxis. In Modeling the Metabolic and ...
... and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a ...
Studies are under way to characterize the bacterial isolates from the outbreak in detail. Physicians around the world should be ... The bacteria contain an adhesion protein for the carbohydrate sequence Gal-1,4Gal. After incubation with various amounts of the ... Detection of the zoonotic bacterial pathogen Streptococcus suis was achieved using magnetic glycoparticles. ... pathogen, magnetic concentration and ATP detection, bacterial levels down to 10^5 cfu could be detected. Sriskandan S, Slater ...
Lpp induces adhesion of neutrophils to human endothelial cells by activating the latter. Seltmann, Guntram; Holst, Otto (2002 ... Silhavy TJ, Kahne D, Walker S (2010). "The bacterial cell envelope". Cold Spring Harbor Perspectives in Biology. 2 (5): a000414 ... Kovacs-Simon A, Titball RW, Michell SL (2011). "Lipoproteins of bacterial pathogens". Infection and Immunity. 79 (2): 548-61. ... The Bacterial Cell Wall. Berlin: Springer. pp. 81-82. ISBN 3-540-42608-6. Dramsi S, Magnet S, Davison S, Arthur M (2008). " ...
These surface/adhesion proteins mediate the initial attachment of bacteria to host tissues. These proteins are covalently ... Sortases are membrane anchored enzyme that sort these surface proteins onto the bacterial cell surface and anchor them to the ... inhibition of sortases may offer a novel strategy against gram-positive bacterial infections. SrtB in particular has gained ... linked to the peptidoglycan of the bacterial cell wall. As more and more pathogens become resistant to antibiotics, ...
Adhesin molecule (immunoglobulin -like) Bacterial adhesin Cell adhesion de Groot, Piet W. J.; Bader, Oliver; de Boer, Albert D ... Adhesion to tissue is an obligatory first step in pathogenesis by many yeasts. Adhesins also have other functions, such as ...
These vesicles were suspected to promote bacterial adhesion to the host epithelial cell surface. Their role in invasion of ... In the prokaryotic gram-negative bacterial cells, membrane vesicle trafficking is mediated via bacterial outer membrane bounded ... In inter-bacterial interactions, OMVs released by Pseudomonas aeruginosa microbes were shown to fuse with outer membrane of ... Bacterial outer membrane vesicles Endocytosis Exocytosis Host-pathogen interaction Secretory pathway Vesicle (Biology and ...
Bacterial adhesion to boat hulls serves as the foundation for biofouling of seagoing vessels. Once a film of bacteria forms, it ... "Building Codes for Bacterial Cities , Quanta Magazine". Quanta Magazine. Retrieved 2017-07-25. Lear G, Lewis GD, eds. (2012). ... Bacterial biofilms start the colonization process by creating microenvironments that are more favorable for biofouling species ... The role that biofilm plays as reservoirs of bacterial fish pathogens has not been explored in detail but it certainly deserves ...
This is possible due to the bacterial protein FimH, which mediates high adhesion in response to high flow. The lectin domain is ... Catch bonds also play a significant role in bacterial adhesion, most notably in Escherichia coli. E. coli and other bacteria ... Thomas WE, Trintchina E, Forero M, Vogel V, Sokurenko EV (June 2002). "Bacterial adhesion to target cells enhanced by shear ... Isberg RR, Barnes P (July 2003). "Dancing with the host: Flow-dependent bacterial adhesion". Cell. 110 (1): 1-4. doi:10.1016/ ...
Bacterial meningitis can also result in gliotic blockage of the aqueduct. In utero infection or infection during infancy could ... This disorder is caused by a point mutation in the gene for neural cell adhesion. Most males born with this have severe ...
"Engineering hydrophobin DewA to generate surfaces that enhance adhesion of human but not bacterial cells". Acta Biomaterialia. ...
Campylobacteriosis seems to be dependent on several virulence factors involving adhesion, invasion and bacterial motility ... The adhesion to eukaryotic cells is mediated by several proteins, including the Campylobacter adhesion to fibronectin protein ( ... Campylobacter coli is a Gram-negative, microaerophilic, non-endospore-forming, S-shaped bacterial species within genus ... Type strain of Campylobacter coli at BacDive - the Bacterial Diversity Metadatabase. ...
The binding of bacterial surface receptors for adhesion has also been implicated in the formation of biofilms. Blood types Red ... Growth and development One of the more basic versions of cell-cell recognition for adhesion can be observed in sponges, the ... In mouse embryos, E-cadherin on cell membranes is responsible for the adhesion of cells needed for embryonic compaction. Cell ... The bacterium Proteus mirabilis uses the T6SS protein to initiate swarming and destruction of other bacterial colonies upon ...
... and bacterial adhesion that lead to soil aggregate formation. The bacterium produce exopolysaccharides for adhesion to the root ... In addition, bacterial adhesion, biofilm formation and growth along the root surfaces were observed in the bacterium. A. ... Bacterial cellulose biofilm is hypothesised to be able to promote and facilitate adherence to ferric iron substrate, which can ... Barns, S. M.; Takala, S. L.; Kuske, C. R. (1999). "Wide Distribution and Diversity of Members of the Bacterial Kingdom ...
... balance as well as treating any bacterial infections that may develop.[33] Dialysis may be needed for kidney failure, and ... which reduces the availability of specific integrins responsible for cell adhesion to the intercellular structure and causes ...
The anaerobic bacterial species Cutibacterium acnes (formerly Propionibacterium acnes) contributes to the development of acne, ... for the treatment of superficial atrophic acne scars and involves the use of a small needle to loosen the fibrotic adhesions ... These reinforced the idea amongst dermatologists that bacterial growth on the skin plays an important role in causing acne.[179 ... such as bacterial resistance.[194] Oral and topical probiotics are under evaluation as treatments for acne.[195] Probiotics may ...
This adhesion involves adhesins (e.g., hyphal wall protein 1), and extracellular polymeric materials (e.g., mannoprotein). ... "Medically important bacterial-fungal interactions." Nature Reviews Microbiology 8.5 (2010): 340-349. Kourkoumpetis, ... In vitro and studies show that Candidal growth, adhesion and biofilm formation is enhanced by the presence of carbohydrates ... Therefore, strains of Candida with more adhesion capability have more pathogenic potential than other strains. The prevalence ...
Some types of cell adhesion proteins or cell adhesion molecules (CAMs) such as integrins, cadherins, NCAMs, or selectins ... As an example of the relationship between the IMP (in this case the bacterial phototrapping pigment, bacteriorhodopsin) and the ... and proteins responsible for cell adhesion. Classification of transporters can be found in Transporter Classification Database. ...
cellular response to molecule of bacterial origin. • positive regulation of interferon-gamma production. • embryonic axis ...
"The Size, Shape, And Arrangement of Bacterial Cells". classes.midlandstech.edu. Archived from the original on 9 August 2016. ... Adhesion - Holding together cells and tissues.. *Cell movement - Chemotaxis, contraction, cilia and flagella. ...
Small intestinal bacterial overgrowth. *Whipple's. *Short bowel syndrome. *Steatorrhea. *Milroy disease. *Bile acid ...
Intestinal adhesions. Rectum ... Peritonitis (Spontaneous bacterial peritonitis) · ...
Infectious diseases - viral (AIDS, SARS, West Nile encephalitis, hepatitis, herpes, measles, others), bacterial (TB, typhoid, ... Leukocyte adhesion deficiency. *Familial cold urticaria. *Leukemia (chronic myelogenous (CML)) and other myeloproliferative ... They defend against bacterial or fungal infection. They are usually first responders to microbial infection; their activity and ...
a b c Øster J. Further fate of the foreskin: incidence of preputial adhesions, phimosis, and smegma among Danish schoolboys. ... Chronic bacterial prostatitis. *Chronic prostatitis/chronic pelvic pain syndrome. *Asymptomatic inflammatory prostatitis ... Incidence of preputial adhesions, phimosis, and smegma among Danish schoolboys". Arch. Dis. Child. 43 (228): 200-203. doi: ... Score 2: partial exposure of glans, prepuce (not congenital adhesions) limiting factor. ...
Small bowel bacterial overgrowth syndrome. *Whipple's. *Short bowel syndrome. *Steatorrhea. *Milroy disease ...
Some prokaryotes, including many archaea and the bacterial order Actinomycetales, also share homologs of the 20S proteasome, ... adhesion molecules (ICAM-1, VCAM-1, P-selectin) and prostaglandins and nitric oxide (NO).[123] Additionally, the UPS also plays ...
Neutrophils are the primary white blood cells that respond to a bacterial infection, so the most common cause of neutrophilia ... Primary neutrophilia can additionally be a result of Leukocyte adhesion deficiency. A "left shift" refers to the presence of ... is a bacterial infection, especially pyogenic infections. Neutrophils are also increased in any acute inflammation, so will be ...
In addition, bacterial hyaluronate lyases (EC 4.2.2.1) may also be referred to as hyaluronidases, although this is uncommon.[6] ... Also in epidural lysis of adhesions for pain management. ... having a function akin to bacterial hyaluronidases.[18] ...
positive regulation of leukocyte adhesion to arterial endothelial cell. • positive regulation of leukocyte adhesion to vascular ... other bacterial products, and Interleukin-1 (IL-1). In the skin, mast cells appear to be the predominant source of pre-formed ... positive regulation of cell adhesion. • regulation of protein secretion. • positive regulation of apoptotic process. • ... positive regulation of heterotypic cell-cell adhesion. • negative regulation of mitotic cell cycle. • endothelial cell ...
Small bowel bacterial overgrowth syndrome. *Whipple's. *Short bowel syndrome. *Steatorrhea. *Milroy disease ...
Other proteins are important in cell signaling, immune responses, cell adhesion, and the cell cycle. In animals, proteins are ... "Green fluorescent protein as a reporter for macromolecular localization in bacterial cells". Methods. 20 (1): 62-72. doi ...
This results in the imbalance between host and bacterial factors which can in turn result in a change from health to disease. ... Co-adehsion: There is a natural affinity for oral microorganisms to adhere to one another which is termed "co‐adhesion". Co- ... Periodontal diseases take on many different forms but are usually a result of a coalescence of bacterial plaque biofilm ... Bacterial transportation: Bacteria will readily adhere to the acquired pellicle through adhesins, proteins and enzymes within ...
... components of bacterial cell walls, and endocytosed nucleic acids such as double-stranded RNA (dsRNA), single-stranded DNA ( ... "Mechanisms underlying acute mast cell-induced leukocyte rolling and adhesion in vivo". Journal of Immunology. 154 (2): 804-13. ...
Small bowel bacterial overgrowth syndrome. *Whipple's. *Short bowel syndrome. *Steatorrhea. *Milroy disease ...
In addition, chronic arthritis secondary to S. flexneri infection, called reactive arthritis, may be caused by a bacterial ... Bacillary dysentery should not be confused with diarrhea caused by other bacterial infections. One characteristic of bacillary ... including an amoebicidal drug to kill the parasite and an antibiotic to treat any associated bacterial infection. ...
Other chemokines are inflammatory and are released from a wide variety of cells in response to bacterial infection, viruses and ... release of superoxide anions and changes in the avidity of cell adhesion molecules called integrins within the cell harbouring ... thereby serving as both a chemoattractant and as an adhesion molecule. ...
... of a bacterial cell to its exterior. Secretion is a very important mechanism in bacterial functioning and operation in their ... to the Pseudomonas fluorescens cell adhesion protein LapA of 520 kDa.[7] The best characterized are the RTX toxins and the ... 2009). Bacterial Secreted Proteins: Secretory Mechanisms and Role in Pathogenesis. Caister Academic Press. ISBN 978-1-904455-42 ... Salyers, A. A. & Whitt, D. D. (2002). Bacterial Pathogenesis: A Molecular Approach, 2nd ed., Washington, D.C.: ASM Press. ISBN ...
... muramyl dipeptide in the peptidoglycan of the gram-positive bacterial cell wall, and CpG bacterial DNA. These PAMPs are ... Inhalational anesthetics can reduce the level of proinflammatory cytokines, altering leukocyte adhesion and proliferation, ... Sepsis is an inflammatory immune response triggered by an infection.[3][4] Bacterial infections are the most common cause, but ... Infections leading to sepsis are usually bacterial but may be fungal or viral.[21] Gram-positive bacteria were the primary ...
Journal of Adhesion Science and Technology. 20 (9): 939-957. doi:10.1163/156856106777657788.. ... was used in the mid-1990s to show that low temperature atmospheric pressure plasma is effective in inactivating bacterial cells ...
These are geared towards lay readers, not readers who are technically proficient. Do not replace easy to understand lay variants (e.g. "smell") with difficult variants lay readers will not understand (e.g. "olfaction ...
Bacterial or viral[edit]. As bacterial and viral infections can both cause the same kinds of symptoms, it can be difficult to ... Some colonizing bacteria, such as Corynebacteria sp. and viridans streptococci, prevent the adhesion and colonization of ... Comparison of viral and bacterial infection Characteristic Viral infection Bacterial infection Typical symptoms In general, ... Bacterial throat pain is often characterized by more pain on one side of the throat. An ear infection is more likely to be ...
Adhesion[editar , editar a fonte]. Y. pseudotuberculosis adhírese fortemente ás células intestinais por medio de proteínas ... "En Ladant, Daniel; Alouf, Joseph E.; Popoff, Michel R. The Comprehensive Sourcebook of Bacterial Protein Toxins. Academic Press ... and the associated accumulation of these proteins in peripheral focal adhesions". EMBO J. 16 (9): 2307-18. PMC 1169832. PMID ... "Identification of murine T cells reactive with the bacterial superantigen Yersinia pseudotuberculosis-derived mitogen (YPM) and ...
"Impaired adrenocorticotropic hormone response to bacterial endotoxin in mice deficient in prostaglandin E receptor EP1 and EP3 ...
Cell adhesion molecules, such as integrins, are critical to the attachment and migration of endothelial cells to the ... This method involves genetically engineering bacterial species such as Clostridium, Bifidobacteria and Salmonella by adding the ... inhibit cell migration, cell proliferation, cell adhesion and survival of endothelial cells. ... inhibit cell migration, cell proliferation, cell adhesion and survival of endothelial cells. ...
RGD Motif of Lipoprotein T, Involved in Adhesion of Mycoplasma conjunctivae to Lamb Synovial Tissue Cells Liza Zimmermann, ... Haloferax volcanii Flagella Are Required for Motility but Are Not Involved in PibD-Dependent Surface Adhesion Manuela Tripepi, ... Diversification of the AlpB Outer Membrane Protein of Helicobacter pylori Affects Biofilm Formation and Cellular Adhesion Hideo ... such as the production of adhesins to enable irreversible adhesion to a surface and surface colonization. The C. crescentus ...
Bacterial adhesion to target cells enhanced by shear force.. Thomas WE1, Trintchina E, Forero M, Vogel V, Sokurenko EV. ... Surface adhesion of bacteria generally occurs in the presence of shear stress, and the lifetime of receptor bonds is expected ... we show that bacterial attachment to target cells switches from loose to firm upon a 10-fold increase in shear stress applied. ...
Phys.org internet news portal provides the latest news on science including: Physics, Space Science, Earth Science, Health and Medicine
This article focuses on identifying the factors which have been reported to affect bacterial adhesion to contact lenses. ... The process of any contact lens related keratitis generally starts with the adhesion of opportunistic pathogens to contact lens ... Lens wear has different effects on bacterial adhesion, partly due to differences between wearers, responses of bacterial ... Factors influencing bacterial adhesion to contact lenses Mol Vis. 2012;18:14-21. Epub 2012 Jan 8. ...
The quantification of bacterial adhesion is based on nucleic acid staining by SYTO9, with Pseudomonas aeruginosa and ... Subsequently, 38 commercially available and novel coatings were evaluated for their anti-bacterial adhesion properties. A poly( ... reduction of bacterial adhesion. Both the coating itself and the anti-adhesive property were stable after 20 washing cycles, ... The assay provides an efficient tool to rapidly screen for non-biocidal coatings reducing bacterial attachment. ...
Evidence That Focal Adhesion Complexes Power Bacterial Gliding Motility Message Subject. (Your Name) has forwarded a page to ... Evidence That Focal Adhesion Complexes Power Bacterial Gliding Motility. By Tâm Mignot, Joshua W. Shaevitz, Patricia L. ... Evidence That Focal Adhesion Complexes Power Bacterial Gliding Motility. By Tâm Mignot, Joshua W. Shaevitz, Patricia L. ... Unexpectedly, bacteria can move as eukaryotes do, by adhering to the surface via transient adhesion sites that continually ...
Methods of inhibiting bacterial adhesion to medical implants and reducing device-associated infection are effectuated by ... The anti-bacterial activity of this protein molecule relates to its effective inhibition of bacterial adhesion to surfaces of ... Effect of Serum on Bacterial Adhesion. In this example, adhesion studies were conducted to examine the ability of bacteria to ... on bacterial adhesion to a polyurethane surface.. DETAILED DESCRIPTION. Before the present methods for inhibiting bacterial ...
T. R. Garrett, M. Bhakoo, and Z. Zhang, "Bacterial adhesion and biofilms on surfaces," Progress in Natural Science, vol. 18, no ... Methicillin-Resistant Staphylococcus aureus Biofilms and Their Influence on Bacterial Adhesion and Cohesion. Khulood Hamid ... In the adhesion assay, the impact of biofilms on cell adhesion to the surface of glass beads was investigated using unwashed ... "Extracellular polymeric substances responsible for bacterial adhesion onto solid surface," FEMS Microbiology Letters, vol. 223 ...
T. R. Garrett, M. Bhakoo, and Z. Zhang, "Bacterial adhesion and biofilms on surfaces," Progress in Natural Science, vol. 18, no ... Methicillin-Resistant Staphylococcus aureus Biofilms and Their Influence on Bacterial Adhesion and Cohesion. Khulood Hamid ... "Extracellular polymeric substances responsible for bacterial adhesion onto solid surface," FEMS Microbiology Letters, vol. 223 ... "Hydrophobic and electrostatic parameters in bacterial adhesion-dedicated to Werner Stumm for his 65th birthday," Aquatic ...
Moreover, bacterial adhesion as function of ?xx had an opposite trend, i.e. when hydrophobicity increased bacterial adhesion ... 577e) Influence of Surface Roughness and Hydrophobicity on Bacterial Adhesion and Colonization. *Conference: AIChE Annual ... Introduction: Bacterial adhesion and colonization are complicated processes that involve many factors, including surface ... Bacterial adhesion and colonization were quantified using scanning electron microscopy and direct colony-counting. ...
Adhesion plays a major role in the bacterial lifestyle. Bacteria can adhere to organic and inorganic surfaces, to each other, ... Adhesion plays a major role in the bacterial lifestyle. Bacteria can adhere to organic and inorganic surfaces, to each other, ... Assessing Bacterial Adhesion on an Individual Adhesin and Single Pili Level Using Optical Tweezers ... Protein Folding in Bacterial Adhesion: Secretion and Folding of Classical Monomeric Autotransporters ...
... bacterial adhesion include An In Vitro Model of a Parallel-Plate Perfusion System to Study Bacterial Adherence to Graft ... Introducing Shear Stress in the Study of Bacterial Adhesion, Assays for Studying the Role of Vitronectin in Bacterial ... In Vitro Assay of Bacterial Adhesion onto Mammalian Epithelial Cells, Adherence of Bacteria to Plant Surfaces Measured in the ... Adhesion and Serum Resistance, Humanized Mouse Model to Study Bacterial Infections Targeting the Microvasculature. ...
Here, we present a method that allows for serial, single bacterial cell force spectroscopy by combining the force control of ... Quantification of detachment forces between bacteria and substrates facilitates the understanding of the bacterial adhesion ... Bacterial adhesion force quantification by fluidic force microscopy E. Potthoff, D. Ossola, T. Zambelli and J. A. Vorholt, ... This study demonstrates the potential of the FluidFM technology for quantitative bacterial adhesion measurements of cell- ...
... coli bacterial infection starts with adhesion to a host cell using cell surface expressed adhesion polymers, called adhesion ... These pili, which are vital for bacterial adhesion, thereby serve as a new possible approach in the fight against bacterial ... The mechanics of adhesion polymers and their role in bacterial attachment. Zakrisson, Johan Umeå University, Faculty of Science ... The mechanics of adhesion polymers and their role in bacterial attachment(2863 kB). 252 downloads. ...
Bacterial adhesion in vitro and in silico. München, 03/29/2018. LMU researchers have characterized the physical mechanism that ... Bacterial pathogens have evolved highly effective strategies that enable them to adhere to target cells and niches in the ... The study shows that, thanks to the geometry of the interaction, the adhesion protein forms a dense network of non-covalent ... In order to dissect the adhesion mechanism, the Blue Waters supercomputer at the University of Illinois, with its 900,000 ...
... localizes to so-called focal adhesion sites (FASs) that form stationary contac … ... The mechanism of force transmission at bacterial focal adhesion complexes Nature. 2016 Nov 24;539(7630):530-535. doi: 10.1038/ ... 7 Adhesion and Inflammation laboratory, INSERM U1067, Aix Marseille University UMR7333, 13288 Marseille, France. ... At FASs, force transmission requires cyclic interactions between the molecular motor and the adhesion proteins of the outer ...
Bacterial adhesion involves the attachment (or deposition) of bacteria on the surface (solid, gel layer, etc.). This ... Jeremy A. Redman, Sharon L. Walker and Menachem Elimelech, Bacterial adhesion and transport in porous media: role of the ... The motility of bacteria also has a significant effect on the bacterial adhesion. Nonmotile and motile bacteria showed ... system has currently been used for the experiment of bacterial adhesion with the verification of DLVO theory. It is a well- ...
Wet-surface-enhanced ellipsometric contrast microscopy identifies slime as a major adhesion factor during bacterial surface ... Wet-surface-enhanced ellipsometric contrast microscopy identifies slime as a major adhesion factor during bacterial surface ... Slime Mediates Adhesion and Is Deposited by the Motility Complexes During Motility.. Could slime mediate adhesion of the ... This way, the machinery itself may lay its own adhesion substrate, enhancing Myxococcus substrate adhesion and allowing cells ...
Bacterial biofilms have been implicated with breast implant complications including capsular contracture and anaplastic large- ... This may correlate with low bacterial adhesion in high kurtosis and higher bacterial adhesion in low kurtosis. ... Bacterial Adhesion and Biofilm Formation on Textured Breast Implant Shell Materials. *Garth A. James1, ... James, G.A., Boegli, L., Hancock, J. et al. Bacterial Adhesion and Biofilm Formation on Textured Breast Implant Shell Materials ...
BACTERIAL) and non-fimbriated bacteria of attaching to cells, tissue, and nonbiological surfaces. It is a factor in bacterial ... Bacterial Adhesion. Known as: Adhesion, Bacterial, Adhesions, Bacterial, Bacterial Adhesions Physicochemical property of ... Bacterial Adhesion to Target Cells Enhanced by Shear Force. *Wendy E. Thomas, Elena Trintchina, Manu Forero, V. Vogel, Evgeni V ... Surface thermodynamics of bacterial adhesion.. *Darryl R. Absolom, Francesco Lamberti, Zdenka Policova, Walter Zingg, Carel Jan ...
Abstract: J7.00001 : Catch bonds enable bacterial and cell adhesion under flow. 11:15 AM-11:51 AM. ... How well does our intuition serve us when trying to prevent bacterial infections? If receptor-ligand complexes are being pulled ...
... transepithelial components in the inhibition of bacterial adhesion. The ... ... Randomized and Controlled Clinical Trial to Evaluate Bacterial Adhesion on Multi-Im® Transepithelial Components. 2018-06-19 02: ... Home » Citations » Randomized and Controlled Clinical Trial to Evaluate Bacterial Adhesion on Multi-Im® Transepithelial ... More From BioPortfolio on "Randomized and Controlled Clinical Trial to Evaluate Bacterial Adhesion on Multi-Im® Transepithelial ...
The protein binding was dependent on the broth used for bacterial growth. The binding after growth in brain heart infusion ... Measured surface hydrophobicity correlated well with the bacterial binding strength to the proteins. Streptococcal incubation ...
Bacterial Adhesion to Silicone Hydrogel Lenses H. Zhu; A. Kumar; J. Ozkan; D. Wu; S. Masoudi; R. Bandara; M. Willcox; R. N. ... Within a bacterial type, there were differences in adhesion to lens polymer types. Future studies will examine the effect of ... Bacterial Adhesion to Silicone Hydrogel Lenses You will receive an email whenever this article is corrected, updated, or cited ... Many of these adverse events are related to bacterial adhesion to the lenses. This study aimed, for the first time, to examine ...
We found that NT-H could significantly inhibit bacterial adhesion and biofilm formation on its surface compared with Smooth Ti ... In our previous study, we demonstrated that the gentamicin-loaded nanotubes could dramatically inhibit bacterial adhesion and ... were selected to investigate the bacterial adhesion at 6 h and biofilm formation at 24, 48, and 72 h on the HACC-loaded ... Lin W-T, Zhang Y-Y, Tan H-L, Ao H-Y, Duan Z-L, He G, Tang T-T. Inhibited Bacterial Adhesion and Biofilm Formation on ...
An in vitro study on bacterial growth interactions and intestinal epithelial cell adhesion characteristics of probiotic ... rhamnosus GG both decreased significantly in the presence of P. jensenii 702 compared to their adhesion levels when alone (P , ... However, in most cases these differences were not statistically significant (P , 0.05). Adhesion percentage of Lb. casei 01 and ... The results of adhesion assay showed that when probiotic strains were tested in combination, there was evidence of an ...
Phd Ceremony Y. Chen: Analysis of bacterial adhesion forces. A study using atomic force microscopy. ... The response of a bacterium adhering at a substratum surface appears to be related to the adhesion force, and the resulting ... Models and methods to define and retrieve mechanical properties of the bacterial cell surface can contribute to further ... the mechanisms by which eukaryotic cells are capable of adapting their cell morphology and cytoskeletal structure upon adhesion ...
P-fimbriae, bacterial adhesion, and pyelonephritis. Message subject: (Your Name) has forwarded a page to you from Archives of ...
This report describes protocols for characterizing interactions between bacterial outer membrane proteins and the human ... Assays for Studying the Role of Vitronectin in Bacterial Adhesion and Serum Resistance ... Assays for Studying the Role of Vitronectin in Bacterial Adhesion and Serum Resistance ... The protocols can be used to study the binding reactions and biological function of vitronectin in any bacterial species. ...
  • The adhesion of this strain reaches maximum numbers within 1h in most in vitro studies and a biofilm has generally formed within 24 h of cells adhering to the lens surface. (nih.gov)
  • There was no correlation between the extent of biofilm formation or biofilm components and the adhesion or cohesion abilities of the bacteria, but the efficiency of adherence to glass beads increased after biofilm depletion. (hindawi.com)
  • In conclusion, nucleic acids and proteins formed the main components of the MRSA clone t127 biofilm matrix, and there seems to be an association between adhesion and cohesion in the biofilms tested. (hindawi.com)
  • Bacterial attachment (2 h) and biofilm formation (24 h) were evaluated for Staphylococcus epidermidis , Pseudomonas aeruginosa , and Ralstonia pickettii over nine independent experiments using a CDC biofilm reactor and viable plate counts (VPCs) as well as confocal scanning laser microscopy. (springer.com)
  • Overall, VPC indicated there was significantly more bacterial attachment and biofilm formation on the Siltex and Biocell implants than the Silk or Velvet implants, although there were differences between species and time points. (springer.com)
  • In this study, bacterial attachment and biofilm formation on the outer surface material of breast implants by S. epidermidis , Pseudomonas aeruginosa, and Ralstonia pickettii were compared using implants with various surface areas and roughness. (springer.com)
  • Overall, the results indicated that rougher textures (Siltex and Biocell) with more surface area had more bacterial attachment and biofilm formation than those with smoother textures and less surface area (Silk and Velvet). (springer.com)
  • For P. aeruginosa, there were significant differences between textures for bacterial attachment but not for biofilm formation. (springer.com)
  • In contrast, S. epidermidis and R. pickettii had more significant differences in biofilm formation than bacterial attachment between textures. (springer.com)
  • Inhibition of bacterial adhesion and biofilm formation on zwitterionic surfaces. (semanticscholar.org)
  • In our previous study, we demonstrated that the gentamicin-loaded nanotubes could dramatically inhibit bacterial adhesion and biofilm formation on implant surfaces. (mdpi.com)
  • We found that NT-H could significantly inhibit bacterial adhesion and biofilm formation on its surface compared with Smooth Ti, and the NT-H with 160 nm and 200 nm diameters had stronger antibacterial activity because of the extended HACC release time of NT-H with larger diameters. (mdpi.com)
  • Models and methods to define and retrieve mechanical properties of the bacterial cell surface can contribute to further understanding of the generic mechanisms involved in bacterial sensing of substratum surfaces, their response to adhering state, and their subsequent growth into a biofilm. (rug.nl)
  • The fact that biofilms can protect attached bacterial cells from disinfectants raises rudimentary questions regarding interactions of bacterial cells with biofilm surfaces. (illinois.edu)
  • This smooth biofilm surface discouraged bacterial cells from adhering. (illinois.edu)
  • The purpose of this in vitro study was to determine the affinity of bacterial biofilm to dental restorative composite resins placed directly and indirectly. (ovid.com)
  • Indirect dental restorative composite resins were found to be less prone to biofilm adhesion than direct composite resins. (ovid.com)
  • The purpose of the present study was to examine the effect of forsythiaside on S. aureus and MRSA adhesion and biofilm formation on the surface of titanium alloy, which is a popular material for orthopedic joint prostheses. (deepdyve.com)
  • One is that Ti is bio-inert and an easy substra- Titanium (Ti) and its alloys are widely used in orthopedic tum for bacterial surface adhesion and biofilm formation. (deepdyve.com)
  • Since Ti surfaces are Two main reasons may contribute to Ti implant-associated susceptible to bacterial adherence and biofilm formation, surface modification of Ti is an important approach for fabricating antibacterial Ti implants. (deepdyve.com)
  • In this study, we employed atomic force microscopy (AFM) to interrogate how the adhesion work and the viscoelasticity of a bacterial pathogen, Klebsiella pneumoniae, influence biofilm formation. (edu.au)
  • This study indicates that AFM-based adhesion measurements of bacteria can be used to evaluate the function of bacterial surface polymers in biofilm formation and to predict the ability of bacterial biofilm formation. (edu.au)
  • Biofilm formation is initiated by bacterial adhesion to a surface followed by the formation of microcolonies and further development of heterogeneous structures with water channels between cell clusters. (syr.edu)
  • The mechanism of biofilm structural heterogeneity and the bacterial genes involve in structural organization are still poorly understood. (syr.edu)
  • To better understand bacteria-surface interactions and to develop more effective biofilm control, we created poly(dimethylsiloxane) (PDMS) surfaces with micrometer scale topography and characterized bacterial adhesion and biofilm formation on these surfaces. (syr.edu)
  • These results provided new information about the effects of surface topography on bacterial adhesion and biofilm physiology, which can help develop better control methods. (syr.edu)
  • Little by little, these bacteria form a bacterial community that becomes a biofilm. (uclouvain.be)
  • Eventually,' Prof. Dufrêne says, 'maybe we'll be able to establish preventive treatments that block biofilm formation and/or complement the antibiotic arsenal in case of bacterial infection. (uclouvain.be)
  • Bacterial adhesion to surfaces is the first step in colonization, invasion, and biofilm formation. (forskningsdatabasen.dk)
  • In vitro bacterial adhesion and biofilm formation assay was performed. (utb.cz)
  • Single bacterial strains as well as natural bacterial communities were used to analyse the impact of hydrophobin modified surfaces on different stages of biofilm formation. (kit.edu)
  • To stimulate the effect on biofilm formation the hydrophobins can subsequently be functionalized with bioactive molecules like antimicrobial peptides to influence the bacterial adhesion. (kit.edu)
  • we provide evidence that the ompR234 mutation promotes biofilm formation by strongly increasing the initial adhesion of bacteria to an abiotic surface. (asm.org)
  • In addition, cell adhesion to surfaces and cell cohesion were evaluated using the packed-bead method and mechanical disruption, respectively. (hindawi.com)
  • Conclusion: On FAS/silicone surfaces, bacterial adhesion was reduced significantly, and was inversely related to surface hydrophobicity. (aiche.org)
  • Bacterial adhesion to glass and metal-oxide surfaces. (semanticscholar.org)
  • Metal oxides can increase the adhesion of negatively-charged bacteria to surfaces primarily due to their positive charge. (semanticscholar.org)
  • Although the mechanisms by which eukaryotic cells are capable of adapting their cell morphology and cytoskeletal structure upon adhesion to substratum surfaces are well known, these mechanisms are still obscure for bacteria due to the nano-scale of their deformation. (rug.nl)
  • On clean PVC, copper and biofilms surfaces, the adhesion of three bacterial strains was found to increase as a function of ionic strength. (illinois.edu)
  • Conversely, adhesion of starved cells on copper surfaces was lower than fresh cells due to incompatibility of hydrophobicity between bacterial cells and copper surfaces. (illinois.edu)
  • Bacterial adhesion is influenced by bacterial surfaces, substratum physical-chemical characteristics, and solution chemistry. (openthesis.org)
  • The in vitro effect of treated surfaces on two oral bacteria strains (Streptococcus sanguinis and Lactobacillus salivarius) was studied with viable bacterial adhesion measurements and growth curve assays. (upc.edu)
  • and local burst release of the antibacterial agents and bac- terial resistance are common problems associated with Bacterial adhesion on Ti such biofunctional Ti surfaces [5]. (deepdyve.com)
  • Microbial Genomics, Emphasizing the Molecular Biology of Polysaccharide Degradation and Bacterial Adhesion to Plant Surfaces. (osumicrobiology.org)
  • My lab is also interested in the adhesion of bacteria to plant surfaces, and we have identified a novel form of cellulose-binding protein, produced by the gram-positive, cellulose-degrading anaerobe Ruminococcus albus . (osumicrobiology.org)
  • These studies have provided new insights into the adhesion of bacteria to plant surfaces, and call attention to the likely existence of genetically analogous adhesion determinants in both pathogenic and non-pathogenic bacteria. (osumicrobiology.org)
  • Oral bacterial adhesion to dental enamel surfaces depends on many factors including surface free energy, hydrophobicity, and surface charge of both bacterium and enamel. (nus.edu.sg)
  • In conclusion, a proper thermal treatment may change the physicochemical properties of enamel surfaces to prevent the adhesion of oral pioneer strains, such as S. mitis, S. oralis in the mouth. (nus.edu.sg)
  • Low-surface-energy poly(methylpropenoxyfluoroalkylsiloxane) or poly(perfluoroacrylate) coatings were used as a potential means of inhibiting the bacterial colonization of surfaces. (port.ac.uk)
  • Further, functionalization increased MSC adhesion to the surfaces and the αvβ3-selective peptidomimetic-coated nanotopographies promoted osteogenesis. (nature.com)
  • My name is Ina and I am the PhD student working on bacterial adhesion to host cell surfaces in the group of Dirk Linke in Oslo, Norway. (vibrant-itn.eu)
  • The adhesion ofbacteria to the food industry, and human tissue surfaces and implanted biomaterial surfaces is an important step in the patho- genesis of infection. (freebookspot.es)
  • The composites also showed a significant effect on bacterial adhesion, exhibiting lower cell counts than stainless-steel surfaces. (foodexecutive.com)
  • Adhesion of microbes, such as bacteria and fungi, to surfaces and the subsequent formation of biofilms cause multidrug-tolerant infections in humans and fouling of medical devices. (syr.edu)
  • The use of flow displacement systems for studying initial bacterial adhesion to surfaces is mostly confined to transparent substrata. (mendeley.com)
  • To this end, a stepwise protocol is described to quantify adhesion of green-fluorescent-protein producing Staphylococcus aureus on polished and non-polished metal and polymer surfaces accounting for surface-enhanced-fluorescence on metal surfaces, quantified by the ratio of the single cell fluorescence observed for adhering and planktonic bacteria. (mendeley.com)
  • The reduction in bacterial attachment was more significant on Osseotite® and Nanotite® for A. actinomycetecomitans, S. mutans and S. sanguis than for P. gingivalis and S. salivarius strains.Conclusions: Nanotite® samples showed the lowest amount of bacterial contamination in comparison to the smoother machined and rougher Osseotite® surfaces. (unipv.it)
  • The aim of this study was to investigate the role of eDNA in bacterial adhesion to abiotic surfaces, and determine to which extent eDNA-mediated adhesion depends on the physicochemical properties of the surface and surrounding liquid. (aalto.fi)
  • We investigated eDNA alteration of cell surface hydrophobicity and zeta potential, and subsequently quantified the effect of eDNA on the adhesion of Staphylococcus xylosus to glass surfaces functionalised with different chemistries resulting in variable hydrophobicity and charge. (aalto.fi)
  • DNase treatment impaired adhesion of cells to glass surfaces, but the adhesive properties of S. xylosus were regained within 30 minutes if DNase was not continuously present, implying a continuous release of eDNA in the culture. (aalto.fi)
  • Removal of eDNA lowered the adhesion of S. xylosus to all surfaces chemistries tested, but not at all ionic strengths. (aalto.fi)
  • However, eDNA promoted adhesion of cells to hydrophobic surfaces irrespective of the ionic strength. (aalto.fi)
  • As an extension of our previous work on the development of a novel organic polymer coating for the prevention of growth of medically significant bacteria on three-dimensional solid surfaces, this study examines the effect of surface coating on the adhesion and proliferation tendencies of Staphylococcus aureus and compares to those previously investigated tendencies of Pseudomonas aeruginosa on similar coatings. (edu.au)
  • Polysaccharide intercellular adhesion- (PIA-) dependent biofilms are composed of poly- β -1,6-N-acetylglucosamine- (PNAG-) based matrices. (hindawi.com)
  • This study demonstrates the potential of the FluidFM technology for quantitative bacterial adhesion measurements of cell-substrate and cell-cell interactions that are relevant in biofilms and infection biology. (rsc.org)
  • In bacteria, the ECM also promotes extracellular recognition, adhesion, and motility, allowing the formation of antibiotic-resistant biofilms ( 2 ). (pnas.org)
  • Bacterial biofilms have been implicated with breast implant complications including capsular contracture and anaplastic large-cell lymphoma. (springer.com)
  • 2) examine the role of disinfectants on biofilms structure and subsequent effect on bacterial adhesion. (illinois.edu)
  • However, on established biofilms, the adhesion was independent of solution chemistry. (illinois.edu)
  • Adhesion of every bacterial strain had found to increase on rougher biofilms than smoother ones. (illinois.edu)
  • Besides monochloramine, free chlorine from tap water was able to eradicate thin biofilms from the pipe surface leading to lower adhesion of bacterial cells. (illinois.edu)
  • The biofilms grown were collected and their bacterial cells counted. (ovid.com)
  • Bacterial biofilms are sessile microbial communities that cause serious problems, such as antibiotic resistant chronic infections in humans, and persistent biofouling of engineering facilities. (syr.edu)
  • This can entail grave complications for the patient, which is why it's so important to study bacterial biofilms and find a way to prevent their formation. (uclouvain.be)
  • In particular, we focus on bacterial biofilms and review the effects of surface energy, charge, topography, and stiffness of substratum material on bacterial adhesion. (syr.edu)
  • Extracellular DNA (eDNA) is an important structural component of biofilms formed by many bacteria, but few reports have focused on its role in initial cell adhesion. (aalto.fi)
  • The nanometer scale surface topography of a solid substrate is known to influence the extent of bacterial attachment and their subsequent proliferation to form biofilms. (edu.au)
  • The process of any contact lens related keratitis generally starts with the adhesion of opportunistic pathogens to contact lens surface. (nih.gov)
  • To circumvent the problem of drug-resistant bacterial pathogens, we need to develop new effective methods, substances, and materials that can disarm and prevent them from causing infections. (diva-portal.org)
  • Bacterial pathogens have evolved highly effective strategies that enable them to adhere to target cells and niches in the tissues of their host organisms. (uni-muenchen.de)
  • Here we highlight recent work demonstrating that surface attachment drives a transcriptional response in bacterial pathogens, including uropathogenic Escherichia coli (E. coli), and discuss the complexity of experimental design when dissecting the specific role of adhesion-mediated signaling during infection. (rutgers.edu)
  • We have recently determined that increased expression of PAFr cor - relates with higher levels of adhesion to human bronchial epithelial cells by non-typable Haemophilus influenzae and Streptococcus pneumoniae which are major bacterial pathogens in acute exacerbations of COPD. (tcd.ie)
  • In addition, we found that a PAFr antagonist decreased the adhesion of both respiratory bacterial pathogens to non-cigarette exposure con - trol levels. (tcd.ie)
  • In this commentary, we explore the question of whether adhesion to a temporally-upregulated host receptor is a common event in chronic bacterial disease, and as such, could represent a putative therapeutic target for blocking infection by respira- tory and other pathogens. (tcd.ie)
  • Adhesion ability of probiotics is the key factor that decides their colonization in the gastrointestinal tract and potential to inhibit pathogens. (frontiersin.org)
  • Presents study documents the antagonistic activity of viable/untreated, Lithium chloride (LiCl) treated or heat-killed forms of eight probiotic Lactobacillus reuteri strains on the adhesion characteristics of selected pathogens. (frontiersin.org)
  • 2. Ribet D , Cossart P . How bacterial pathogens colonize their hosts and invade deeper tissues. (microbiologyresearch.org)
  • 3. Singh B , Fleury C , Jalalvand F , Riesbeck K . Human pathogens utilize host extracellular matrix proteins laminin and collagen for adhesion and invasion of the host. (microbiologyresearch.org)
  • Management of bacterial infections is becoming increasingly difficult due to the emergence and increasing prevalence of bacterial pathogens that are resistant to available antibiotics. (forskningsdatabasen.dk)
  • Type IV pili are filamentous organelles found on the surface of a large number of bacterial species including several pathogens (Pelicic, 2008 ). (embopress.org)
  • Here, we present a method that allows for serial, single bacterial cell force spectroscopy by combining the force control of atomic force microscopy with microfluidics. (rsc.org)
  • The researchers utilized atomic force microscopy to measure the binding force between a staphylococcal adhesion protein (SdrG from Staphylococcus epidermidis) and its cognate ligand (fibrinogen β) at the single-molecule level in vitro, and calculated the contributions of all of the atoms involved in the interaction in silico, with the help of an especially powerful supercomputer. (uni-muenchen.de)
  • Therefore, this study was aimed (1) to evaluate the physicochemical properties of enamel after thermal treatment, (2) to characterize the physicochemical properties of the three pioneer strains of oral bacteria, and (3) to quantify bacterial adhesion by adhesion assay, confocal laser scanning microscopy observation and oral bacterial adhesion force measured by atomic force microscopy. (nus.edu.sg)
  • Nanoscale adhesion forces of bacteria to enamel were quantified by atomic force microscopy. (nus.edu.sg)
  • The measurement of Bacillus mycoides spore adhesion using atomic force microscopy, simple counting methods, and a spinning disk technique. (microbiologyresearch.org)
  • Methods of inhibiting bacterial adhesion to medical implants and reducing device-associated infection are effectuated by administering an effective amount of apo-transferrin to an individual with such an implant. (google.com)
  • An E. coli bacterial infection starts with adhesion to a host cell using cell surface expressed adhesion polymers, called adhesion pili. (diva-portal.org)
  • Biomaterial-centered infection: microbial adhesion versus tissue integration. (semanticscholar.org)
  • What Cegelski wanted to understand was the relative contributions of pEtN and curli to the adhesion of bacteria to host cells and how they worked together during infection. (technologynetworks.com)
  • A pls mutant constructed by allele replacement adhered well to immobilized fibronectin and immunoglobulin G, in contrast to the parental strain, suggesting that Pls could have a role in preventing adhesion at some stages during an infection. (asm.org)
  • Given the phase-variable nature of neisserial Opa proteins, these results indicate that the mechanism of bacterial engulfment and the cellular response to gonococcal infection depend on both the receptor specificities of the neisserial Opa protein variants expressed and the spectrum of CEACAM receptors present on target cells, each of which determines the combination of receptors ultimately engaged. (asm.org)
  • Adhesion of bacteria to an implant surface through specific and nonspecific mechanisms is a critical initial step in the development of biomaterial-centered infection. (asmscience.org)
  • Bacterial infection of the respiratory tract drives a number of communicable diseases including pneumonia and tuberculosis, but also acute exacerbations (AE) of the non-communicable illness, chronic obstructive pulmonary disease (COPD). (biomedcentral.com)
  • Now, it is transcendental to develop a better understanding of the bacterial adhesion process if the aim is to prevent infection through the inhibition of bacterial anchoring to human cells. (vibrant-itn.eu)
  • In the adherence process, bacterial proteins use a "collaborator" coming from the human cells… Do not get me wrong, it does not mean that human cells are helping in the infection process, but bacteria take advantage of structures that are already present in our cellular environment. (vibrant-itn.eu)
  • Monocyte trafficking to hepatic sites of bacterial infection is chemokine independent and directed by focal intercellular adhesion molecule-1 expression. (ox.ac.uk)
  • Intravenously transferred, CCR2-deficient Ly6C(high) monocytes traffic normally to hepatic foci of infection and contribute to bacterial clearance. (ox.ac.uk)
  • Pertussis toxin treatment of adoptively transferred monocytes does not impair their intrahepatic trafficking, suggesting that chemokine signaling, once CCR2(+)Ly6C(high) monocytes emigrate from the bone marrow, is not required for monocyte localization to sites of bacterial infection in the liver. (ox.ac.uk)
  • Expression of ICAM-1 is induced in close proximity to foci of bacterial infection in the liver, including on CD31(+) endothelial cells, and blockade of CD11b and CD44 diminishes monocyte localization to these hepatic foci. (ox.ac.uk)
  • Purpose: Bacterial adhesion and colonization play a crucial function in the pathogenesis of peri-implant tissue infection, which is considered the main cause of fixture loss. (unipv.it)
  • Unlike traditional expanded PTFE that features a microporous structure which can encourage bacterial formation, the condensed anti-adhesive smooth surface of MotifMESH TM , offers excellent anti-bacterial qualities to reduce infection risk. (aranbiomedical.com)
  • As mediators of adhesion, autoaggregation and bacteria‐induced plasma membrane reorganization, type IV pili are at the heart of Neisseria meningitidis infection. (embopress.org)
  • PilV and PilX pilins of Neisseria meningitidis type IV pili regulate pili number rather than their composition, suggesting that meningitidis infection‐associated adhesion and plasma membrane re‐organization require a minimum number of pili rather than specific subtypes. (embopress.org)
  • IL-1, TNFα and C5a [1] cause the endothelial cells of blood vessels near the site of infection to express cellular adhesion molecules , including selectins . (wikipedia.org)
  • The results of adhesion assay showed that when probiotic strains were tested in combination, there was evidence of an associated effect on percentage adherence. (nih.gov)
  • The initial stage of localized adherence is mediated by bacterial pili. (pnas.org)
  • Taken together these data demonstrate that the induction of diffuse adherence, intimate attachment, and AE lesions after pilus-mediated adhesion requires the cytoplasmic PilT protein. (pnas.org)
  • This pilus-mediated adhesion phase leads to an initial phase of localized adherence. (pnas.org)
  • Furthermore, an inoculum of nonpiliated bacteria is not capable of diffuse adherence, intimate attachment, and AE lesions ( 1 , 4 ), thus demonstrating that the expression of the attributes responsible for these phenotypes requires the initial step of pilus-mediated adhesion. (pnas.org)
  • It is apparent that exploitation of receptor induction for bacterial adherence is not unique to one body system, but is also observed in the central nervous, gastrointestinal and urogenital systems. (microbiologyresearch.org)
  • This fact makes Bartonella an interesting model to study the feasibility of blocking bacterial adherence to prevent and treat infections. (vibrant-itn.eu)
  • These structures are the perfect target for bacterial adherence because they are distributed everywhere on all tissues. (vibrant-itn.eu)
  • How to start unraveling the puzzle for bacterial adherence? (vibrant-itn.eu)
  • An in vitro study assessing the effect of mesh morphology and suture fixation on bacterial adherence", D Sanders et al. (aranbiomedical.com)
  • Bacterial adhesion and colonization were quantified using scanning electron microscopy and direct colony-counting. (aiche.org)
  • The aim of this study is to evaluate the differences in bacterial adhesion between a machined titanium surface, a double acid etched surface (Osseotite®) and an Osseotite surface with Nanometer-scale Discrete Crystalline Deposition (DCD™) of calcium phosphate (CaP)(Nanotite®).Methods: Surface roughness properties of each sample were determined by a laser profilometer and scanning electron microscopy (SEM) observation. (unipv.it)
  • The quantification of bacterial adhesion is based on nucleic acid staining by SYTO9, with Pseudomonas aeruginosa and Staphylococcus aureus as the model microorganisms. (mdpi.com)
  • Researchers from the Université de Lille (France) studied the fouling behaviour and hygienic features of two hydrophobic and non-polar commercial graphite-based composites (Graphilor XC and XTH) that were exposed to isothermal whey protein fouling in an industrial pasteurization unit and to foodborne pathogenic bacterial strains, namely Staphylococcus aureus , Listeria monocytogenes and Salmonella enterica . (foodexecutive.com)
  • An in vitro study on bacterial growth interactions and intestinal epithelial cell adhesion characteristics of probiotic combinations. (nih.gov)
  • Our experiments here reveal a specific function for the cellulose in which it serves a mortar-like role to enhance the adhesion strength of bacteria with bladder epithelial cells," said study co-leader Gerald Fuller, the Fletcher Jones II Professor in the School of Engineering. (technologynetworks.com)
  • Here, we compare the process of bacterial engulfment by a panel of stably transfected HeLa epithelial cell lines expressing each CEACAM receptor in isolation. (asm.org)
  • This highlights the possibility that epithelial receptors, that are upregulated in response to cigarette smoke, could be targeted to specifically block chronic bacterial infections of the lower respiratory tract. (tcd.ie)
  • Methods Human alveolar (A549), bronchial (BEAS2-B), and primary bronchial epithelial cells (HBEpC) were exposed to CS extract (CSE), and adhesion of Streptococcus pneumoniae determined. (bmj.com)
  • Conclusion CSE stimulates PAFR-dependent pneumococcal adhesion to lower airway epithelial cells. (bmj.com)
  • Bacteria proliferate in bacterial aggregates, referred to as microcolonies, in tight association with the epithelial surface (Stephens et al , 1983 ). (embopress.org)
  • In vitro studies indicate that both adhesion to epithelial cells and auto aggregation are mostly mediated by type IV pili (Carbonnelle et al , 2006 ). (embopress.org)
  • These systems are involved in chemotaxis and other cell responses to environment conditions, such as the production of adhesins to enable irreversible adhesion to a surface and surface colonization. (asm.org)
  • Bacterial adhesins affected were identified by overlay assay with immobilized ligands. (diva-portal.org)
  • We recently identified Multivalent Adhesion Molecules (MAMs) as a new and wide-spread family of bacterial adhesins mediating host-pathogen interactions (Krachler et al, PNAS 2011). (findaphd.com)
  • It is becoming more and more evident that adhesins can exhibit biological functions other than bacterial adhesion but that may nevertheless play a crucial role in the infectious process. (asmscience.org)
  • The concept that adhesins can have pathogenic activities other than in bacterial adhesion are illustrated by the proinflammatory properties of lipoteichoic acid (LTA). (asmscience.org)
  • Inhibition of adhesion by oligosaccharides and simple sugars continues to be a major method of identifying lectin adhesins and characterizing receptor specificities. (asmscience.org)
  • The concept that bacterial clones are capable of producing multiple adhesins was established a number of years ago. (asmscience.org)
  • In this review, we discuss several key host receptors and cognate adhesins that function in bacterial pathogenesis. (microbiologyresearch.org)
  • Fruit extracts from black currants (Ribes nigrum L.) are traditionally used for treatment of gastritis based on seed polysaccharides that inhibit the adhesion of Helicobacter pylori to stomach cells. (diva-portal.org)
  • It was hypothesized that proper heating may change the physicochemical properties of enamel to reduce or inhibit bacterial adhesion. (nus.edu.sg)
  • A number of approaches have been used, in both in vitro and in vivo experimental models, to inhibit bacterial attachment to temporally expressed host receptors. (microbiologyresearch.org)
  • Here, we illustrate this important topic with examples of techniques being developed that can inhibit bacterial adhesion. (forskningsdatabasen.dk)
  • Medical devices design to inhibit bacterial adhesion. (abich.it)
  • Introduction: Bacterial adhesion and colonization are complicated processes that involve many factors, including surface chemistry, hydrophobicity, and surface roughness, but the roles of these factors are not clear. (aiche.org)
  • The objective of this study was to modify hydrophobicity and roughness on one polymeric surface, and measure the corresponding bacterial adhesion and colonization changes. (aiche.org)
  • Surface roughness had a significant effect on bacterial adhesion and colonization when the root-mean-square roughness was higher than 200nm. (aiche.org)
  • however, there is a certain threshold (below 200nm) below which there was no significant decrease in bacterial adhesion and colonization. (aiche.org)
  • Bacterial adhesion to host cells or extracellular matrices in damaged tissues is a prerequisite for colonization of the host by infecting bacteria. (asm.org)
  • Bacterial adhesion involves the attachment (or deposition) of bacteria on the surface (solid, gel layer, etc. (wikipedia.org)
  • However, by using Escherichia coli expressing the lectin-like adhesin FimH and guinea pig erythrocytes in flow chamber experiments, we show that bacterial attachment to target cells switches from loose to firm upon a 10-fold increase in shear stress applied. (nih.gov)
  • The assay provides an efficient tool to rapidly screen for non-biocidal coatings reducing bacterial attachment. (mdpi.com)
  • However, their mechanical functions and the advantage of specific mechanical functions, especially in the initial attachment process, have not yet been fully understood.In this work, a detailed description of the pili mechanics and their role during cell adhesion is presented. (diva-portal.org)
  • The purpose of my project is to add some information in this field, by describing the mechanisms involved in this pathogen attachment to human cells using a bacterial model. (vibrant-itn.eu)
  • Cadherins forms homophilic attachment between themselves, which results in cells of a similar type sticking together and can lead to selective cell adhesion, allowing vertebrate cells to assemble into organised tissues. (wikipedia.org)
  • More particularly, the invention relates to a method of reducing device-associated infections by inhibiting bacterial adhesion to biomaterials with apo-transferrin. (google.com)
  • Persistent bacterial infections associated with implant devices remain a serious and costly complication with both temporary and permanent implants. (google.com)
  • These pili, which are vital for bacterial adhesion, thereby serve as a new possible approach in the fight against bacterial infections by targeting and disabling these structures using novel chemicals. (diva-portal.org)
  • How well does our intuition serve us when trying to prevent bacterial infections? (aps.org)
  • Over the last few decades, there has been a tremendous increase in research on antibacterial surface coatings as an alternative strategy against bacterial infections. (rsc.org)
  • The investigation of pili, both their biogenesis and their expected in vivo properties, brings information that can be of importance for the design of new drugs to prevent bacterial infections, which is crucial in the era of increased bacterial resistance towards antibiotics. (diva-portal.org)
  • Once implanted, orthopedic ation of the Ti prosthesis belong to a relatively immune prostheses may develop microbial infections, especially fade zone and a small bacterial load can lead to the severe those used in open fracture fixation and arthroplasty [2, 3]. (deepdyve.com)
  • We explore how upregulated receptors, in turn, expose the host to a range of bacterial infections in the respiratory tract. (microbiologyresearch.org)
  • This disease is characterized by recurrent bacterial infections, impaired wound formation, and other aberrations of adhesion-dependent functions. (clinicaltrials.gov)
  • Bacterial infections continue to be a significant concern particularly in healthcare settings and in the developing world. (mit.edu)
  • Arcanobacterium haemolyticum is an emerging bacterial pathogen, causing pharyngitis and more invasive infections. (biomedcentral.com)
  • These data indicate that PLD enhances bacterial adhesion and promotes host cell necrosis following invasion, and therefore, may be important in the disease pathogenesis of A. haemolyticum infections. (biomedcentral.com)
  • The contact time and setpoint dependence of the adhesion forces of E. coli and Streptococcus pyogenes , as well as the sequential detachment of bacteria out of a chain, are shown, revealing distinct force patterns in the detachment curves. (rsc.org)
  • Statistics for "Interactions between M proteins of Streptococcus pyogenes and glycosaminoglycans promote bacterial adhesion to host cells. (lu.se)
  • The cell growth of human osteosarcoma cells (CAL-72) over a time period of 3-11 days were examined on three scaffolds (PLGA, PLLA, PLLA-TCP) and compared to the adhesion of salivary microorganisms and representative germs of the oral flora (Porphyromonas gingivalis, Prevotella nigrescens, Candida albicans, Enterococcus faecalis, Streptococcus mutans, and Streptococcus sanguinis). (envisiontec.com)
  • Four disks per group were incubated in a brain heart infusion (BHI) medium that was inoculated with Streptococcus mutans GS5 to evaluate the bacterial adhesion by 3-4, [5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide cell viability assay (MTT assay). (bvsalud.org)
  • This study aimed to examine the surface characteristics of low shrinkage composites and adhesion of Streptococcus mutans and Streptococcus mitis to these materials. (yyu.edu.tr)
  • Bacterial adhesion on machined, Osseotite®, and Nanotite® discs were performed using the following bacterial strains: Streptococcus mutans CCUG 35176, Streptococcus sanguis CCUG 17826, Streptococcus salivarius CCUG 11878, Actinobacillus actinomycetecomitans CCUG 37002, Porphyromonas gingivalis CCUG 2521. (unipv.it)
  • Functional testing of F2 was performed by semiquantitative in situ adhesion assay on sections of human gastric mucosa and by quantitative in vitro adhesion assay with FITC-labled H. pylori strain J99 and human stomach AGS cells. (diva-portal.org)
  • Thirdly, adhesion assay was used to calculate percentages of the bacterial adhesion to enamel particles with or without saliva and/or heating. (nus.edu.sg)
  • This invention relates to a method of inhibiting bacterial adhesion to biomaterials. (google.com)
  • The adhesion of S. epidermidis directly on biomaterials appears to be governed by nonspecific interactions. (asmscience.org)
  • Handbook 0/ Bacterial Adhesion: Principles, Methods, and Applications is an outgrowth of the editors' own quest for information on laboratory techniques for studying bacte- rial adhesion to biomaterials, bone, and other tissues and, more importantly, a response to significant needs in the research community. (freebookspot.es)
  • This book is designed to be an experimental guide for biomedical scientists, biomaterials scientists, students, laboratory technicians, or anyone who plans to conduct bacterial adhesion studies. (freebookspot.es)
  • LMU researchers have characterized the physical mechanism that enables a widespread bacterial pathogen to adhere to the tissues of its human host. (uni-muenchen.de)
  • The probiotic strain L. reuteri LR6 showed the strongest adhesion and pathogen inhibition ability among the eight L. reuteri strains tested. (frontiersin.org)
  • Why focusing on pathogen adhesion? (vibrant-itn.eu)
  • For numerous reasons, though, biochemical and structural biology knowledge of the molecular interactions involved in adhesion are limited. (springer.com)
  • At FASs, force transmission requires cyclic interactions between the molecular motor and the adhesion proteins of the outer membrane via a periplasmic interaction platform, which presumably involves contractile activity of motor components and possible interactions with peptidoglycan. (nih.gov)
  • The aims of this study were to examine long-term growth interactions of five probiotic strains (Lactobacillus casei 01, Lactobacillus plantarum HA8, Lactobacillus rhamnosus GG, Lactobacillus reuteri ATCC 55730 and Bifidobacterium lactis Bb12) either alone or in combination with Propionibacterium jensenii 702 in a co-culture system and to determine their adhesion ability to human colon adenocarcinoma cell line Caco-2. (nih.gov)
  • This report describes protocols for characterizing interactions between bacterial outer membrane proteins and the human complement regulator vitronectin. (jove.com)
  • Current understanding of molecular-level interactions is inadequate to explain the initial moments of bacterial adhesion. (openthesis.org)
  • Capsular polysaccharides and fimbriae are two major components on a bacterial surface, which are critical for mediating cell-surface interactions. (edu.au)
  • Adhesion and viscoelasticity of bacteria are two major physical properties related to bacteria-surface interactions. (edu.au)
  • In the last decade, increased interest has been focused on mast cells, immune cells that are best known for their role in allergy and that have never previously been implicated in interactions with bacterial targets. (asmscience.org)
  • 3. DLVO (Derjaguin, Landau, Verwey, Overbeek) interactions determine the characteristic hydrodynamic shear forces to prevent adhesion and to detach adhering micro-organisms as well as the detachment induced by a passing air-liquid interface. (microbiologyresearch.org)
  • Cells adhesion occurs from the interactions between cell-adhesion molecules (CAMs), transmembrane proteins located on the cell surface. (wikipedia.org)
  • Actin accumulation at sites of bacterial adhesion to tissue culture cells: basis of a new diagnostic test for enteropathogenic and enterohemorrhagic Escherichia coli. (semanticscholar.org)
  • Role of lipopolysaccharides in the adhesion, retention, and transport of Escherichia coli JM109. (microbiologyresearch.org)
  • 0.05) the adhesion of Escherichia coli ATCC25922, Salmonella typhi NCDC113, Listeria monocytogenes ATCC53135, and Enterococcus faecalis NCDC115. (frontiersin.org)
  • SEM images revealed a reduced Escherichia coli adhesion to PVC/Cu nanocomposite films after 4 days of incubation with respect to plasticized PVC. (udt.cl)
  • Microbial genetics experiments have greatly enhanced our knowledge of what bacterial factors are involved in adhesion. (springer.com)
  • For the first time, this study simultaneously deals with microbial and tissue cell adhesion to rapid prototyping-produced 3D-scaffolds. (envisiontec.com)
  • Bacterial deposition in a parallel plate and a stagnation point flow chamber: microbial adhesion mechanisms depend on the mass transport conditions. (microbiologyresearch.org)
  • The dynamics of protein cluster localization suggest that intracellular motors and force transmission by dynamic focal adhesions can power bacterial motility. (sciencemag.org)
  • In the deltaproteobacterium Myxococcus xanthus, a putative gliding motility machinery (the Agl-Glt complex) localizes to so-called focal adhesion sites (FASs) that form stationary contact points with the underlying surface. (nih.gov)
  • Cells move along the ECM through focal adhesions and specific recognition of ECM components. (pnas.org)
  • Focal adhesion kinase (FAK), guanine nucleotide exchange factors (GEF) for Rho and the Rho effector Rho kinase II (ROCKII) are crucial for the regulation of adhesion movement and trailing-edge retraction. (biologists.org)
  • These studies support a model in which FAK and PDZ-RhoGEF cooperate to induce Rho/ROCKII-dependent focal adhesion movement and trailing-edge retraction in response to LPA. (biologists.org)
  • We found that A motility involved transient adhesion complexes that remained at fixed positions relative to the substratum as cells moved forward. (sciencemag.org)
  • Our results provide a molecular model of bacterial gliding motility. (nih.gov)
  • Altogether, the results revealed that in this bacterium, slime associates preferentially with the outermost components of the motility machinery and promotes its adhesion to the substrate on the ventral side of the cell. (pnas.org)
  • Whereas thermodynamic factors underpinning adhesion are well studied, the role of bacterial activity on adhesion is less explored.Here, we show that bacterial motility enhances adhesion to surfactant-decorated oil droplets dispersed in artificial sea water. (arxiv.org)
  • Lens wear has different effects on bacterial adhesion, partly due to differences between wearers, responses of bacterial strains and the ability of certain tear film proteins when bound to a lens surface to kill certain types of bacteria. (nih.gov)
  • Measured surface hydrophobicity correlated well with the bacterial binding strength to the proteins. (ovid.com)
  • Extracellular polymeric substances (EPS), surface proteins, and lipopolysaccharides (LPS) mediate cell adhesion and conditioning film formation via direct bonding to a substrate. (openthesis.org)
  • Conversely, planktonic cell adhesion is inhibited for Mn-oxide coated cells via blocking of surface proteins. (openthesis.org)
  • Finally, we present evidence that adhesion to the UF membrane surface is mediated by cell-surface macromolecules (likely to be outer membrane proteins and pili) which, upon contacting the membrane, undergo surface-induced unfolding. (umn.edu)
  • To do so, I chopped one of these proteins into shorter pieces to assess which fragment is crucial in the bacterial adhesion process. (vibrant-itn.eu)
  • But is fibronectin the only structure important to support the adhesion or is Bartonella interacting with other human proteins? (vibrant-itn.eu)
  • This is where I fell in love with bacterial membrane proteins during my bachelor studies. (vibrant-itn.eu)
  • I stumbled upon an advertisement of a group at the Max Planck Institute searching for a student working on bacterial outer membrane proteins. (vibrant-itn.eu)
  • After my bachelors I had fallen for membrane protein work and decided to stick with bacterial proteins also during my masters. (vibrant-itn.eu)
  • Afterwards, I did my thesis on outer membrane proteins in one of the most resistant bacterial species known so far ( Acinetobacter baumannii ). (vibrant-itn.eu)
  • Świątecka D, Markiewicz L, Wróblewska B. The effect of hydrolysates of proteins from rice milk on the physiological response of enterocytes and on the adhesion of bacteria from healthy and allergic people - an in vitro study. (termedia.pl)
  • This family of CAMs are membrane proteins that mediate cell-cell adhesion through its extracellular domains and require extracellular Ca2+ ions to function correctly. (wikipedia.org)
  • Controlling and preventing the adverse impact of the bacterial deposition on the aquatic environment need a deeply understanding about the mechanisms of this process. (wikipedia.org)
  • Determining the molecular mechanisms of adhesion-mediated signaling requires disentangling the contributions of chemical and mechanical stimuli. (rutgers.edu)
  • Insight into the mechanisms underlying bacterial adhesion is critical to the formulation of membrane biofouling control strategies. (umn.edu)
  • Bacterial adhesion to target cells enhanced by shear force. (nih.gov)
  • For S. aureus , total adhesion to lenses ranged from 3x10 4 to 8x10 5 total cells/lens, and 3x10 3 to 8x10 5 viable cells/lens. (arvojournals.org)
  • For P. aeruginosa , total adhesion to lenses ranged from 9x10 5 to 4x10 6 total cells/lens, and 8x10 5 to 3x10 6 viable cells/lens. (arvojournals.org)
  • but inhibited bacterial binding to human gastric cells. (diva-portal.org)
  • The effect of bacteria surface hydrophobicity on bacterial adhesion was also investigated by starving Legionella cells in Newmark Groundwater. (illinois.edu)
  • Adhesive bacterial organelles, so called pili, mediate adhesion to host cells and are therefore crucial for the initial bacterial-cell contact. (diva-portal.org)
  • A few years earlier, Fuller had developed an instrument, called the Live-Cell Monolayer Rheometer (LCMR), to investigate the adhesion of contact lenses to corneal cells. (technologynetworks.com)
  • However, cleavage of the GPI anchor by phosphatidylinositol-specific phospholipase C reduced bacterial uptake by HeLa cells expressing CEACAM5, consistent with a single zipper-like mechanism of uptake mediated by this receptor. (asm.org)
  • The characterization of the physiological responses of the inoculated microorganisms to starvation, especially the evaluation of characteristics that affect the adhesion of the cells to soil particles, is fundamental to anticipate the success or failure of bioaugmentation. (ufv.br)
  • Cultivation of the cells in nitrogen-deficient medium caused a significant reduction of the adhesion to soil particles by all the four strains. (ufv.br)
  • The disease leukocyte adhesion deficiency type 1 (LAD1) affects white blood cells. (clinicaltrials.gov)
  • Evaluation of bacterial adhesion on mammal cells, performed on the CACO-2 cell line. (abich.it)
  • For S. mutans adhesion, the smallest number of cells per milliliter ( cell /ml) was found at 40 s for Vitremer™ and at 30 s for Ketac™ N100. (bvsalud.org)
  • PLD also promoted host cell adhesion, as a pld mutant had a 60.3% reduction in its ability to adhere to HeLa cells as compared to the wild type. (biomedcentral.com)
  • The present invention relates to intercellular adhesion inhibitory factors produced by cytokine activated endothelial cells. (google.es)
  • We recently reported that the particulate matter from urban air simulates platelet-activating factor receptor (PAFR)-dependent adhesion of pneumococci to airway cells. (bmj.com)
  • We therefore sought to determine whether CS stimulates pneumococcal adhesion to airway cells. (bmj.com)
  • Does exposure to cigarette smoke increase the adhesion of pneumococci to lower airway cells? (bmj.com)
  • Cigarette smoke extract stimulates platelet-activating factor receptor (PAFR)-dependent pneumococcal adhesion to lower airway cells. (bmj.com)
  • Protrusion of the leading edge and the establishment of new peripheral adhesions coupled with the maintenance of stable attachments at the cell rear create the typical asymmetrical profile of a migrating cells with a broad lamellipodia (front) and narrow long trailing edge (rear) ( Regen and Horwitz, 1992 ). (biologists.org)
  • A monoclonal antibody, CSAT, which inhibits the adhesion of chick cells to substrata coated with fibronectin, laminin and vitronectin, has been used to identify a cell surface receptor required for cell-substratum adhesion. (biologists.org)
  • This receptor, termed integrin, is found on the ventral surface of cells in close contact adhesion sites, at the periphery of adhesion plaques and beneath stress fibres. (biologists.org)
  • Integrin is structurally and serologically related to adhesion receptors from mammalian tumour cells, fibroblasts, platelets and lymphocytes. (biologists.org)
  • Subsequent measurements of bacterial adhesion resulted in cell loadings of 0.2×10⁵, 1.0×10⁵cells×cm−2 and 2.6×10⁵ cells.cm−2 for deionized, tap water and MilliQ water, respectively. (ucd.ie)
  • However, the mechanism underlying these effects of PPAR ligands and their ability to intervene with leukocyte adhesion and migration across brain endothelial cells has yet to be explored. (jimmunol.org)
  • For the first time, using primary human brain endothelial cells (BMVEC), we demonstrated that monocyte adhesion and transendothelial migration across inflamed endothelium were markedly reduced by PPARγ activation. (jimmunol.org)
  • Cell adhesion is the process by which cells interact and attach to neighbouring cells through specialised molecules of the cell surface. (wikipedia.org)
  • Cell adhesion links cells in different ways and can be involved in signal transduction for cells to detect and respond to changes in the surroundings. (wikipedia.org)
  • Quantification of detachment forces between bacteria and substrates facilitates the understanding of the bacterial adhesion process that affects cell physiology and survival. (rsc.org)
  • However, there has been no study investigating the link of heat/laser-induced changes of physicochemical properties to bacterial adhesion. (nus.edu.sg)
  • Secondly, the physicochemical properties of three bacterial strains were different. (nus.edu.sg)
  • Medical-grade polyvinyl chloride was surface modified by a multistep physicochemical approach to improve bacterial adhesion prevention properties. (utb.cz)
  • The adhesive properties of eDNA in mediating initial adhesion of S. xylosus is thus highly versatile, but also dependent on the physicochemical properties of the surface and ionic strength of the surrounding medium. (aalto.fi)
  • This makes it an exciting topic to investigate in the context of infectious disease, and a potential target of novel drugs targeting bacterial virulence. (findaphd.com)
  • Targeting bacterial virulence functions directly is an attractive alternative. (forskningsdatabasen.dk)
  • It follows that interference with adhesion can reduce bacterial virulence. (forskningsdatabasen.dk)
  • Lymphocyte adhesion deficiency type 1 (LAD1) is an autosomal recessive disorder of leukocyte function. (clinicaltrials.gov)
  • 2 subunit of leukocyte integrins results in abnormal cell-cell and cell extracellular matrix adhesion. (clinicaltrials.gov)
  • These polypeptides, previously identified as "leukocyte adhesion inhibitor" (LAI), are involved in the process through which populations of leukocytes are inhibited from adhering to cellular substrates. (google.es)
  • P-fimbriae, bacterial adhesion, and pyelonephritis. (bmj.com)
  • It also covers research methods for the study of bacterial adhesion to tis- sues such as teeth, respiratory mucosa, intestinal mucosa, and the urinary tract. (freebookspot.es)
  • Moreover, bacterial adhesion as function of ?xx had an opposite trend, i.e. when hydrophobicity increased bacterial adhesion decreased and vice versa. (aiche.org)
  • Electrophoretic mobility and hydrophobicity as a measured to predict the initial steps of bacterial adhesion. (semanticscholar.org)
  • The objective of this study was to investigate the effect of nitrogen starvation on cell surface hydrophobicity and cell adhesion to soil particles by bacterial strains previously characterized as able to use benzene, toluene or xilenes as carbon and energy sources. (ufv.br)
  • This figure shows how the staphylococcal adhesion protein (in green) interacts with its cognate peptide ligand (red). (uni-muenchen.de)
  • The study shows that, thanks to the geometry of the interaction, the adhesion protein forms a dense network of non-covalent hydrogen bonds with its ligand. (uni-muenchen.de)
  • In other words, the extremely high mechanical strength of the interaction is largely independent of both the amino-acid sequence of the adhesion protein and the biochemical properties of the target peptide. (uni-muenchen.de)
  • The protein binding was dependent on the broth used for bacterial growth. (ovid.com)
  • Individual Neisseria gonorrhoeae colony opacity-associated (Opa) protein variants can bind up to four different carcinoembryonic antigen-related cellular adhesion molecule (CEACAM) receptors. (asm.org)
  • In many anaerobic bacteria the adhesion protein, and the enzymes required for polysaccharide hydrolysis, are organized into a complex and interesting structure called the cellulosome. (osumicrobiology.org)
  • In this work, we engineered a mutation in the cytoplasmic nucleotide-binding protein PilT and showed that this mutation increased piliation and abolished the dispersal phase of bacterial clumps as well as the loss of piliation. (pnas.org)
  • Pili emanate from the bacterial surface and are assembled from protein subunits called pilin. (pnas.org)
  • So, putting this together we have two possible participants in this bacterial adhesion process, BadA a bacterial protein from Bartonella and fibronectin a structural protein from the cellular environment. (vibrant-itn.eu)
  • Fortunately, we found that when a section of this protein is missing, the bacterial binding is reduced. (vibrant-itn.eu)
  • I therefore joined one of the leading groups in bacterial outer membrane protein biogenesis at Harvard as part of my master programme in Tuebingen (Fig.1). (vibrant-itn.eu)
  • ψp and ψc are the surface potentials of the bacterial cell and the collector surface. (wikipedia.org)
  • Reversible bacterial cell immobilization under physiological conditions on the pyramidal tip of a microchanneled cantilever is achieved by underpressure. (rsc.org)
  • In biology, the extracellular matrix (ECM) promotes both cell adhesion and specific recognition, which is essential for central developmental processes in both eukaryotes and prokaryotes. (pnas.org)
  • The response of a bacterium adhering at a substratum surface appears to be related to the adhesion force, and the resulting deformation of the cell surface. (rug.nl)
  • Both bacterial cell count and surface topography parameters were subjected to statistical analysis (α=.05). (ovid.com)
  • Indirect composite resins showed significantly lower levels than direct composite resins for bacterial cell adhesion, (P (ovid.com)
  • The first study uses in situ attenuated total reflectance (ATR) Fourier transform infrared (FTIR) spectroscopy to reveal that prior to Mn-oxidation via Pseudomonas putida GB-1, cell adhesion to ZnSe is favorable. (openthesis.org)
  • No negative effects in fibroblast cell viability were detected and a significant reduction on bacterial adhesion in vitro was achieved in silver-treated samples compared with control titanium. (upc.edu)
  • Does upregulated host cell receptor expression provide a link between bacterial adhesion and chronic respiratory disease? (tcd.ie)
  • O'Toole R.F, Shukla S.D, Walters E.H, Does upregulated host cell receptor expression provide a link between bacterial adhesion and chronic respiratory disease? (tcd.ie)
  • The first step in bacterial colonisation of the respiratory tract involves the binding of a bacterial adhesin to its cognate receptor presented on the surface of the host cell. (biomedcentral.com)
  • PAFr is known to bind to phosphorylcholine which is a component of the cell wall of the above bacterial species and is a molecular mimic of human platelet-activating factor [ 9 ]. (biomedcentral.com)
  • Nitrogen starvation also reduced significantly the strength of cell adhesion to the soil particles, except for Klebsiella sp. (ufv.br)
  • This organism expresses an unusual phospholipase D (PLD), which we propose promotes bacterial pathogenesis through its action on host cell membranes. (biomedcentral.com)
  • Moreover, the accurate quantification of surface-enhanced-fluorescence arising from adhering bacteria offers a new pathway for evaluating bacterial cell surface deformation during adhesion. (mendeley.com)
  • Cell adhesion experiments were carried out at three different ionic strengths. (aalto.fi)
  • A key step in cell migration is the dynamic formation and disassembly of adhesions at the front and the concomitant movement and release of adhesions in the rear of the cell. (biologists.org)
  • Fibroblasts maintained in the absence of serum have stable adhesions within the rear of the cell and exhibit reduced trailing-edge retraction resulting in an elongated cell phenotype. (biologists.org)
  • Addition of lysophosphatidic acid (LPA) induced the movement of adhesions and retraction of the trailing edge, thus mimicking tail retraction in a migrating cell. (biologists.org)
  • Downregulation of FAK by small interfering RNAs or small hairpin RNAs blocked LPA-induced adhesion movement and restoration of cell shape. (biologists.org)
  • Once formed, these adhesions must be strong enough to generate traction forces necessary to support translocation of the cell body. (biologists.org)
  • GTRAP48 (rat)] in the regulation of adhesion movement, trailing-edge retraction and cell-shape change. (biologists.org)
  • We observed that maintaining fibroblasts in the absence of serum results in stabilization of adhesions within the rear of the cell, and significantly reduced trailing-edge retraction resulting in an elongated cell phenotype. (biologists.org)
  • These differences in initial cell adhesion rates demonstrate that choice of laboratory water can significantly impact the results of bacterial adhesion on NF membranes. (ucd.ie)
  • Other cellular processes regulated by cell adhesion include cell migration and tissue development in multicellular organisms. (wikipedia.org)
  • Alterations in cell adhesion can disrupt important cellular processes and lead to a variety of diseases, including cancer and arthritis. (wikipedia.org)
  • Cell adhesion is also essential for infectious organisms, such as bacteria or viruses, to cause diseases. (wikipedia.org)
  • Defects in cell adhesion are usually attributable to defects in expression of CAMs. (wikipedia.org)
  • Cadherins are essential for cell-cell adhesion and cell signalling in multicellular animals and can be separated into two types: classical cadherins and non-classical cadherins. (wikipedia.org)
  • This association with actin filaments is essential for adherens junctions to stabilise cell-cell adhesion. (wikipedia.org)
  • A partial correlation was observed between composite resin roughness and bacterial adhesion when the second and particularly the third-order statistical moments of the composite resin height distributions were considered. (ovid.com)
  • In order to dissect the adhesion mechanism, the Blue Waters supercomputer at the University of Illinois, with its 900,000 processors one of the most advanced in the world, carried out detailed molecular dynamics simulations. (uni-muenchen.de)
  • However, in order to develop such chemicals, better understanding of these pili is needed.Optical tweezers (OT) can measure and apply forces up to a few hundred pN with sub-pN force resolution and have shown to be an excellent tool for investigating mechanical properties of adhesion pili. (diva-portal.org)
  • Deletion of the pilV and pilX genes led to a decrease in the number, but not length, of pili displayed on the bacterial surface indicating a role in the initiation of pilus biogenesis. (embopress.org)
  • Type IV pili are part of a larger group of bacterial machineries. (embopress.org)
  • Type IV pili and related structures are thus one of the building blocks of the archeal and bacterial world. (embopress.org)
  • Target prediction and KEGG pathway analysis indicated that these ncRNAs are closely related to pathways associated with in vitro adhesion, and our results indicated that chemical stress-induced reductions in the adhesion ability of V. alginolyticus might be due to the perturbation of ncRNA expression. (frontiersin.org)
  • The adhesion and antagonistic potential of the probiotic strains were significantly decreased upon exposure to 5 M LiCl, showing that surface molecules, proteinaceous in nature, are involved. (frontiersin.org)
  • Thus, integrin has the properties of a transmembrane molecule capable of bringing extracellular matrix and cytoskeleton-associated molecules in proper juxtaposition to form adhesion structures. (biologists.org)
  • Cytokine activation promotes up-regulation of integrins in leukocytes and adhesion molecules (e.g. (jimmunol.org)
  • citation needed] Each of these adhesion molecules has a different function and recognizes different ligands. (wikipedia.org)
  • Instead of classical cadherins, non-classical cadherins such as desmogleins and desmocollins act as adhesion molecules and they are linked to intermediate filaments instead of actin filaments. (wikipedia.org)
  • Adhesion to lenses differs between various genera/species/strains of bacteria. (nih.gov)
  • The adhesion of five strains of bacteria, i.e. (semanticscholar.org)
  • This study aimed, for the first time, to examine the level of bacterial adhesion to the currently available silicone hydrogel lenses. (arvojournals.org)
  • It was concluded that bacterial deposition mainly occurred in a secondary energy minimum by using DLVO theory. (wikipedia.org)
  • This resulted in an observable bacterial deposition despite the very high electrostatic repulsive energy from the DLVO prediction. (wikipedia.org)
  • When compared to other hernia mesh, its smooth, anti-adhesive monolayer structure helps to reduce visceral adhesion formation. (aranbiomedical.com)
  • Standardized protocols are therefore needed for the fundamental studies of bacterial adhesion and biofouling formation on NF and RO membrane. (ucd.ie)
  • Results: Direct colony counting showed that 16 μg/mL forsythiaside significantly inhibited S. aureus and MRSA adhesion on titanium alloy discs in 2 h. (deepdyve.com)
  • However, thermal treatments did not significantly influence the adhesion of S. sanguis. (nus.edu.sg)
  • S. mutans adhesion of composites was significantly lower than control group, but there was no significant difference between composites. (yyu.edu.tr)
  • Relevant to HIV-1 neuropathogenesis, enhanced adhesion and migration of HIV-1 infected monocytes across the BBB were significantly reduced when BMVEC were treated with PPARγ agonist. (jimmunol.org)
  • While host receptors are often regarded as being available perpetually for bacterial adhesion, it is apparent from our work that NTHi and S. pneumoniae utilise a receptor which is temporally-upregulated in response to a specific external stimulus, in this case, tobacco smoke. (biomedcentral.com)
  • Although there are several examples of effective strategies to prevent bacterial adhesion, the effect of the wetting properties on the coating was rarely considered as a crucial factor. (rsc.org)
  • Using a parallel-plate flow chamber, the hydrodynamic shear forces to prevent bacterial adhesion ( F prev ) and to detach adhering bacteria ( F det ) were evaluated for hydrophilic glass, hydrophobic, dimethyldichlorosilane (DDS)-coated glass and six different bacterial strains, in order to test the following three hypotheses. (microbiologyresearch.org)
  • Subsequently, 38 commercially available and novel coatings were evaluated for their anti-bacterial adhesion properties. (mdpi.com)
  • The antibacterial efficiency of the coatings was analyzed by using inductively coupled plasma mass spectrometry (ICP-MS) and bacterial viability tests. (rsc.org)
  • We show that hydrophilic polydopamine (PDA) coatings decrease bacterial adhesion forces at short bacterium-membrane contact times. (umn.edu)
  • Investigation of the effect of adhesion contact time revealed that PDA coatings are less effective at preventing bioadhesion when the contact time is prolonged to 2-5 s, or when the membranes are exposed to bacterial suspensions under stirring. (umn.edu)
  • The effects of surface topography on bacterial conjugation were also investigated. (syr.edu)
  • The influence of light-curing time on fluoride release, surface topography, and bacterial adhesion in resin-modified glass ionomer cements: AFM and SEM in vitro study. (bvsalud.org)
  • Within a bacterial type, there were differences in adhesion to lens polymer types. (arvojournals.org)
  • Bacterial resistance to antibiotics is increasing at a high rate in both developing and developed countries. (diva-portal.org)
  • The compacted membranes were also employed as substrata for monitoring the initial adhesion of Ps. (ucd.ie)
  • This increase in initial adhesion is stationary phase dependent, but it is negatively regulated by the stationary-phase-specific sigma factor RpoS. (asm.org)
  • Bacterial adhesion is one of the first and most crucial steps during the interaction between bacteria and host organisms. (findaphd.com)
  • Non-coding RNAs (ncRNAs) play a crucial role in the intricate regulation of bacterial gene expression, thereby affecting bacterial pathogenicity. (frontiersin.org)