Aspartate Aminotransferases: Enzymes of the transferase class that catalyze the conversion of L-aspartate and 2-ketoglutarate to oxaloacetate and L-glutamate. EC 2.6.1.1.Pyridoxamine: The 4-aminomethyl form of VITAMIN B 6. During transamination of amino acids, PYRIDOXAL PHOSPHATE is transiently converted into pyridoxamine phosphate.Transaminases: A subclass of enzymes of the transferase class that catalyze the transfer of an amino group from a donor (generally an amino acid) to an acceptor (generally a 2-keto acid). Most of these enzymes are pyridoxyl phosphate proteins. (Dorland, 28th ed) EC 2.6.1.Cytosol: Intracellular fluid from the cytoplasm after removal of ORGANELLES and other insoluble cytoplasmic components.Liver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.Alanine Transaminase: An enzyme that catalyzes the conversion of L-alanine and 2-oxoglutarate to pyruvate and L-glutamate. (From Enzyme Nomenclature, 1992) EC 2.6.1.2.Tyrosine Transaminase: An enzyme that catalyzes the conversion of L-TYROSINE and 2-oxoglutarate to 4-hydroxyphenylpyruvate and L-GLUTAMATE. It is a pyridoxal-phosphate protein. L-PHENYLALANINE is hydroxylated to L-tyrosine. The mitochondrial enzyme may be identical with ASPARTATE AMINOTRANSFERASES (EC 2.6.1.1.). Deficiency of this enzyme may cause type II Tyrosinemia (see TYROSINEMIAS). EC 2.6.1.5.Pyridoxal Phosphate: This is the active form of VITAMIN B 6 serving as a coenzyme for synthesis of amino acids, neurotransmitters (serotonin, norepinephrine), sphingolipids, aminolevulinic acid. During transamination of amino acids, pyridoxal phosphate is transiently converted into pyridoxamine phosphate (PYRIDOXAMINE).Aspartate Carbamoyltransferase: An enzyme that catalyzes the conversion of carbamoyl phosphate and L-aspartate to yield orthophosphate and N-carbamoyl-L-aspartate. (From Enzyme Nomenclature, 1992) EC 2.1.3.2.Aspartic Acid: One of the non-essential amino acids commonly occurring in the L-form. It is found in animals and plants, especially in sugar cane and sugar beets. It may be a neurotransmitter.Substrate Cycling: A set of opposing, nonequilibrium reactions catalyzed by different enzymes which act simultaneously, with at least one of the reactions driven by ATP hydrolysis. The results of the cycle are that ATP energy is depleted, heat is produced and no net substrate-to-product conversion is achieved. Examples of substrate cycling are cycling of gluconeogenesis and glycolysis pathways and cycling of the triglycerides and fatty acid pathways. Rates of substrate cycling may be increased many-fold in association with hypermetabolic states resulting from severe burns, cold exposure, hyperthyroidism, or acute exercise.Phenylpyruvic Acids: A group of compounds that are derivatives of phenylpyruvic acid which has the general formula C6H5CH2COCOOH, and is a metabolite of phenylalanine. (From Dorland, 28th ed)Tryptophan Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the transfer amino group from L-TRYPTOPHAN to 2-oxoglutarate in order to generate indolepyruvate and L-GLUTAMATE.Leucine Transaminase: A PYRIDOXAL PHOSPHATE containing enzyme that catalyzes the reversible transamination of branched-chain AMINO ACIDS to 2-oxoglutarate.Tyrosine Decarboxylase: A pyridoxal-phosphate protein that catalyzes the conversion of L-tyrosine to tyramine and carbon dioxide. The bacterial enzyme also acts on 3-hydroxytyrosine and, more slowly, on 3-hydroxyphenylalanine. (From Enzyme Nomenclature, 1992) EC 4.1.1.25.GlyoxylatesKynurenic Acid: A broad-spectrum excitatory amino acid antagonist used as a research tool.4-Aminobutyrate Transaminase: An enzyme that converts brain gamma-aminobutyric acid (GAMMA-AMINOBUTYRIC ACID) into succinate semialdehyde, which can be converted to succinic acid and enter the citric acid cycle. It also acts on beta-alanine. EC 2.6.1.19.Amino Acids, Branched-Chain: Amino acids which have a branched carbon chain.Liver Function Tests: Blood tests that are used to evaluate how well a patient's liver is working and also to help diagnose liver conditions.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Aspartate Aminotransferase, Mitochondrial: An aspartate aminotransferase found in MITOCHONDRIA.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.Antibodies: Immunoglobulin molecules having a specific amino acid sequence by virtue of which they interact only with the ANTIGEN (or a very similar shape) that induced their synthesis in cells of the lymphoid series (especially PLASMA CELLS).Electronic Mail: Messages between computer users via COMPUTER COMMUNICATION NETWORKS. This feature duplicates most of the features of paper mail, such as forwarding, multiple copies, and attachments of images and other file types, but with a speed advantage. The term also refers to an individual message sent in this way.Periodicals as Topic: A publication issued at stated, more or less regular, intervals.Journal Impact Factor: A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.Aspartate Aminotransferase, Cytoplasmic: An aspartate aminotransferase found in the CYTOPLASM.Acetylcholinesterase: An enzyme that catalyzes the hydrolysis of ACETYLCHOLINE to CHOLINE and acetate. In the CNS, this enzyme plays a role in the function of peripheral neuromuscular junctions. EC 3.1.1.7.Molecular Weight: The sum of the weight of all the atoms in a molecule.Succinic Acid: A water-soluble, colorless crystal with an acid taste that is used as a chemical intermediate, in medicine, the manufacture of lacquers, and to make perfume esters. It is also used in foods as a sequestrant, buffer, and a neutralizing agent. (Hawley's Condensed Chemical Dictionary, 12th ed, p1099; McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed, p1851)Dicarboxylic AcidsHeptanes: Seven-carbon saturated hydrocarbon group of the methane series. Include isomers and derivatives.Arginine Kinase: An enzyme that catalyzes the phosphorylation of the guanidine nitrogen of arginine in the presence of ATP and a divalent cation with formation of phosphorylarginine and ADP. EC 2.7.3.3.alpha-Macroglobulins: Glycoproteins with a molecular weight of approximately 620,000 to 680,000. Precipitation by electrophoresis is in the alpha region. They include alpha 1-macroglobulins and alpha 2-macroglobulins. These proteins exhibit trypsin-, chymotrypsin-, thrombin-, and plasmin-binding activity and function as hormonal transporters.Borates: Inorganic or organic salts and esters of boric acid.Hospital-Physician Relations: Includes relationships between hospitals, their governing boards, and administrators in regard to physicians, whether or not the physicians are members of the medical staff or have medical staff privileges.MedlinePlus: NATIONAL LIBRARY OF MEDICINE service for health professionals and consumers. It links extensive information from the National Institutes of Health and other reviewed sources of information on specific diseases and conditions.Information Services: Organized services to provide information on any questions an individual might have using databases and other sources. (From Random House Unabridged Dictionary, 2d ed)Hospice Care: Specialized health care, supportive in nature, provided to a dying person. A holistic approach is often taken, providing patients and their families with legal, financial, emotional, or spiritual counseling in addition to meeting patients' immediate physical needs. Care may be provided in the home, in the hospital, in specialized facilities (HOSPICES), or in specially designated areas of long-term care facilities. The concept also includes bereavement care for the family. (From Dictionary of Health Services Management, 2d ed)Hospices: Facilities or services which are especially devoted to providing palliative and supportive care to the patient with a terminal illness and to the patient's family.Recombinant Proteins: Proteins prepared by recombinant DNA technology.Methotrexate: An antineoplastic antimetabolite with immunosuppressant properties. It is an inhibitor of TETRAHYDROFOLATE DEHYDROGENASE and prevents the formation of tetrahydrofolate, necessary for synthesis of thymidylate, an essential component of DNA.Access to Information: Individual's rights to obtain and use information collected or generated by others.Bibliometrics: The use of statistical methods in the analysis of a body of literature to reveal the historical development of subject fields and patterns of authorship, publication, and use. Formerly called statistical bibliography. (from The ALA Glossary of Library and Information Science, 1983)Chemistry, Agricultural: The science of the chemical composition and reactions of chemicals involved in the production, protection and use of crops and livestock. (From McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)Electrochemical Techniques: The utilization of an electrical current to measure, analyze, or alter chemicals or chemical reactions in solution, cells, or tissues.Liver Cirrhosis: Liver disease in which the normal microcirculation, the gross vascular anatomy, and the hepatic architecture have been variably destroyed and altered with fibrous septa surrounding regenerated or regenerating parenchymal nodules.Platelet Count: The number of PLATELETS per unit volume in a sample of venous BLOOD.Hepatitis C, Chronic: INFLAMMATION of the LIVER in humans that is caused by HEPATITIS C VIRUS lasting six months or more. Chronic hepatitis C can lead to LIVER CIRRHOSIS.Liver Diseases: Pathological processes of the LIVER.

Activities of citrate synthase, NAD+-linked and NADP+-linked isocitrate dehydrogenases, glutamate dehydrogenase, aspartate aminotransferase and alanine aminotransferase in nervous tissues from vertebrates and invertebrates. (1/2887)

1. The activities of citrate synthase and NAD+-linked and NADP+-linked isocitrate dehydrogenases were measured in nervous tissue from different animals in an attempt to provide more information about the citric acid cycle in this tissue. In higher animals the activities of citrate synthase are greater than the sum of activities of the isocitrate dehydrogenases, whereas they are similar in nervous tissues from the lower animals. This suggests that in higher animals the isocitrate dehydrogenase reaction is far-removed from equilibrium. If it is assumed that isocitrate dehydrogenase activities provide an indication of the maximum flux through the citric acid cycle, the maximum glycolytic capacity in nervous tissue is considerably greater than that of the cycle. This suggest that glycolysis can provide energy in excess of the aerobic capacity of the tissue. 2. The activities of glutamate dehydrogenase are high in most nervous tissues and the activities of aspartate aminotransferase are high in all nervous tissue investigated. However, the activities of alanine aminotransferase are low in all tissues except the ganglia of the waterbug and cockroach. In these insect tissues, anaerobic glycolysis may result in the formation of alanine rather than lactate.  (+info)

Blockade of type beta transforming growth factor signaling prevents liver fibrosis and dysfunction in the rat. (2/2887)

We eliminated type beta transforming growth factor (TGF-beta) signaling by adenovirus-mediated local expression of a dominant-negative type II TGF-beta receptor (AdCATbeta-TR) in the liver of rats treated with dimethylnitrosamine, a model of persistent liver fibrosis. In rats that received a single application of AdCATbeta-TR via the portal vein, liver fibrosis as assessed by histology and hydroxyproline content was markedly attenuated. All AdCATbeta-TR-treated rats remained alive, and their serum levels of hyaluronic acid and transaminases remained at low levels, whereas all the AdCATbeta-TR-untreated rats died of liver dysfunction. The results demonstrate that TGF-beta does play a central role in liver fibrogenesis and indicate clearly in a persistent fibrosis model that prevention of fibrosis by anti-TGF-beta intervention could be therapeutically useful.  (+info)

Enrichment of canalicular membrane with cholesterol and sphingomyelin prevents bile salt-induced hepatic damage. (3/2887)

These studies were undertaken to characterize the role of plasma membrane cholesterol in canalicular secretory functions and hepatocyte integrity against intravenous taurocholate administration. Cholesterol and sphingomyelin concentrations and cholesterol/phospholipid ratios were significantly increased in canalicular membranes of diosgenin-fed rats, suggesting a more resistant structure against solubilization by taurocholate. During taurocholate infusion, control rats had significantly decreased bile flow, whereas diosgenin-fed animals maintained bile flow. Maximal cholesterol output increased by 176% in diosgenin-fed rats, suggesting an increased precursor pool of biliary cholesterol in these animals. Maximal phospholipid output only increased by 43% in diosgenin-fed rats, whereas bile salt output remained at control levels. The kinetics of glutamic oxalacetic transaminase, lactic dehydrogenase, and alkaline phosphatase activities in bile showed a significantly faster release in control than in diosgenin-fed rats. After 30 min of intravenous taurocholate infusion, necrotic hepatocytes were significantly increased in control animals. Preservation of bile secretory functions and hepatocellular cytoprotection by diosgenin against the intravenous infusion of toxic doses of taurocholate was associated with an increased concentration of cholesterol and sphingomyelin in the canalicular membrane. The increase of biliary cholesterol output induced by diosgenin was correlated to the enhanced concentration of cholesterol in the canalicular membrane.  (+info)

Phase I and pharmacokinetic study of the topoisomerase II catalytic inhibitor fostriecin. (4/2887)

We conducted a phase I and pharmacokinetic study of the topoisomerase II catalytic inhibitor fostriecin. Fostriecin was administered intravenously over 60 min on days 1-5 at 4-week intervals. Dose was escalated from 2 mg m(-2) day(-1) to 20 mg m(-2) day(-1) in 20 patients. Drug pharmacokinetics was analysed with high performance liquid chromatography with UV-detection. Plasma collected during drug administration was tested in vitro for growth inhibition of a teniposide-resistant small-cell lung cancer (SCLC) cell line. The predominant toxicities were elevated liver transaminases (maximum common toxicity criteria (CTC) grade 4) and serum creatinine (maximum CTC grade 2). These showed only a limited increase with increasing doses, often recovered during drug administration and were fully reversible. Duration of elevated alanine-amino transferase (ALT) was dose-limiting in one patient at 20 mg m(-2). Other frequent toxicities were grade 1-2 nausea/vomiting, fever and mild fatigue. Mean fostriecin plasma half-life was 0.36 h (initial; 95% CI, 0-0.76 h) and 1.51 h (terminal; 95% CI, 0.41-2.61 h). A metabolite, most probably dephosphorylated fostriecin, was detected in plasma and urine. No tumour responses were observed, but the plasma concentrations reached in the patients were insufficient to induce significant growth inhibition in vitro. The maximum tolerated dose (MTD) has not been reached, because drug supply was stopped at the 20 mg m(-2) dose level. However, further escalation seems possible and is warranted to achieve potentially effective drug levels. Fostriecin has a short plasma half-life and longer duration of infusion should be considered.  (+info)

Influences of Kupffer cell stimulation and suppression on immunological liver injury in mice. (5/2887)

AIM: To study the possible involvement of Kupffer cells (KC) in immunological liver injury in mice. METHODS: Liver injury was induced by i.v. injection of Bacillus Calmette-Guerin (BCG) 5 x 10(7) viable bacilli followed by i.v. injection of lipopolysaccharides (LPS) 7.5 micrograms to each mouse. Indian ink and silica were i.v. injected to suppress KC and retinol was given po to stimulate KC in these mice. Plasma alanine aminotransferase (AlaAT), aspatate aminotransferase (AspAT), nitric oxide (NO), and liver tissue were examined. RESULTS: Injection of LPS following BCG injection resulted in a remarkable elevation of plasma NO, AlaAT, and AspAT levels, and severe liver damage. The damages were enhanced by the activation of KC with retinol and reduced by suppression of KC with silica and Indian ink. CONCLUSION: The degree of liver injury induced by BCG + LPS is closely correlated with the status of KC, and NO from KC plays an important role in the pathogenesis of the liver damage in mice.  (+info)

Effect of epidermal growth factor on cultured rat hepatocytes poisoned by CCl4. (6/2887)

AIM: To study the effects of epidermal growth factor (EGF) on CCl4-induced primary cultured hepatocytes injury. METHODS: Alanine amino-transferase (AlaAT) and aspartate aminotransferase (AspAT) activities and K+ concentractions were determined by the Auto-biochemistry Assay System. Malondialdehyde (MDA) was determined by thiobarbituric acid method. Radioactivity was determined by liquid scintillometry. Light microscopy and electron microscopy were used. RESULTS: EGF 40 micrograms.L-1 decreased CCl4 (10 mmol.L-1)-induced damages of rat primary cultured hepatocytes by decreasing AlaAT and AspAT leakage and MDA production, and promoted RNA and DNA synthesis, with a high positive correlation between intracellular K+ leakage and DNA syntheses (r = 0.99, P < 0.01). Cytopathological study showed that EGF decreased damage of liver cells. CONCLUSION: EGF maintains the stability of cellular lipid membrane and promotes syntheses of RNA and DNA of hepatocytes, and intracellular K+ transference is a promotor of the message transmission of DNA synthesis.  (+info)

Opposite behavior of two isozymes when refolding in the presence of non-ionic detergents. (7/2887)

GroEL has a greater affinity for the mitochondrial isozyme (mAAT) of aspartate aminotransferase than for its cytosolic counterpart (cAAT) (Mattingly JR Jr, Iriarte A, Martinez-Carrion M, 1995, J Biol Chem 270:1138-1148), two proteins that share a high degree of sequence similarity and an almost identical spatial structure. The effect of detergents on the refolding of these large, dimeric isozymes parallels this difference in behavior. The presence of non-ionic detergents such as Triton X-100 or lubrol at concentrations above their critical micelle concentration (CMC) interferes with reactivation of mAAT unfolded in guanidinium chloride but increases the yield of cAAT refolding at low temperatures. The inhibitory effect of detergents on the reactivation of mAAT decreases progressively as the addition of detergents is delayed after starting the refolding reaction. The rate of disappearance of the species with affinity for binding detergents coincides with the slowest of the two rate-limiting steps detected in the refolding pathway of mAAT. Limited proteolysis studies indicate that the overall structure of the detergent-bound mAAT resembles that of the protein in a complex with GroEL. The mAAT folding intermediates trapped in the presence of detergents can resume reactivation either upon dilution of the detergent below its CMC or by adding beta-cyclodextrin. Thus, isolation of otherwise transient productive folding intermediates for further characterization is possible through the use of detergents.  (+info)

Folate nutriture alters choline status of women and men fed low choline diets. (8/2887)

Choline and folate share methylation pathways and, in studies of rats, were shown to be metabolically inter-related. To determine whether choline status is related to folate intake in humans, we measured the effect of controlled folate depletion and repletion on the plasma choline and phosphatidylcholine concentrations of 11 healthy men (33-46 y) and 10 healthy women (49-63 y) fed low-choline diets in two separate metabolic unit studies. Total folate intake was varied by supplementing low folate (25 and 56 microg/d for men and women, respectively) and low choline (238 and 147 mg/d for men and women, respectively) diets with pteroylglutamic acid for 2-6 wk following folate-depletion periods of 4-5 wk. The low folate/choline intakes resulted in subclinical folate deficiencies; mean plasma choline decreases of 28 and 25% in the men and women, respectively; and a plasma phosphatidylcholine decrease of 26% in the men (P < 0. 05). No functional choline deficiency occurred, as measured by serum transaminase and lipid concentrations. The decreases in choline status measures returned to baseline or higher upon moderate folate repletion and were more responsive to folate repletion than plasma folate and homocysteine. Feeding methionine supplements to the men did not prevent plasma choline depletion, indicating that folate is a more limiting nutrient for these methylation pathways. The results indicate that 1) choline is utilized as a methyl donor when folate intake is low, 2) the de novo synthesis of phosphatidylcholine is insufficient to maintain choline status when intakes of folate and choline are low, and 3) dietary choline is required by adults in an amount > 250 mg/d to maintain plasma choline and phosphatidylcholine when folate intake is low.  (+info)

*Aspartate-prephenate aminotransferase

... prephenate aspartate aminotransferase, and L-aspartate:prephenate aminotransferase. De-Eknamkul W, Ellis BE (1988). " ... In enzymology, an aspartate-prephenate aminotransferase (EC 2.6.1.78) is an enzyme that catalyzes the chemical reaction L- ... The systematic name of this enzyme class is L-arogenate:oxaloacetate aminotransferase. Other names in common use include ... whereas its two products are prephenate and L-aspartate. This enzyme belongs to the family of transferases, specifically the ...

*GOT1

... aspartate aminotransferase 1)". Panteghini M (1990). "Aspartate aminotransferase isoenzymes". Clin. Biochem. 23 (4): 311-9. doi ... Totan A, Greabu M, Totan C, Spinu T (2006). "Salivary aspartate aminotransferase, alanine aminotransferase and alkaline ... Aspartate aminotransferase, cytoplasmic is an enzyme that in humans is encoded by the GOT1 gene. Glutamic-oxaloacetic ... Doyle JM, Schininà ME, Bossa F, Doonan S (1990). "The amino acid sequence of cytosolic aspartate aminotransferase from human ...

*Aminooxyacetic acid

... inhibits aspartate aminotransferase, another PLP-dependent enzyme, which is an essential part of the malate ... Also, the inhibition of aspartate aminotransferase by aminooxyacetic acid has clinical implications for the treatment of breast ... Moreover, selective inhibition of aspartate aminotransferase with aminooxyacetic acid ameliorated experimental autoimmune ... "Targeting aspartate aminotransferase in breast cancer". Breast Cancer Research. 10 (5): R84. doi:10.1186/bcr2154. PMC 2614520 ...

*HELLP syndrome

... aspartate aminotransferase] and/or ALT [alanine aminotransferase] ≥70 IU/l), and evidence suggestive of hemolysis (total serum ... serum aspartate aminotransferase >70 IU/l; and platelet count 50,000 and ≤100,000 cells/μl, and class 3 HELLP syndrome featured ...

*Streptomyces violaceochromogenes

"Cytosolic aspartate aminotransferase inactivating-enzyme from Streptomyces violaceochromogenes". Agricultural and Biological ...

*Malate-aspartate shuttle

... aspartate is converted by cytosolic aspartate aminotransferase to oxaloacetate. The net effect of the malate-aspartate shuttle ... by mitochondrial aspartate aminotransferase. Since aspartate is an amino acid, an amino radical needs to be added to the ... aspartate aminotransferase in the mitochondrial matrix and intermembrane space. malate-alpha-ketoglutarate antiporter in the ... glutamate-aspartate antiporter in the inner membrane. The primary enzyme in the malate-aspartate shuttle is malate ...

*GOT2

Aspartate aminotransferase, mitochondrial is an enzyme that in humans is encoded by the GOT2 gene. Glutamic-oxaloacetic ... Guidetti P, Amori L, Sapko MT, Okuno E, Schwarcz R (Jul 2007). "Mitochondrial aspartate aminotransferase: a third kynurenate- ... Furuya E, Yoshida Y, Tagawa K (May 1979). "Interaction of mitochondrial aspartate aminotransferase with negatively charged ... GOT2 converts oxaloacetate into aspartate by transamination. This aspartate as well as alpha-ketoglutarate return into the ...

*Peptidyl-Lys metalloendopeptidase

"The primary structure of aspartate aminotransferase from pig heart muscle. Digestion with a proteinase having specificity for ...

*Aspartate transaminase

... (AST) or aspartate aminotransferase, also known as AspAT/ASAT/AAT or serum glutamic oxaloacetic ... Aspartate transaminase catalyzes the interconversion of aspartate and α-ketoglutarate to oxaloacetate and glutamate. Aspartate ... Okamoto A, Kato R, Masui R, Yamagishi A, Oshima T, Kuramitsu S (1996). "An aspartate aminotransferase from an extremely ... 1984). "Mechanism of action of aspartate aminotransferase proposed on the basis of its spatial structure". J Mol Biol. 174 (3 ...

*Cystathionine gamma-lyase

It is also a member of the broader aspartate aminotransferase family. Like many other PLP-dependent enzymes, cystathionine ...

*Rangelia

The alanine aminotransferase, aspartate aminotransferase and creatine kinase levels may be raised. The gamma- ...

*Alcoholic hepatitis

... including elevated bilirubin and aminotransferases. The ratio of aspartate aminotransferase to alanine aminotransferase is ... ISBN 0-7216-7335-X. Sorbi D, Boynton J, Lindor KD (1999). "The ratio of aspartate aminotransferase to alanine aminotransferase ...

*Ebola virus disease

... elevated levels of the liver enzymes alanine aminotransferase (ALT) and aspartate aminotransferase (AST); and abnormalities in ...

*Amino acid

For example, aspartate aminotransferase converts glutamate and oxaloacetate to alpha-ketoglutarate and aspartate. Other ... Aspartate, glycine, and glutamine are precursors of nucleotides. However, not all of the functions of other abundant non- ... to bind to positively charged molecules have surfaces rich with negatively charged amino acids like glutamate and aspartate, ...

*HSPA8

"Structural features of the precursor to mitochondrial aspartate aminotransferase responsible for binding to hsp70". The Journal ...

*Alanine transaminase

... shows a marked diurnal variation.[citation needed] The ratio of ALT to AST (aspartate aminotransferase) ... determined that the appropriate terminology for AST and ALT are aspartate aminotransferase and alanine aminotransferase. The ... Aspartate transaminase Liver function tests Karmen A, Wroblewski F, Ladue JS (Jan 1955). "Transaminase activity in human blood ... Wang CS, Chang TT, Yao WJ, Wang ST, Chou P (April 2012). "Impact of increasing alanine aminotransferase levels within normal ...

*Mitochondrial matrix

"Mechanism of action of aspartate aminotransferase proposed on the basis of its spatial structure". Journal of Molecular Biology ... These reactions are facilitated by transaminases in order to produce aspartate and asparagine from oxaloacetate. Transamination ...

*Transferase

"Mechanism of action of aspartate aminotransferase proposed on the basis of its spatial structure". Journal of Molecular Biology ... Transamination, or the transfer of an amine (or NH2) group from an amino acid to a keto acid by an aminotransferase (also known ... In ATCase such a transfer is written as Carbamyl phosphate + L-aspertate → {\displaystyle \rightarrow } L-carbamyl aspartate + ... This includes enzymes like transaminase (also known as "aminotransferase"), and a very small number of oximinotransferases and ...

*Hepatitis B

Aspartate aminotransferase to platelet ratio index may be used when cost is an issue. Hepatitis B virus DNA persists in the ... Carriers of the virus may have chronic hepatitis B, which would be reflected by elevated serum alanine aminotransferase (ALT) ... Chronically infected individuals with persistently elevated serum alanine aminotransferase, a marker of liver damage, and HBV ...

*Transamination

The two common types of aminotransferases are Alanine aminotransferase (ALT) and Aspartate aminotransferase (AST). Booth, ... Glutamate + oxaloacetate ↔ α-ketoglutarate + aspartate Transamination catalyzed by aminotransferase occurs in two stages. In ... The products usually are either alanine, aspartate or glutamate, since their corresponding alpha-keto acids are produced ... For the reaction to complete, aminotransferases require participation of aldehyde containing coenzyme, pyridoxyl-5'-phosphate ( ...

*Leptospirosis

Brief elevations of aspartate aminotransferase (AST), alanine aminotransferase (ALT), and gamma-glutamyltransferase (GGT) ...

*Fasciolosis

... gamma glutamyl transpeptidase and aspartate aminotransferase activities and their significance as diagnostic aids". Res. Vet. ...

*Fibrolamellar hepatocellular carcinoma

The usual markers for liver disease - aspartate aminotransferase, alanine aminotransferase and alkaline phosphatase - are often ...

*Renal cell carcinoma

For example, liver enzymes such as aspartate aminotransferase [AST] and alanine aminotransferase [ALT] are found to be at ...

*Glycogen storage disease type 0

... function studies provide evidence of mild hepatocellular damage in patients with mild elevations of aspartate aminotransferase ... AST) and alanine aminotransferase (ALT) levels.[citation needed]Plasma amino-acid analysis shows plasma alanine levels as in ...

*Beta-alanine-pyruvate transaminase

The systematic name of this enzyme class is L-alanine:3-oxopropanoate aminotransferase. Other names in common use include beta- ... This enzyme participates in 4 metabolic pathways: alanine and aspartate metabolism, valine, leucine and isoleucine degradation ... Stinson RA, Spencer MS (1969). "Beta alanine aminotransferase (s) from a plant source". Biochem. Biophys. Res. Commun. 34 (1): ... alanine-pyruvate aminotransferase, and beta-alanine-alpha-alanine transaminase. ...
Define glutamic oxaloacetic transaminase. glutamic oxaloacetic transaminase synonyms, glutamic oxaloacetic transaminase pronunciation, glutamic oxaloacetic transaminase translation, English dictionary definition of glutamic oxaloacetic transaminase. Noun 1. glutamic oxaloacetic transaminase - an enzyme involved in transamination glutamic oxalacetic transaminase aminopherase, aminotransferase,...
INTRODUCTION. Glutamic oxaloacetic transaminase (GO-T) is widely distributed in animal and human tissues. Its greatest activity has been found in homogenates of heart muscle, skeletal muscle, brain, liver and kidney, the relative activities varying in different species (table 1). This enzyme activity has been found in all animal and human sera tested, and the activities are comparable whether determined chromatographically,1 spectrophotometrically2 or colorimetrically3 (figure 1). It has been demonstrated that serum. ...
Recombinant Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2) Protein (His tag). Species: Human. Source: Escherichia coli (E. coli). Order product ABIN1981684.
TY - JOUR. T1 - Aspartate aminotransferase (AST/GOT) and alanine aminotransferase (ALT/GPT) detection techniques. AU - Huang, Xing Jiu. AU - Choi, Yang Kyu. AU - Im, Hyung Soon. AU - Yarimaga, Oktay. AU - Yoon, Euisik. AU - Kim, Hak Sung. PY - 2006/1/1. Y1 - 2006/1/1. N2 - The levels of aspartate aminotransferase (AST/GOT) and alanine aminotransferase (ALT/GPT) in serum can help people diagnose body tissues especially the heart and the liver are injured or not. This article provides a comprehensive review of research activities that concentrate on AST/GOT and ALT/GPT detection techniques due to their clinical importance. The detection techniques include colorimetric, spectrophotometric, chemiluminescence, chromatography, fluorescence and UV absorbance, radiochemical, and electrochemical techniques. We devote the most attention on experimental principle. In some methods a few representative devices and important conclusions are presented.. AB - The levels of aspartate aminotransferase (AST/GOT) ...
Aspartate transaminase (AST) or aspartate aminotransferase, also known as AspAT/ASAT/AAT or serum glutamic oxaloacetic transaminase (SGOT), is a pyridoxal phosphate (PLP)-dependent transaminase enzyme (EC 2.6.1.1) that was first described by Arthur Karmen and colleagues in 1954. AST catalyzes the reversible transfer of an α-amino group between aspartate and glutamate and, as such, is an important enzyme in amino acid metabolism. AST is found in the liver, heart, skeletal muscle, kidneys, brain, and red blood cells. Serum AST level, serum ALT (alanine transaminase) level, and their ratio (AST/ALT ratio) are commonly measured clinically as biomarkers for liver health. The tests are part of blood panels. Aspartate transaminase catalyzes the interconversion of aspartate and α-ketoglutarate to oxaloacetate and glutamate. Aspartate (Asp) + α-ketoglutarate ↔ oxaloacetate + glutamate (Glu) As a prototypical transaminase, AST relies on PLP (Vitamin B6) as a cofactor to transfer the amino group from ...
AV Fasano, BA Kasprow, JT Velardo. Glutamic oxalacetic and glutamic pyruvic transaminase activity in the pineal gland of the albino rat during the estrous cycle. J Am Osteopath Assoc 1972;72(2):185. doi: .. Download citation file:. ...
The following laboratory values obtained within 30 prior to study entry:. Absolute neutrophil count (ANC) ≥750/mm3 Hematocrit ≥30 Platelet count ≥40,000/mm3 Calculated creatinine clearance (CrCl) ≥50 mL/min, as estimated by the Cockcroft-Gault equation* aspartate amino transferase (AST) serum glutamic oxalacetic transaminase (SGOT), amino alanine transferase (ALT) serum glutamic-pyruvic transaminase (SGPT), and alkaline phosphatase ,3 x upper limit of normal (ULN) total bilirubin ≤2.5 x ULN. NOTE: If the potential subject is taking an atazanavir-containing regimen at the time of screening, total bilirubin ≤5 x ULN is acceptable. * Calculation for the Cockcroft-Gault equation is available at https://www.fstrf.org/common/utilities/calculators/ccc.html. ...
Age greater than 18 years.. Life expectancy of greater than 3 months.. Performance status (Eastern Cooperative Oncology Group (ECOG)) less than or equal to 2.. Patients must have adequate organ and marrow function (as defined below). Patients must have returned to base line or grade one from any acute toxicity related to prior therapy.. Laboratory Test/Required Value:. Absolute neutrophil count greater than 1,500/microl.. Platelets greater than 100,000/microl.. International normalized ratio (INR) less than or equal to 1.5 times upper limit of normal (ULN) or. Partial thromboplastin time (PTT) abnormality can be explained by the presences of lupus anticoagulant or in the therapeutic range if on anticoagulation.. Total bilirubin less than or equal to 1.5 times institutional upper limits of normal.. Aspartate aminotransferase (AST)/serum glutamic oxaloacetic transaminase(SGOT) and alanine aminotransferase (ALT)/serum glutamic pyruvic transaminase(SGPT) less than or equal to 3 times institutional ...
Recently there have been news stories on a dengue strain that affects the liver. This condition is also called dengue hepatitis. It leads to severe organ malfunction and in some cases even organ failure. In the case of dengue hepatitis, fever lasts longer, often for more than a week, and leaves the patient extremely exhausted. An indication of this condition, according to experts is the sudden rise in SGOT (Serum Glutamic Oxaloacetic Transaminase) and SGPT (Serum Glutamic Pyruvic Transaminase) levels, sometime almost 20 times higher than the normal level. Dengue hepatitis is characterized by high fever, lasting more than a week, extreme weakness. The blood tests show an increase in SGPT and SGOT levels, a drop in platelet count and WBCs ...
Gentaur molecular products has all kinds of products like :search , Nordic Immunological Lab \ rabbit IgG against Porcine heart Glutamic_oxalacetic transaminase \ NE172/7S for more molecular products just contact us
Reference: Polikarpova L.I., Effect of protein synthesis inhibitors on the hormonal induction of alanine and aspartate aminotransferases in the liver of sexually mature male rats, Voprosy meditsinskoi khimii, 1974, vol: 20(2), 215-217 ...
The patient underwent an uneventful induction of anesthesia with midazolam, sodium thiopental, pancuronium, and metocurine. After induction, the patient was placed in a right flexed lateral decubitus position on a padded table with the kidney bolster raised. All pressure points were padded. Anesthesia was maintained with a combination of nitrous oxide, isoflurane, and intravenous fentanyl. The patient had no episodes of hypotension and had a urine output , 0.75 ml *symbol* kg sup -1 *symbol* h sup -1. The patient remained in a lateral position for 7 h during the surgical procedure. The long duration was due to extensive scarring surrounding the kidney. The patient did not complain of flank or hip pain in the recovery room. Biochemical testing was performed on discharge of the patient from the recovery room because of periods of renal ischemia during the partial nephrectomy. The results were remarkable for an increased serum glutamic oxaloacetic transaminase (SGOT) of 95 u/l (normal , 35 u/l) and ...
Objectives: A non-invasive, simple and non-expensive test to predict cirrhosis would be highly desirable. The aspartate aminotransferase/ alanine aminotransferase (AST/ALT) ratio has been proven to be such an indicator of cirrhosis in alcoholic liver disease, hepatitis C. Aim: To test whether the AST/ALT ratio is a marker of cirrhosis also in patients with primary biliary cirrhosis (PBC). Methods: The study consisted of 160 patients. In 126 patients, we had clinical and laboratory data at the time of diagnosis and follow-up with outcome: liver-related death, liver transplantation and survival. In 121 patients, we had laboratory data and liver histology. Results: We found that the AST/ALT ratio was significantly higher in cirrhotic patients than in non-cirrhotic patients. A high AST/ALT ratio was significantly associated with esophageal varices and ascites. In a multivariate analysis, bilirubin and ALP were predictors of poor prognosis. Conclusion: The AST/ALT ratio seems to be of clinical value ...
The MaxDiscovery Aspartate Transaminase (AST) Color Endpoint Assay Kit is a plate-based colorimetric enzymatic assay for the determination of the aspartate transaminase enzyme in serum samples. Aspartate transaminase (AST) also known as aspartate aminotransferase or (sGOT) is a metabolic enzyme expressed primarily in the liver. Elevation of AST levels is an indication of liver damage and has been associated with liver injury. AST levels are monitored routinely in patients with liver diseases. AST is also a very useful tool for preclinical investigation of experimental drug formulations and AST levels are commonly used to monitor and attenuate the hepatotoxic effects of experimental drugs in rodents. The MaxDiscovery Alanine Transaminase (AST) Color Endpoint Assay Kit uses a colored reaction scheme to detect AST enzymatic activity in serum samples. In this method aspartate and -ketoglutarate are first converted to glutamate and oxaloacetate. The oxaloacetate then reacts with diazonium salt to ...
TY - JOUR. T1 - Comparison of Circulating Endothelial Cell/Platelet Count Ratio to Aspartate Transaminase/Platelet Ratio Index for Identifying Patients with Cirrhosis. AU - Sethi, Saurabh. AU - Simonetto, Douglas. AU - Abdelmoneim, Soha S.. AU - Campion, Michael B.. AU - Kaloiani, Irakli. AU - Clayton, Amy C.. AU - Kremers, Walter K. AU - Halling, Kevin C.. AU - Kamath, Patrick Sequeira. AU - Talwalkar, Jayant. AU - Shah, Vijay. PY - 2012. Y1 - 2012. N2 - Background/Objectives: Circulating endothelial cells (CECs) are indicative of vascular injury and correlate with severity of vascular diseases. A pilot study showed that the ratio of CEC to platelet count (CEC/PC) was effective in predicting cirrhosis. Therefore, we evaluated CEC/PC in a larger cohort of patients, correlated it with cirrhosis, and compared its operating characteristics with previously described biomarker for cirrhosis, the AST/platelet ratio index (APRI). Methods: Fifty-three patients with cirrhosis, 20 matched healthy ...
Site: ovarian; stage: COG stage II and III, FIGO stage IC, II and III; histology: must contain at least one of the following: yolk sac tumor, embryonal carcinoma, or choriocarcinoma (pure or mixed); age (years) ,= 11 and - Site: testicular; stage: COG stage II-IV, AJCC stage II, III, International Germ Cell Consensus Classification (IGCCC) good risk; histology: must contain at least one of the following: yolk sac tumor, embryonal carcinoma, or choriocarcinoma (pure or mixed); tumor markers: for IGCCC good risk: alpha-FP = 11 and - Site: extragonadal; stage: COG stage II; histology: must contain at least one of the following: yolk sac tumor, embryonal carcinoma, or choriocarcinoma (pure or mixed) age (years) ,= 11 and 10. Patients must have a performance status corresponding to Eastern Cooperative Oncology Group (ECOG) scores of 0, 1 or 2; use Karnofsky for patients , 16 years of age and Lansky for patients =11. Serum glutamic-oxaloacetic transaminase (SGOT) (aspartate aminotransferase [AST]) or ...
Aminotransferase (AST) is an enzyme thats present in various parts of your body. Your doctor can order an AST test to check the level of aspartate aminotransferase in your blood. Abnormal results may be a sign of liver damage or disease. Learn more about this test.
Abstract Glutamic oxaloacetic transaminase (GOT) and glutamic pyruvic transaminase (GPT) activity were measured in precutaneous needle biopsy specimens of human liver tissue and co..
1B4X: The role of residues outside the active site: structural basis for function of C191 mutants of Escherichia coli aspartate aminotransferase.
GOT1 - GOT1 (Myc-DDK-tagged)-Human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1) available for purchase from OriGene - Your Gene Company.
The effect of ingesting charcoal-broiled beefburgers (CBB) on the liver functions and nonenzymatic antioxidant levels in human blood was examined in twenty-nine healthy individually males (mean age 21.65 ± 1.32 years, range 20.32 - 22.42 years), non-smokers and had no occupational exposure to PAHs, who consumed two charcoal grilled beefburger per day (mean weight 70 gmper each) at lunch time over 28 consecutive days. The mean daily intake of PAH during the consumption period was 3431 ng and the mean daily intake of PAH per kg body wt/day was 46 ng. Blood samples were collected from each subject 7, 14, 21 and 28 days before, during, and after the beefburgers consumption period. glutamic-oxaloacetic transaminase (GOT), glutamic-pyruvate transaminase (GPT) and alkaline phosphatase (ALP) were significantly higher in serum of subjects during CBB consumption period compared with those of before CBB consumption ones. All of the enzyme activities still increased upper the baseline levels, before CBB
1AMR: X-ray crystallographic study of pyridoxamine 5-phosphate-type aspartate aminotransferases from Escherichia coli in three forms.
Abstract The alcoholic extract of fruits of the plant Luffa acutangula previously reported for is hepatoprotective activity was fractionated into three parts to chemically identify the most potent bioactive fraction. The hepatoprotective potential of the fraction prepared from extract was studied in vivo in rats as well as ex vivo in isolated hepatocytes against paracetamol induced hepatotoxicity. The hepatoprotective activity was determined on the basis of their effects on parameters like direct bilirubin, serum aspartate transaminase, serum alanine transaminase and alakaline phasphatase. Ethyl acetate fraction (EAF) of alcoholic extract 100 mg/kg, p.o.) exhibited maximum hepatoprotective activity and is the active fraction for hepatoprotective activity of L. acutangula fruit.. ...
Viruses regulate host metabolic networks to improve their survival. The molecules that are responsive to viral infection and regulate such metabolic changes are hardly known, but are essential for understanding viral infection. Here we identify a long noncoding RNA (lncRNA) that is induced by multiple viruses, but not by type I interferon (IFN-I), and facilitates viral replication in mouse and human cells. In vivo deficiency of lncRNA-ACOD1 (a lncRNA identified by its nearest coding gene Acod1, aconitate decarboxylase 1) significantly attenuates viral infection through IFN-I-IRF3 (interferon regulatory factor 3)-independent pathways. Cytoplasmic lncRNA-ACOD1 directly binds the metabolic enzyme glutamic-oxaloacetic transaminase (GOT2) near the substrate niche, enhancing its catalytic activity. Recombinant GOT2 protein and its metabolites could rescue viral replication upon lncRNA-ACOD1 deficiency and increase lethality. This work reveals a feedback mechanism of virus-induced lncRNA-mediated ...
Saputri, F. C., Astari, C., Janatry, D. A., ., A., & Kusmana, D. (2018). HEPATOPROTECTIVE EFFECT OF BELLAMYA JAVANICA: ASPARTATE TRANSAMINASE, ALANINE AMINOTRANSFERASE, AND ALKALINE PHOSPHATASE ACTIVITY, AND LIVER HISTOPATHOLOGY IN MICE INDUCED WITH CARBON TETRACHLORIDE. International Journal of Applied Pharmaceutics, 10(1), 203-207. https://doi.org/10.22159/ijap.2018. ...
The mission of IJRHS (An international, double-blind peer-reviewed Quarterly Journal) is to provide its readers with up-to-date information relevant to Health Sciences. The journal policy is to publish work deemed by peer reviewers to be a coherent and sound addition to scientific knowledge and to put less emphasis on interest levels, provided that the research constitutes a useful contribution to the field. The Journal publishes original research papers, review articles, case studies, reports and short communications in all aspects of Health Sciences.. ...
On starch-gel or polyacrylamide-gel electrophoresis of human serum, a supernumerary zone of aspartate aminotransferase activity may be demonstrated, migrating with the slow α2 protein zone. This appearance is due only to cationic aspartate aminotransferase, bound by α2-macroglobulin. The binding is strongly potentiated by dilute borate buffers.. ...
Body mass index, fasting insulin, and aspartate aminotransferase or alanine aminotransferase ratio also differed.. The team found that quantitative insulin sensitivity check index, and hyaluronic acid differed between the 2 groups.. Hyaluronic acid composite index for distinguishing steatosis from nonalcoholic steatohepatitis was calculated.. The team calculated this index by summing up risk factors that included age 50 years or more, and female gender.. Other risk factors assessed were aspartate aminotransferase 45 IU/l or more, and body mass index 30 mg/kg2 or more.. The index was also calculated by an aspartate aminotransferase/alanine aminotransferase ratio of 0.8 or more, and hyaluronic acid of 55 mcg/l or more.. The team determined the accuracy of the index by receiver operating characteristic analysis, and found this to be 0.76.. The presence of 3 or more risk factors had a sensitivity of 74% and a specificity of 66%.. In addition, the researchers noted that a hyaluronic acid cutoff of 45 ...
Aspartate aminotransferase (AST) catalyzes the transfer of the amino group from L-aspartate to α-Ketoglutarate to yield oxalacetate and L-glutamate. The oxalacetate undergoes reduction with simultaneous oxidation of NADH to NAD in the malate dehydrogenase (MDH) catalyzed indicator reaction. The resulting rate of decrease in absorbance at 340nm is directly proportional to the AST activity. Lactate dehydrogenase (LDH) is added to prevent interference from endogenous pyruvate which is normally present in serum.. ...
Disease Markers is a peer-reviewed, Open Access journal that publishes original research articles, review articles, and clinical studies related to the identification of disease markers, the elucidation of their role and mechanism, as well as their application in the prognosis, diagnosis and treatment of diseases.
Alanine aminotransferase (ALT) is an enzyme found mostly in liver and kidney cells. ALT is released into the blood when the liver is damaged. The ALT blood test is often ordered in conjunction with aspartate aminotransferase (AST) or as part of a liver panel to screen for and/or help diagnose liver disease.
Prof. Vivian I. Teichberg of the Institutes Neurobiology Department first demonstrated a possible way around these problems in 2003. Glutamate - a short-lived neurotransmitter - is normally all but absent in brain fluids. After a stroke or injury, however, the glutamate levels in brain fluid become a flood that over-excites the cells in its path and kills them. Instead of attempting to get drugs into the brain, Teichberg had the idea that one might be able to transport glutamate from the brain to the blood using the tiny "pumps," or transporters, on the capillaries that work on differences in glutamate concentration between the two sides. Decreasing glutamate levels in blood would create a stronger impetus to pump the substance out of the brain. He thought that a naturally-occurring enzyme called glutamate-oxaloacetate transaminase (GOT, for short) could "scavenge" blood glutamate, significantly lowering its levels. By 2007, Teichberg and his colleagues had provided clear evidence of the very ...
Blood tests remain a mainstay for the diagnosis of a patient with suspected liver disease or to stage patients with known liver disease. In general, the goal of such tests is to detect the release of products that are characteristic of the liver into the bloodstream, thereby indicating liver cell injury. Similarly, accumulation of molecules normally excreted via the biliary system is indicative of a failure in liver function, although further tests are necessary to assess the site at which the defect is occurring.. Two enzymes referred to as transaminases are easily measured in the serum, and are sensitive markers of liver cell injury. Alanine aminotransferease (ALT) is produced by hepatocytes, and when these cells are injured, its circulating levels are increased. Aspartate aminotransferase (AST) is similarly increased in the setting of hepatocellular injury, although it is less specific for liver disease because it is also produced by other tissues. For example, AST levels are increased ...
ALP (Alkaline phosphatase); ACP (Acid Phosphatase); GOT (glutamate-oxaloacetate transaminase) (EC 2.6.1.1); GPT (glutamate-pyruvate transaminase) (EC 2.6.1.2) ...
infected rats. The results show significant increase in specific activities of serum aspartate transaminase (AST) in infected untreated rats when compared with infected treated rats. However, there were no significant difference in serum and liver alanine transaminase (ALT). Liver Alkaline phosphatase (ALP) activities were significantly increased in infected untreated when compared with the infected treated rats. Results also show significant increase in specific activities of serum catalase (CAT) and Superoxide dismutase (SOD) in infected treated rats when compared with infected untreated rats. Whereas, there was no significant difference in specific activities of liver catalase, (CAT) and Superoxide dismutase (SOD) in infected treated rats when compared with infected untreated rats. We hereby conclude that ethylacetate extract of wheat has no toxic effect and can ameliorate the effect caused by T. brucei infection ...
Glutamate levels in the brain can be lowered through a naturally-occurring enzyme called glutamate-oxaloacetate transaminase in order to contain stroke damage.
Could Methotrexate sodium cause Aspartate aminotransferase increased? We studied 16,979 Methotrexate sodium users who have side effects from FDA and eHealthme. Among them, 92 have Aspartate aminotransferase increased. See what we found.
APRI (aspartate aminotransferase [AST]-to-platelet ratio index) is recommended as the preferred non-invasive test (NIT) to assess for the presence of cirrhosis (APRI score >2 in adults) in resource-limited settings. Transient elastography (e.g. FibroScan) or FibroTest may be the preferred NITs in settings where they are available and cost is not a major constraint ...
Glentham Life Sciences is a supplier of GZ1012 - Aspartate Transaminase (9000-97-9). Find catalogue prices, chemical data, technical specifications and MSDS documents.
Measures the overall function of the liver. Commonly used tests to check liver function are the alanine transaminase (ALT), aspartate aminotransferase (AST), albumin, and bilirubin tests. The ALT and AST tests measure enzymes that your liver releases in response to damage or disease. The albumin measures how well the liver creates albumin and the bilirubin tests measure how well the liver creates albumin, a protein, and how well it disposes of bilirubin, a waste product of the blood.. ...
20. The subject has any Screening Visit 1 abnormal laboratory value that suggests a clinically significant underlying disease or condition that may prevent the subject from entering the study; or the subject has: creatinine ,1.5 mg/dL, alanine aminotransferase (ALT) and/or aspartate aminotransferase (AST) ,2 times the upper limit of normal (×ULN), or total bilirubin ,2.0 mg/dL with AST/ALT elevated above the limits of normal values ...
20. The subject has any Screening Visit 1 abnormal laboratory value that suggests a clinically significant underlying disease or condition that may prevent the subject from entering the study; or the subject has: creatinine ,1.5 mg/dL, alanine aminotransferase (ALT) and/or aspartate aminotransferase (AST) ,2 times the upper limit of normal (×ULN), or total bilirubin ,2.0 mg/dL with AST/ALT elevated above the limits of normal values ...
en] The effects of weight loss on hormonal and biochemical blood parameters were measured monthly [carnitine, creatinine, urea, free T4 (fT4), total T4 (TT4), plasma alkaline phosphatases (ALP), aspartate aminotransferase (AST), alanine aminotransferase (ALT), potassium and total proteins] or bimonthly [cholesterol, triglycerides, non-esterified fatty acids (NEFA), insulin-like growth factor I (IGF-I), glucose, insulin] in eight obese Beagles dogs fed either a high protein dry diet, DP (crude protein 47.5%, on dry matter basis) or a commercial high fibre diet, HF (crude protein 23.8%, crude fibre 23.3%). The dogs were allotted to two groups according to sex and body weight (BW) and they were respectively fed with the DP or the control HF diet during 12-26 weeks, until they reach their optimal BW. The plasma basal triglycerides and cholesterol concentrations were decreased by the two diets but the difference was only significant for the DP diet. The plasma mean NEFA concentration increased ...
Description: Aspartate Aminotransferase (AST) is an enzyme produced by the liver. The AST test is commonly used to determine liver damage. A significant deviation from the normal range may require further evaluation by your physician ...
YiQiFuMai Powder Injection (YQFM) is widely used in clinical practice for the treatment of heart failure (HF). However, its functional molecular mechanism remains to be fully uncovered. Our present study aimed to elucidate the impact of YQFM and underlying mechanisms on coronary artery ligation (CAL)-induced HF. Our results exhibited that YQFM significantly mitigated CAL-induced HF via meliorating the left ventricular contractile function and reducing the serum content of creatine kinase MB (CK-MB), aspartate aminotransferase (AST), interleukin-6 (IL-6), troponin (Tn), myosin, myoglobin (MYO) and myocilin (MYOC). Then, the relevance between circulating omentin level and cardiac function was investigated and we found that serum omentin levels positively associated with ejection fraction and negatively correlated with NT-proBNP content. Further, the effect of YQFM on cardiac function and omentin change in 1, 7 and 14 days CAL-induced HF mice was evaluated and the omentin secretion in isolated ...
GOT2, human recombinant protein , Aspartate aminotransferase 2, mitochondrial, KAT4, KATIV, mitAAT validated in (PBV11368r-100), Abgent
Biosystems Aspartate Aminotransferase (AST-GOT) stabil olmak kaydıyla, yaygın kullanım alanına sahip Biosystems reaktif Ve Cihazlarının
Question - Test showed high SGOT and AST level. What should I do to reduce it?. Ask a Doctor about when and why Low-density lipoprotein is advised, Ask a Gastroenterologist
Protective Effect of 6 Food Mixed-Extract on the CCl4-Induced Hepatic Damage in Rats liver;hematological;tetrachlorid;biochemical;hepatic damage;immunological; The objective of this study was to examine the biochemical parameters of hepatic function such as serum level of ALT (alanine aminotransferase), AST (aspartate aminotransferase), ALP (alkaline phosphatase), LDH (lactate dehydrogenase), and content of TG (triglyceride) and cholesterol, and tissue immunological changes of the $CCl_4$-treated rats with administration of the mixed sample extract (MSE). The liver weight in $CCl_4$-administered experimental control group (EC) was slightly higher than that of normal control (NC) group. Hepatic damage parameters (ALT, AST, ALP, LDH & TG) in serum of the EC group were significantly higher than those in serum of the NC and silymarin-treated positive control (PC) group. On the other hand, these hepatic damage parameters of MSE-treated experimental (E1 & E2) groups were significantly lower than
Elevated alt and ast levels cancer - What does alk, ast, ALT high levels mean if they are high? Is it cancer? Not necessarily. These are liver function tests. When they are high, it means there is some degree of liver damage. High levels are seen in viral or alcohol hepatitis or drug toxicity with tylenol (acetaminophen) or some herbal preparations or fatty liver. Even though cancer can cause increased liver tests, other more common causes as listed above should be considered first.
Background: Multiple Sclerosis (MS) is associated with many pathological changes and liver damage is one of the most important consequences. This study aimed to investigate the effect of aerobic exercise and the royal jelly on AST, ALT, and ALP enzymes in the patients with multiple sclerosis. Materials and Methods: In ...
Effect of a Dmbt1 deletion on ALT and AST levels after feeding a Western style diet in Dmbt1-/- and Dmbt1+/+ mice. Activity levels of (A) alanine-aminotrans
(elevated ld, ast || alt) Evaluation of a lft pattern not typical of liver disease (elevated ld, ast || alt) possible causes further investigations muscle disorders myocardial infarction ck...Aspartate aminotransferase (ast) in refrigerated serum ... Aspartate aminotransferase (ast) in refrigerated serum - nhanes 2001-2002 collaborative laboratory services, l.l.c. 0. public release data set information
Hi Am having High SGOT(AST),SGPT(ALT) & Thyroid SGOT (AST) - Serum =| 61.9 (Ranges 5 - 40) SGPT (ALT) - Serum =| 156.5 (Ranges 5 - 40) TSH - Serum =| 7.67 ...
L-FABP is predominantly found in the liver and is thought to be involved in the regulation of lipid transport (2) and metabolism. At present ALT and Aspartate Aminotransferase are used to both detect the presence of liver disease and monitor its progression however more sensitive markers are required due to the lack of specificity of Aspartate Aminotransferase and the fact plasma levels of ALT increase too late (12). Research has shown L-FABP levels to rise significantly after cell damage; levels are also increased a lot earlier than ALT making it a promising new biomarker. (13 ...
lmi:LMXM_34_0820 K14454 aspartate aminotransferase, cytoplasmic [EC:2.6.1.1] , (RefSeq) putative aspartate aminotransferase (A) MSTQAAMTTTERWQKIQGRAPDPIFELAKRAAAAKGPKANLVIGAYRDEQGLPYPLRVVR KAEQLLLDMNLNYEYLPISGYQPFIDEAVKMIYGDTVELENLVAVQTLSGTGALSLGAKL LTHVFDAEKTPIYLADPTWPNHYSIVKAAGWKDIRTYAYYDHKTLGLDFEGMKKDILAAP DGSVFLLHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSLDTDAYAAR LFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIRAEYTCPPAH GAHLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGRWEHVINQIGMFS FLGLSKEQCEYCQNHNIFITLSGRANIAGLTHETALMLAQTINDAVRNVNRK ...
Hasilnya menunjukkan bahwa pemberian fucoidan menghasilkan proteksi bermakna (p,0,05) terhadap ulserasi dengan menghambat alterasi akut AST (aspartate transaminase), ALT (alanine transaminase), sitokin, dan kadar glikogen dalam lambung. Namun, terdapat peningkatan kadar interferon gamma pada populasi yang diberikan fucoidan ...
aspC; putative aspartate aminotransferase ASPC (transaminase A) (ASPAT); K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] ...
Rabbit polyclonal Aspartate Aminotransferase antibody. Validated in WB and tested in Cow. Immunogen corresponding to recombinant full length protein.
KidsHealth says that a comprehensive metabolic panel includes tests for three liver enzymes: alanine aminotransferase, alkaline phosphatase and aspartate aminotransferase. Each enzyme has a different...
mmi:MMAR_0610 K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] , (GenBank) aspC; aspartate aminotransferase AspC (A) MDSDETMVDVTTHQLPWHASSHQRQRSFAQSSKLQDVLYEIRGPVHQQAARLETEGHRIL KLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFDV DDVYLGNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTSLAGGTPVHYLCDETQDWQ PDIADLESKITERTKALVIINPNNPTGAVYSHEILTQMVELARKHELLLLADEIYDKILY DDAKHISVATLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGISLLANMR LCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPKGALYAF PRLDPEVYDIADDEQLVLDLLLSEKILVTQGTGFNWPEPDHLRLVTLPWSRDLAAAIERL GNFLVSYRQ ...
AccessGUDID - AST (05055273208245)- The AST test system is intended for the quantitative in vitro determination of Aspartate Aminotransferase (AST) in serum or plasma.
Helpful answers from trusted Doctors on causes, diagnosis, symptoms, treatment, and more: Discover the potential causes and solutions of high SGOT and SGPT levels with Dr. Mays.
BioAssay record AID 887031 submitted by ChEMBL: Open TG-GATES: Regimen: Daily Repeat; Time: 4 day; Dose: High; Route: Gavage | Dataset: Biochemistry; Assay: AST (Aspartate Aminotransferase); Study_ID: 543/13.
BioAssay record AID 896326 submitted by ChEMBL: Open TG-GATES: Regimen: Daily Repeat; Time: 29 day; Dose: Low; Route: Gavage | Dataset: Biochemistry; Assay: AST (Aspartate Aminotransferase); Study_ID: 350/8.
Curien G, Bastien O, Robert-Genthon M, Cornish-Bowden A, Cárdenas ML, Dumas R; Understanding the regulation of aspartate metabolism using a model based on measured kinetic parameters.; Mol Syst Biol, 2009 PubMed Europe PMC ...
I have been lifting for about 8-9 months. I am 15 years old, 170lbs, and natural Current numbers: Bench:235lb Squat:285lb Deadlift:350lb (i do it once
Mental illnesses, especially depression and anxiety disorders, are common in the United States and Europe according to two new major research reports. They often are untreated, and they are associated with chronic, life threatening health problems, including heart disease.
1. Cytoplasmic aspartate aminotransferase was isolated and purified from human heart with a final specific activity of 236 units/mg of protein.. 2. Three distinct peaks of aspartate aminotransferase activity were detected by isoelectric focusing with isoelectric points of 5.46, 5.60 and 5.71. Two minor subforms were also noted as shoulder patterns with pI 5.2 and 5.8.. 3. These electrophoretic characteristics are similar to previous findings of multiple molecular forms detected in human liver and erythrocytes.. ...
The effect of Bacillus additive on immunity and antioxidant activities of grass carp (Ctenopharyngodon idellus) was studied in this experiment. Animals of the control group were fed the basal diet and those of treatment group were fed the basal diet augmented with Bacillus additive at a dose of 105 Colony Forming Units per gram (CFU g-1) feed. Data showed that serum immunity parameters including IgM, complement C3 and Alkaline Phosphatase (AKP) significantly increased (p,0.05) by 30.77, 34.62 and 107.79% in the treatment group. However, there was no significant difference in serum total protein, globulin, albumin, A/G ratio, Lysozyme (LZM), Glutamic Oxaloacetic Transaminase (GOT) and Glutamic Pyruvic Transaminase (GPT) activities. Serum antioxidant parameters such as serum Glutathione (GSH), Total Antioxidant Capacity (T-AOC), Superoxide Dismutase (SOD) and Glutathione Peroxidase (GSH-Px) activities significantly (p,0.05) enhanced by 32.76, 41.75, 20.06 and 11.30%, respectively and ...
The effect of Bacillus additive on immunity and antioxidant activities of grass carp (Ctenopharyngodon idellus) was studied in this experiment. Animals of the control group were fed the basal diet and those of treatment group were fed the basal diet augmented with Bacillus additive at a dose of 105 Colony Forming Units per gram (CFU g-1) feed. Data showed that serum immunity parameters including IgM, complement C3 and Alkaline Phosphatase (AKP) significantly increased (p,0.05) by 30.77, 34.62 and 107.79% in the treatment group. However, there was no significant difference in serum total protein, globulin, albumin, A/G ratio, Lysozyme (LZM), Glutamic Oxaloacetic Transaminase (GOT) and Glutamic Pyruvic Transaminase (GPT) activities. Serum antioxidant parameters such as serum Glutathione (GSH), Total Antioxidant Capacity (T-AOC), Superoxide Dismutase (SOD) and Glutathione Peroxidase (GSH-Px) activities significantly (p,0.05) enhanced by 32.76, 41.75, 20.06 and 11.30%, respectively and ...
Oxaloacetic Acid directory ☆ Oxaloacetic Acid manufacturers, suppliers ☆ Oxaloacetic Acid buyers, importers, wholesalers, distributors
The impact of adolescent nonalcoholic fatty liver disease (NAFLD) on health, independent of fat mass, is unclear.The objective of the study was to determine the independent (of total body fat) association of ultrasound scan (USS)-determined NAFLD with liver fibrosis, insulin resistance, and dyslipidemia among healthy adolescents.This was a cross-sectional analysis in participants from a UK birth cohort.One thousand eight hundred seventy-four (1059 female) individuals of a mean age of 17.9 years participated in the study.USS assessed liver stiffness (shear velocity, an indicator of fibrosis) and volume, fasting glucose, insulin, triglycerides, low-density lipoprotein cholesterol, high-density lipoprotein cholesterol, alanine amino transferase, aspartate amino transferase, γ-glutamyltransferase, and haptoglobin.The prevalence of NAFLD was 2.5% [95% confidence interval (CI) 1.8-3.3] and was the same in females and males. Dual-energy X-ray absorptiometry determined total body fat mass was strongly ...
BIOLABO, AST/TGO - ALT/TGP colorimetric Method, End point colorimetric method. Reagent for quantitative determination of Alanine amino transferase (ALT) and Aspartate amino transferase (AST) activities in human serum and plasma. Reading : End Point at 505 nm.
Patients and methods: In this cross sectional study conducted at diabetic and endocrine centre in A-Sadr medical city in Najaf, from February 2014 to March 2015 , a total of 120 type 2 diabetic patients were included (Male 39 and Female 81). Several different factors were studied like age, sex, type of treatment, body mass index and control of diabetes by measuring glycated hemoglobin. Liver transaminases (alanine aminotransferase and aspartate aminotransferase) was done to all those patients and the results are compared with these different factors that mention above. Ultrasonography was done to all the patients searching for any signs of non-alcoholic fatty liver disease like increase in liver size or echogenicity and compared with these factors ...
Reference: Ilin V.S., Kovner F.Ia., Hexokinase, aspartate and alanine aminotransferase activity in transplanted rat sarcomas, Voprosy meditsinskoi khimii, 1971, vol: 17(6), 644-649 ...
This page includes the following topics and synonyms: Alanine Aminotransferase, Serum Glutamic Pyruvic Transaminase, Glutamic Pyruvate Transaminase, Serum ALT, ALT, SGPT, Aminotransferase.
This study was performed to investigate the effect of feeding garcinia cambogia extract(HCA) and L-carnitine and exercise on body weight and lipid metabolism in rats. Forty-eight male rats(Charles River CD(SD) IGS) of eight weeks and weighing 323.5±2.4g were raised for two months with high fat diet(40% fat as calorie) to induce obesity. After induction of obesity, rats weighing 552.8±5.8g were blocked into eight groups according to body weight and raised for six weeks with diet containing HCA and L-carnitine and swimming. Animals were given diet and water ad libitum. Food intake and body weight gain were recorded for experimental period and perirenal fat pad, epididymal fat pad and brown adipose tissue were weighed. Plasma aspartate aminotransferase(AST) and alanine aminotransferase (ALT) activities were measured to examine the safety of experimental compound in rats and plasma total protein and albumin levels were analyzed to determine the protein nutritional state of rats. And in order to ...
FDAs review of adverse event reports supports a relationship between the use of various body-building products suspected to contain steroids and serious liver injury requiring hospitalization. A majority of the cases involved elevated liver enzymes (i.e., alanine aminotransferase (ALT), aspartate aminotransferase (AST), and alkaline phosphatase (AlkP)), which are indicators of liver injury. In some cases, consumers were taking multiple body-building products, which precludes the ability to limit the findings to a specific product or ingredient and raises the concern that the harmful effects may be caused by an interaction between the two products.. Drug-induced liver injury (DILI) is a known possible harmful effect of using anabolic steroid-containing products. In addition, anabolic steroids (or AAS) may cause other serious adverse effects such as abnormal fat and cholesterol in the blood, mood disorders, androgenic effects (acnes, baldness, excessive hair growth in females), gonadal ...
A group of blood tests used to detect, evaluate, and monitor liver disease or damage. A liver function test measures enzymes, proteins, and other substances that are produced or excreted by the liver, such as alanine aminotransferase (ALT), alkaline phosphatase (ALP), aspartate aminotransferase (AST), gamma-glutamyl transpeptidase (GGT), bilirubin, and albumin.
The assessment of liver fibrosis in ESRD patients with chronic viral hepatitis is considered essential for indication of therapy, transplantation and prognosis.[17,18,19] It is also important to rule out liver cirrhosis, which if present, constitutes a contraindication for lone kidney transplantation because of poor post-transplant survival. Liver biopsy is the gold standard method for staging and grading of liver disease, but it is an invasive procedure in which the frequency of pain at biopsy site is reportedly 20%, while the incidence of mortality and other serious complications have been reported to be 0.01% and 0.3-0.57% respectively.[20-21] On the other hand, liver biopsy represents only 1/50,000 portion of the entire liver, due to which error of sampling is a likely possibility. To overcome this limitation, it is essential to use a thick needle (18-G) and collect 2 or more samples of sufficient length for correct assessment of fibrosis. Achieving this goal is difficult because of ...
Introduction: Glutathione (GSH) protects the tissue and cell from oxidative injury. Objectives: In the current study, we investigated the possible effects of GSH on liver markers, oxidative stress and inflammatory indices in rat with renal ischemia reperfusion (RIR) injury. Materials and Methods: Twenty-four adult male Wistar rats were divided into 3 groups (n=8). Group I (the control group), group II (the RIR group) received saline (0.25 mL/d, intraperitoneally; i.p.), group III as the RIR group that received GSH (100 mg/kg/d, i.p.). The treatment with saline or GSH began daily 14 days before RIR induction. RIR was induced by clamping renal pedicles for 45 minutes and 24 hours of reperfusion. Results: RIR significantly increased the serum level of nitric oxide (NO), the serum activities of aspartate aminotransferase (AST), alkaline phosphatase (ALP), gamma-glutamyltransferase (GGT), the serum and renal levels of malondialdehyde (MDA), and the serum activity of myeloperoxidase (MPO). However, RIR
လူအေတာ္မ်ားမ်ား အသဲအဆီဖံုးေရာဂါ ရွိေနေပမဲ့ လူေကာင္းလို ေနၾကေသးတယ္။ စမ္းသပ္တဲ့အခါ အသဲ ၾကီးေနတာ ေတြ႔ရႏိုင္တယ္။ အသဲလုပ္ငန္းကိုသိဘို႔ ေသြးစစ္ရင္ Alanine transaminase (ALT) နဲ႔ Aspartate aminotransferase (AST) ေခၚတဲ့ (အင္ဇိုင္းမ္) ေတြ မ်ားေနမယ္။ (ALT) နဲ႔ (AST) (အင္ဇိုင္းမ္) ေတြ မ်ားေနတာက အသဲေရာဂါ ရမွသာ ျဖစ္တာ မဟုတ္ပါ။ ၾကြက္သားေရာဂါေၾကာင့္လဲ ရေစတယ္။ CT scan နဲ႔ MRI လုပ္ရင္ ပိုသိႏိုင္တယ္။ Liver biopsy အသဲက အသားစ ထုတ္ယူစစ္ေဆးမွ ...
Lupinus species and their derivatives are good candidates to be used as hypoglycaemic agents. The aim of this study was to evaluate the effects of supplementation with Lupinus albus dry extract in type 2 diabetic patients. The study included 47 adult patients (21 men and 26 women) with type 2 diabetes. While consuming their usual medication, patients received a daily dose of 400 mg of Lupinus albus dry extract during 12 weeks. Fasting and post meal test glucose and insulin were measured at baseline and after 2 and 12 weeks. Plasma lipids, Alanine and Aspartate aminotransferases activities and glycated haemoglobin were assessed at baseline and at the end of the supplementation period. Compared to baseline values, fasting and postprandial plasma glucose levels were decreased at 2 and 12 weeks. Blood glucose area under the curve significantly decreased after 2 weeks (p|0.01) and 12 weeks (p|0.05) of lupine administration. Fasting insulin concentrations (10.3±5.34 vs. 11.9±6.58; p|0.05) and homeostasis
Alanine aminotransferase (ALT), a sensitive indicator of liver cell injury, has been used to identify patients with liver disease for almost 50 years (1). This cytosolic enzyme, which is found in many organs, catalyzes the transfer of the α-amino group from alanine to α-ketoglutaric acid (2). Alanine aminotransferase levels are particularly high in the liver. For detection of liver diseases, ALT is thought to be a more specific indicator than aspartate aminotransferase, an enzyme found in cytosol and mitochondria (3). Serum levels of ALT normally are low-167 to 667 nkat/L (10 to 40 U/L) in most laboratories; however, normal values may vary greatly among laboratories. Elevated serum ALT levels help identify many types of liver diseases in patients and were widely used in the 1980s to screen blood donors for non-A, non-B hepatitis. Any type of liver cell injury can modestly increase ALT levels. Values up to 5000 nkat/L (300 U/L) are considered nonspecific. Marked elevations-that is, ALT levels ...
abbr. (in clinical biochemistry): ALT; EC 2.6.1.2; systematic name: l‐alanine:2‐oxoglutarate aminotransferase; other names: glutamic‐pyruvic transaminase; glutamic‐alanine transaminase. An enzyme that catalyses the reversible reaction:. l‐alanine + 2‐oxoglutarate = pyruvate + l‐glutamate.. [...] ...
HCV patients were divided into two groups over a 12 month period. Group A received Peg-IFN-a 2b plus ribavirin plus L-carnitine, and Group B received Peg-IFN-a and ribavirin. Red cell count, hemoglobin, white cell count, platelets, bilirubin, alanine aminotransferase (ALT), aspartate aminotransferase (AST), and viremia were tested in all subjects ...
Alcohol is thought to cause injury to the mitochondria which contains AST but not ALT. In addition, in chronic alcoholics, pyridoxine (vitamin B6) deficiency may reduce the synthesis of ALT more than AST because the former is more B6-dependent (1). AST/ALT ratio |1 may be more common in advanced alcohol liver disease (e.g. cirrhosis) than…
Alanine aminotransferase measurements are used in the diagnosis and treatment of certain liver diseases (e.g. viral hepatitis and cirrhosis) and heart diseases. In viral hepatitis and other forms of liver disease associated with hepatic necrosis, serum ALT levels are elevated even before clinical signs and symptoms of the disease ...
SGPT/Serum Glutamic Pyruvic Transaminase (Alanine Transaminase /ALT) adalah enzim yang ditemukan terutama di sel-sel hati dan ginjal, dan dalam jumlah yang lebih kecil ditemukan di jantung dan otot ...
Everything you need to know about Alanine Aminotransferase (ALT) and find out which of our blood tests check Alanine Aminotransferase levels.
SGPT, or serum glutamic pyruvic transaminase, is an enzyme that enters the blood when the heart or liver are damaged, according to MedicineNet. When a condition like hepatitis C causes damage to the...
An experiment was conducted to detect the relationship between some serum enzyme activities,
i.e. lactate dehydrogenase (LDH) and creatine phosphokinase (CPK) enzymes and liver functions...
In this study aminotransferase inhibitors were used to determine the relative importance of different aminotransferases in providing nitrogen for de novo glutamate synthesis in the retina. Aminooxyacetate, which inhibits all aminotransferases, blocke
OBJECTIVES: Non-invasive fibrosis scores are widely used to identify/exclude advanced fibrosis in patients with non-alcoholic fatty liver disease (NAFLD). However, these scores were principally developed and validated in patients aged between 35 and 65 years of age. The objective of this study was to assess the effect of age on the performance of non-invasive fibrosis tests in NAFLD.. METHODS: Patients were recruited from European specialist hepatology clinics. The cohort was divided into five age-based groups: ≤35 (n=74), 36-45 (n=96), 46-55 (n=197), 56-64 (n=191), and ≥65 years (n=76), and the performance of the aspartate aminotransferase (AST)/alanine transaminase (ALT) ratio, fibrosis 4 (FIB-4), and NAFLD fibrosis score (NFS) for advanced fibrosis (stage F3-F4) for each group was assessed using liver biopsy as the standard.. RESULTS: Six hundred and thirty-four patients were included. The diagnostic accuracy of the AST/ALT ratio was lower than NFS and FIB-4 in all the age groups. The ...
OBJECTIVES: Non-invasive fibrosis scores are widely used to identify/exclude advanced fibrosis in patients with non-alcoholic fatty liver disease (NAFLD). However, these scores were principally developed and validated in patients aged between 35 and 65 years of age. The objective of this study was to assess the effect of age on the performance of non-invasive fibrosis tests in NAFLD.. METHODS: Patients were recruited from European specialist hepatology clinics. The cohort was divided into five age-based groups: ≤35 (n=74), 36-45 (n=96), 46-55 (n=197), 56-64 (n=191), and ≥65 years (n=76), and the performance of the aspartate aminotransferase (AST)/alanine transaminase (ALT) ratio, fibrosis 4 (FIB-4), and NAFLD fibrosis score (NFS) for advanced fibrosis (stage F3-F4) for each group was assessed using liver biopsy as the standard.. RESULTS: Six hundred and thirty-four patients were included. The diagnostic accuracy of the AST/ALT ratio was lower than NFS and FIB-4 in all the age groups. The ...
As of November 2004, nearly 5,000 pulmonary hypertension patients across Europe were included in the Tracleer® PMS system, representing 79% of patients receiving bosentan at that time. The calculated exposure to bosentan represented 3,416 patient-yrs, a ,50-fold increase over the 59 patient-yrs of experience from the two pivotal trials 4, 5. A total of 4,623 patients were naïve to bosentan treatment and, of these, 352 had elevated liver aminotransferases, corresponding to a crude incidence of 7.6% and an annual rate of 10.1%, which was consistent with the crude rates observed in the two pivotal trials of bosentan (12.8%) and in the eight placebo-controlled bosentan trials included in the safety assessment and registration submission (11.2%) 4, 5, 8. Bosentan was discontinued due to elevated aminotransferase levels in 150 patients, representing 3.2% of all bosentan-naïve patients. The incidence of elevated aminotransferases was similar in most subgroups although higher in patients with PAH ...
Rat liver mitochondrial aspartate aminotransferase (a homodimer) was shown to catalyse a β-lyase reaction with three nephrotoxic halogenated cysteine S-conjugates [S-(1,1,2,2-tetrafluoroethyl)-l-cysteine, S-(1,2-dichlorovinyl)-l-cysteine and S-(2-chloro-1,1,2-trifluoroethyl)-l-cysteine], and less effectively so with a non-toxic cysteine S-conjugate [benzothiazolyl-l-cysteine]. Transamination competes with the β-lyase reaction, but is not favourable. The ratio of β elimination to transamination in the presence of S-(1,1,2,2-tetrafluoroethyl)-l-cysteine and 2-oxoglutarate is ,100. Syncatalytic inactivation by the halogenated cysteine S-conjugates is also observed. The enzyme turns over approx. 2700 molecules of halogenated cysteine S-conjugate on average for every monomer inactivated. Kidney mitochondria are known to be especially sensitive to toxic halogenated cysteine S-conjugates. Evidence is presented that 15-20% of the cysteine S-conjugate β-lyase activity towards ...
This study was carried out to evaluate the radioprotective potential of aqueous extract of seeds of Aframomum melegueta (A.M.) against gamma radiation-induced (6Gy) liver damage in male Wistar rats. Thirty male rats were randomly distributed into six groups of five animals each and aqueous extract of A.M. was administered at a dose of 200 or 400 mg/kg b. wt., orally for 2 weeks prior to irradiation and 4 weeks after irradiation, when they were sacrificed. The hepatic antioxidant status; reduced glutathione (GSH), catalase (CAT) and glutathione peroxidase (GPx) as well as the extent of lipid peroxidation (LPO) were estimated. The activities of serum alanine aminotransferase (ALT) and aspartate aminotransferase (AST) were determined and histological examination was carried out. Exposure of animals to irradiation significantly increased LPO levels in comparison with the normal control group, reduced the level of GSH as well as CAT and GPx activity. On the other hand, there was a significant ...
After 10 months of imatinib therapy, the patient was referred to our department owing to elevated aminotransferase level without any specific symptoms for several months. He denied any causal alcohol consumption or medication. His physical examination was normal. The laboratory tests revealed the following values: white blood cell count, 4,770/µL; eosinophil count, 467/µL (range, ,500/µL); hemoglobin, 13.8 g/µL; platelet count, 184 K/µL; total protein, 6.34 g/dL; albumin, g/dL, total bilirubin (TB), 1.59 mg/dL; direct bilirubin, 0.31 mg/dL; aspartate aminotransferase (AST), 239 IU/L; alanine aminotransferase (ALT), 393 IU/L; alkaline phosphatase, 194 IU/L (range, 30-120 IU/L); gamma glutamyl transferase, 52 IU/L (range, ,50 IU/L); blood urea nitrogen, 12 mg/dL; creatinine, 1 mg/dL; and international normalized ratio, 1.06. Serologic markers for viral hepatitis, including hepatitis A virus, hepatitis B virus, and hepatitis C virus, were negative. There was no evidence of acute viral ...
Liver enzyme elevation is an important and common adverse effect among patients with immune-mediated diseases who receive tumour necrosis factor inhibitors (anti-TNF), and has various causes. Hence, we evaluated the relative risks of developing liver enzyme elevation in anti-TNF users with differing hepatitis B virus (HBV) infection status. At a hospital in central Taiwan, 407 patients with rheumatoid arthritis, ankylosing spondylitis, or psoriasis/psoriatic arthritis received anti-TNF therapy between 1 January 2004 and 30 June 2012. We performed a nested case-control study (n = 368) of cases with serum alanine aminotransferase (ALT) | 40 international units/L ≤ 12 months after starting anti-TNF therapy, and corresponding controls without liver enzyme elevation. Conditional logistic regression was used to evaluate associations between liver enzyme elevation and HBV serostatus, as well as other risk factors. Thirty cases were compared to 338 controls. After adjustment for potential confounders, HBV
Aoki, Y.-h., Ohkoshi, S., Yamagiwa, S., Yano, M., Takahashi, H., Waguri, N., Igarashi, K., Sugitani, S.-i., Takahashi, T., Ishikawa, T., Kamimura, T., Wakabayashi, H., Watanabe, T., Matsuda, Y., Nomoto, M. and Aoyagi, Y. (2011), Characterization of elevated alanine aminotransferase levels during pegylated-interferon α-2b plus ribavirin treatment for chronic hepatitis C. Hepatology Research, 41: 118-125. doi: 10.1111/j.1872-034X.2010.00749.x ...
Adrenal gland dysfunction, resulting in hormonal imbalance.. These are just some of the causes of elevated liver enzymes. A host of other conditions may lead to a high liver enzymes count in the blood.. Elevated liver enzymes in pregnancy. Increased liver enzymes during pregnancy may occur due to hereditary liver disorders and viral hepatitis, which can prove fatal to both mother and infant. Elevated liver enzymes during pregnancy may occur due to medical conditions such as ICP (Intrahepatic Choletasis of Pregnancy) and HELLP syndrome. This acronym stands for the breakdown of red blood cells (hemolysis), elevated liver enzymes, and low platelets (low chance of blood clotting). In most cases, pregnancy hormones, immune disorders, and a family history of liver problems cause high liver enzymes in pregnancy and related conditions. Hormonal imbalances during pregnancy may also increase the risk of nonalcoholic fatty liver disease, causing increased liver enzymes in pregnancy.. Elevated liver enzymes ...
TY - JOUR. T1 - Methane attenuates hepatic ischemia/reperfusion injury in rats through antiapoptotic, anti-inflammatory, and antioxidative actions. AU - Ye, Zhouheng. AU - Chen, Quyang. AU - Zhang, Rongjia. AU - Nakao, Atsunori. AU - Fan, Danfeng. AU - Zhang, Ting. AU - Gu, Zhengyong. AU - Tao, Hengyi. AU - Sun, Xuejun. PY - 2015/9/1. Y1 - 2015/9/1. N2 - Hepatic ischemia/reperfusion (I/R) injury, which occurs in various diseases, introduces severe tissue damage and liver dysfunction. However, no promising therapies for such a significant condition currently exist. Methane has been suggested to exert a protective effect against intestinal I/R injury. In this study, we introduced methane to treat hepatic I/R injury to show its promising protective effect. Also, intraperitoneal injection with methane-rich saline, which could have potential clinical applications, was applied as a new method. Partial liver warm ischemia was applied in Sprague-Dawley rats for 60 min followed by succedent reperfusion. ...
We read with great interest the recent chronic hepatitis B (CHB) (AASLD) practice guideline written eminently by 2 of the most experienced hepatologists in CHB.1 Hepatitis B e antigen (HBeAg)-negative CHB is characterized by increased levels of alanine aminotransferase (ALT)/ aspartate aminotransferase (AST), serum hepatitis B virus (HBV)-DNA , 2,000 IU/mL, and moderate/severe necroinflammation, whereas the inactive hepatitis B surface antigen (HBsAg) carrier state is defined as persistently normal ALT/AST on ≥3-4 determinations made every 3 months (then every 6-12 months) and HBV-DNA , 2,000 IU/mL.1. According to our unpublished, recent, prospective cohort of 150 HBeAg-negative chronic HBV patients with a close biochemical and virological follow-up, a substantial proportion (22% of cases or 28% of 228 serum samples tested) of 85 patients with persistently normal ALT/AST levels have HBV-DNA , 2,000 IU/mL (15% at 2,000-5,000 IU/mL and 7% at 5,000-20,000 IU/mL). Such patients are excluded from ...

Glutamic oxaloacetic transaminase - definition of glutamic oxaloacetic transaminase by The Free DictionaryGlutamic oxaloacetic transaminase - definition of glutamic oxaloacetic transaminase by The Free Dictionary

Related to glutamic oxaloacetic transaminase: aspartate aminotransferase, glutamic pyruvic transaminase ThesaurusAntonyms ... replaced in Australia with aspartate aminotransferase--AST), serum glutamic pyruvic transaminase (SGPT) (replaced in Australia ... aminopherase, aminotransferase, transaminase - a class of transferases that catalyze transamination (that transfer an amino ... with alanine aminotransferase--ALT), alkaline phosphatase (ALP), and gamma-glutamyl transpeptidase (GGT).. Clinical evaluation ...
more infohttp://www.thefreedictionary.com/glutamic+oxaloacetic+transaminase

Aspartate Aminotransferase (AST)Aspartate Aminotransferase (AST)

... Test Overview. An aspartate aminotransferase (AST) test measures the amount of this enzyme in ... The aspartate aminotransferase (AST) test is more effective than the alanine aminotransferase (ALT) test for detecting liver ... An aspartate aminotransferase (AST) test measures the amount of this enzyme in the blood. Results are usually available within ... The AST test may be done at the same time as a test for alanine aminotransferase, or ALT. The ratio of AST to ALT sometimes can ...
more infohttps://www.rexhealth.com/rh/health-library/document-viewer/?id=hw20331

Aspartate Aminotransferase (AST) | Definition | AIDSinfoAspartate Aminotransferase (AST) | Definition | AIDSinfo

Aspartate aminotransferase may be measured as part of a liver function test. ... Aspartate aminotransferase may be measured as part of a liver function test. ... Aspartate Aminotransferase (AST) Aspartate Aminotransferase Speaker Synonym(s): Serum Glutamic-Oxaloacetic Transaminase ...
more infohttps://aidsinfo.nih.gov/understanding-hiv-aids/glossary/3367/aspartate-aminotransferase

Aspartate Aminotransferase, Serum or PlasmaAspartate Aminotransferase, Serum or Plasma

... ,ARUP Laboratories is a national reference laboratory and a worldwide leader in ... Aspartate Aminotransferase (AST) (GOT). 2. Aspartate Aminotransferase (AST) (GOT) IFCC WITH P5P. 3. Alanine Aminotransferase, ...
more infohttp://www.bio-medicine.org/medicine-products/Aspartate-Aminotransferase--Serum-or-Plasma-21287-1/

Aspartate aminotransferase (AST) blood test: MedlinePlus Medical EncyclopediaAspartate aminotransferase (AST) blood test: MedlinePlus Medical Encyclopedia

The aspartate aminotransferase (AST) blood test measures the level of the enzyme AST in the blood. ... Aspartate aminotransferase (AST, aspartate transaminase, SGOT) - serum. In: Chernecky CC, Berger BJ, eds. Laboratory Tests and ... The aspartate aminotransferase (AST) blood test measures the level of the enzyme AST in the blood. ...
more infohttps://medlineplus.gov/ency/article/003472.htm

Aspartate aminotransferase - Xiphophorus maculatus (Southern platyfish)Aspartate aminotransferase - Xiphophorus maculatus (Southern platyfish)

tr,A0A3B5QAR0,A0A3B5QAR0_XIPMA Aspartate aminotransferase OS=Xiphophorus maculatus OX=8083 PE=4 SV=1 ... IPR004839 Aminotransferase_I/II. IPR000796 Asp_trans. IPR004838 NHTrfase_class1_PyrdxlP-BS. IPR015424 PyrdxlP-dep_Trfase. ... IPR004839 Aminotransferase_I/II. IPR000796 Asp_trans. IPR004838 NHTrfase_class1_PyrdxlP-BS. IPR015424 PyrdxlP-dep_Trfase. ...
more infohttps://www.uniprot.org/uniprot/A0A3B5QAR0

Aspartate Aminotransferase (AST) Test: Purpose, Risks, and ResultsAspartate Aminotransferase (AST) Test: Purpose, Risks, and Results

Your doctor can order an AST test to check the level of aspartate aminotransferase in your blood. Abnormal results may be a ... Aminotransferase (AST) is an enzyme thats present in various parts of your body. ... What is aspartate aminotransferase?. Aminotransferase (AST) is an enzyme thats present in various tissues of your body. An ... An alanine aminotransferase (ALT) test measures the level of ALT in your blood. ALT is an enzyme made by cells in your liver. ...
more infohttps://www.healthline.com/health/ast

Anti-Aspartate Aminotransferase antibody (ab232750) | AbcamAnti-Aspartate Aminotransferase antibody (ab232750) | Abcam

Rabbit polyclonal Aspartate Aminotransferase antibody. Validated in WB and tested in Cow. Immunogen corresponding to ... Anti-Aspartate Aminotransferase antibody (ab232750) at 2 µg/ml + Recombinant cow Aspartate Aminotransferase protein.. Predicted ... Primary - Rabbit Anti-Aspartate Aminotransferase antibody (ab232750) WB Secondary - Goat Anti-Rabbit IgG H&L (HRP) (ab205718) ... All lanes : Anti-Aspartate Aminotransferase antibody (ab232750) at 2 µg/ml. Lane 1 : Cow brain lysate. Lane 2 : Cow heart ...
more infohttps://www.abcam.com/aspartate-aminotransferase-antibody-ab232750.html

Anti-Aspartate Aminotransferase antibody (ab104265) ReferencesAnti-Aspartate Aminotransferase antibody (ab104265) References

References for Abcams Anti-Aspartate Aminotransferase antibody (ab104265). Please let us know if you have used this product in ...
more infohttp://www.abcam.com/aspartate-aminotransferase-antibody-ab104265-references.html

Aspartate Aminotransferase (AST) - Adventist HealthCareAspartate Aminotransferase (AST) - Adventist HealthCare

Aspartate Aminotransferase (AST). Test Overview. An aspartate aminotransferase (AST) test measures the amount of this enzyme in ... The aspartate aminotransferase (AST) test is more effective than the alanine aminotransferase (ALT) test for detecting liver ... An aspartate aminotransferase (AST) test measures the amount of this enzyme in the blood. Results are usually available within ... The AST test may be done at the same time as a test for alanine aminotransferase, or ALT. The ratio of AST to ALT sometimes can ...
more infohttps://www.adventisthealthcare.com/health/library/topic/?id=hw20331

Stability of aspartate aminotransferase from Sulfolobus solfataricus.  - PubMed - NCBIStability of aspartate aminotransferase from Sulfolobus solfataricus. - PubMed - NCBI

Stability of aspartate aminotransferase from Sulfolobus solfataricus.. Arnone MI1, Birolo L, Pascarella S, Cubellis MV, Bossa F ... Aspartate aminotransferase from Sulfolobus solfataricus (SsAspAT) is an extremely thermophilic and thermostable dimeric enzyme ... Therefore, in the case of aspartate aminotransferases, thermal stability does not correlate with the stability against chemical ... SsAspAT is less resistant to guanidinium chloride-induced denaturation than the cytosolic aspartate aminotransferase from pig ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/9153089?dopt=Abstract

Aspartate Aminotransferase Antibody Pairs: Novus BiologicalsAspartate Aminotransferase Antibody Pairs: Novus Biologicals

Browse our Aspartate Aminotransferase Antibody Pair catalog backed by our Guarantee+. ... Aspartate Aminotransferase Antibody Pairs available through Novus Biologicals. ... Aspartate Aminotransferase Antibody Pairs. We offer Aspartate Aminotransferase Antibody Pairs for use in common research ... Alternate Names for Aspartate Aminotransferase Antibody Pairs. Aspartate Aminotransferase antibody pair, GOT1 antibody pair, ...
more infohttps://www.novusbio.com/antibody-pairs/aspartate-aminotransferase?related_diseases=Spinal%20Cord%20Injuries

RCSB PDB 









- 1IVR: STRUCTURE OF ASPARTATE AMINOTRANSFERASE Literature Report PageRCSB PDB - 1IVR: STRUCTURE OF ASPARTATE AMINOTRANSFERASE Literature Report Page

Aspartate aminotransferase complexed with erythro-beta-hydroxyaspartate: crystallographic and spectroscopic identification of ... ASPARTATE AMINOTRANSFERASE A 401 Gallus gallus EC#: 2.6.1.1 IUBMB 2.6.1.7 IUBMB Mutation: S45P Gene Name(s): GOT2 Gene View ...
more infohttp://www.rcsb.org/pdb/explore/litView.do?structureId=1IVR

Aspartate aminotransferase increased with TylenolAspartate aminotransferase increased with Tylenol

ASPARTATE AMINOTRANSFERASE INCREASED Causes, Patient Concerns and Latest Treatments and Tylenol Reports and Side Effects. ... Check out the latest treatments for ASPARTATE AMINOTRANSFERASE INCREASED. ➢ ASPARTATE AMINOTRANSFERASE INCREASED treatment ... ASPARTATE AMINOTRANSFERASE INCREASED Symptoms and Causes. We are sorry, but no medical information on this topic currently ... ASPARTATE AMINOTRANSFERASE INCREASED Clinical Trials and Studies. Treatments might be new drugs or new combinations of drugs, ...
more infohttp://patientsville.com/i.htm?q=ASPARTATE%20AMINOTRANSFERASE%20INCREASED&mp=Tylenol

Aspartate aminotransferase increased with ProzacAspartate aminotransferase increased with Prozac

ASPARTATE AMINOTRANSFERASE INCREASED Causes, Patient Concerns and Latest Treatments and Prozac Reports and Side Effects. ... Check out the latest treatments for ASPARTATE AMINOTRANSFERASE INCREASED. ➢ ASPARTATE AMINOTRANSFERASE INCREASED treatment ... ASPARTATE AMINOTRANSFERASE INCREASED Symptoms and Causes. We are sorry, but no medical information on this topic currently ... ASPARTATE AMINOTRANSFERASE INCREASED Clinical Trials and Studies. Treatments might be new drugs or new combinations of drugs, ...
more infohttp://patientsville.com/i.htm?q=ASPARTATE%20AMINOTRANSFERASE%20INCREASED&mp=Prozac

Aspartate Aminotransferase (AST)Aspartate Aminotransferase (AST)

... Test Overview. An aspartate aminotransferase (AST) test measures the amount of this enzyme in ... The aspartate aminotransferase (AST) test is more effective than the alanine aminotransferase (ALT) test for detecting liver ... An aspartate aminotransferase (AST) test measures the amount of this enzyme in the blood. Results are usually available within ... The AST test may be done at the same time as a test for alanine aminotransferase, or ALT. The ratio of AST to ALT sometimes can ...
more infohttps://myhealth.alberta.ca/health/pages/conditions.aspx?hwid=hw20331

BioVision Inc Aspartate Aminotransferase (AST or SGOT) Activity Colorimetric
 | Fisher ScientificBioVision Inc Aspartate Aminotransferase (AST or SGOT) Activity Colorimetric | Fisher Scientific

BioVision Inc Aspartate Aminotransferase (AST or SGOT) Activity Colorimetric Assay Kit: High-Throughput Suitable Assay for ... Aspartate Aminotransferase (AST or SGOT) Activity Colorimetric Assay Kit: High-Throughput Suitable Assay for Measuring ALT/SGPT ... It catalyzes the reaction: Aspartate + ⍺-Ketoglutarate ⇌ Oxaloacetate + Glutamate Diagnostically, it is almost always measured ... in units/liter (U/L). In this Kit, an amino group is transferred of from aspartate to ⍺-ketoglutarate. The products of this ...
more infohttps://www.fishersci.com/shop/products/ast-sgot-assay-kit-fluoro/501119877

GOT2 - Aspartate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - GOT2 gene & proteinGOT2 - Aspartate aminotransferase, mitochondrial precursor - Homo sapiens (Human) - GOT2 gene & protein

Aspartate aminotransferase, mitochondrialAdd BLAST. 401. Amino acid modifications. Feature key. Position(s). DescriptionActions ... L-aspartate:2-oxoglutarate aminotransferase activity Source: UniProtKB ,p>Inferred from Direct Assay,/p> ,p>Used to indicate a ... Aspartate aminotransferase, mitochondrial (EC:2.6.1.11 Publication. Manual assertion based on experiment ini ... "The primary structure of mitochondrial aspartate aminotransferase from human heart.". Martini F., Angelaccio S., Barra D., ...
more infohttps://www.uniprot.org/uniprot/P00505

Aspartate Aminotransferase (AST) Test - Request A TestAspartate Aminotransferase (AST) Test - Request A Test

The Aspartate Aminotransferase test AST test is often done to evaluate liver function or detect injury to the liver. Order this ... Aspartate Aminotransferase (AST) Blood Test. This test measures levels of Aspartate Aminotransferase (AST) in the blood. AST is ... Aspartate Aminotransferase (AST) Blood Test. This test measures levels of Aspartate Aminotransferase (AST) in the blood. AST is ... Aspartate Aminotransferase (AST) Blood Test. This test measures levels of Aspartate Aminotransferase (AST) in the blood. AST is ...
more infohttps://requestatest.com/aspartate-aminotransferase-ast-testing

Aspartate aminotransferase test | definition of aspartate aminotransferase test by Medical dictionaryAspartate aminotransferase test | definition of aspartate aminotransferase test by Medical dictionary

What is aspartate aminotransferase test? Meaning of aspartate aminotransferase test medical term. What does aspartate ... Looking for online definition of aspartate aminotransferase test in the Medical Dictionary? aspartate aminotransferase test ... aspartate aminotransferase test. Also found in: Dictionary, Encyclopedia.. Related to aspartate aminotransferase test: Creatine ... Aspartate Aminotransferase Test. Definition. The Aspartate aminotransferase test measures levels of AST, an enzyme released ...
more infohttps://medical-dictionary.thefreedictionary.com/aspartate+aminotransferase+test

Persistent Increase in Aspartate Aminotransferase in an Asymptomatic Patient - AACC.orgPersistent Increase in Aspartate Aminotransferase in an Asymptomatic Patient - AACC.org

AACC.org // ... // Clinical Chemistry // Clinical Case Studies // Persistent Increase in Aspartate Aminotransferase in an ... Persistent Increase in Aspartate Aminotransferase in an Asymptomatic Patient. *Severe Hyponatremia with High Urine Sodium and ... Laboratory studies revealed an isolated increase in aspartate aminotransferase (AST)1 that prompted consultation with a ...
more infohttps://www.aacc.org/Publications/Clinical-Chemistry/Clinical-Case-Studies/2009/Persistent-Increase-in-Aspartate-Aminotransferase-in-an-Asymptomatic-Patient.aspx

Aspartate Aminotransferase (AST, GOT), Hum | LeeBio.comAspartate Aminotransferase (AST, GOT), Hum | LeeBio.com

Buy purified Glutamate Oxaloacetate Tranasminase/Aspartate Aminotransferase (AST/GOT) for in vitro diagnostic manufacturing, ... Lee Biosolutions is a producer and supplier of human liver enzyme Aspartate Aminotransferase/Glutamate Oxaloacetate ... This means that AST isnt as specific an indicator of liver damage as ALT (also known as alanine aminotransferase, another type ... Aspartate Transaminase, Glutamate Oxaloacetate, AST, GOT, sGOT, AspAT, ASAT, AAT, serum glutamic oxaloacetic transaminase. ...
more infohttps://www.leebio.com/product/645/glutamate-oxaloacetate-transaminase-got-aspartate-transferase-ast-human-liver-306-10

INTERACTION OF ASPARTATE AMINOTRANSFERASE WITH AMINO ACIDS | Biochemical JournalINTERACTION OF ASPARTATE AMINOTRANSFERASE WITH AMINO ACIDS | Biochemical Journal

INTERACTION OF ASPARTATE AMINOTRANSFERASE WITH AMINO ACIDS. P SCOTTO, V SCARDI. Biochemical Journal Jun 01, 1965, 95 (3) 657- ... INTERACTION OF ASPARTATE AMINOTRANSFERASE WITH AMINO ACIDS Message Subject (Your Name) has forwarded a page to you from ...
more infohttp://www.biochemj.org/content/95/3/657

Multiple Molecular Forms of Human Heart Cytoplasmic Aspartate Aminotransferase | Clinical ScienceMultiple Molecular Forms of Human Heart Cytoplasmic Aspartate Aminotransferase | Clinical Science

Multiple Molecular Forms of Human Heart Cytoplasmic Aspartate Aminotransferase. F. Y. Leung, A. R. Henderson ... 1. Cytoplasmic aspartate aminotransferase was isolated and purified from human heart with a final specific activity of 236 ... Multiple Molecular Forms of Human Heart Cytoplasmic Aspartate Aminotransferase Message Subject (Your Name) has forwarded a page ... 2. Three distinct peaks of aspartate aminotransferase activity were detected by isoelectric focusing with isoelectric points of ...
more infohttp://www.clinsci.org/content/62/3/337

Structure Cluster 









- 1CZE: ASPARTATE AMINOTRANSFERASE MUTANT ATB17/139S/142N WITH SUCCINIC ACID 3D Similarity Report...Structure Cluster - 1CZE: ASPARTATE AMINOTRANSFERASE MUTANT ATB17/139S/142N WITH SUCCINIC ACID 3D Similarity Report...

Cocrystallization of a mutant aspartate aminotransferase with a C5-dicarboxylic substrate analog: structural comparison with ... Description: ASPARTATE AMINOTRANSFERASE protein , Length: 396 No structure alignment results are available for 1CZE.A ...
more infohttp://www.rcsb.org/pdb/explore/structureCluster.do?structureId=1CZE
  • At 25 degrees C, SsAspAT is less resistant to guanidinium chloride-induced denaturation than the cytosolic aspartate aminotransferase from pig heart (cpAspAT), which was chosen as a mesophilic counterpart in the thermodynamic analysis since it shares with SsAspAT the two-state unfolding mechanism. (nih.gov)