OrganismsChemicals and DrugsPsychiatry and PsychologyDisciplines and OccupationsGeographicals
AsclepiasPregnanesApocynaceaeGlycosidesButterfliesMitragynaBiological Science DisciplinesSierra LeonePredatory Behavior
Asclepias
A plant genus of the family ASCLEPIADACEAE. This is the true milkweed; APOCYNUM & EUPHORBIA hirta are rarely called milkweed. Asclepias asthmatica has been changed to TYLOPHORA.
Pregnanes
Saturated derivatives of the steroid pregnane. The 5-beta series includes PROGESTERONE and related hormones; the 5-alpha series includes forms generally excreted in the urine.
Apocynaceae
The dogbane family of the order Gentianales. Members of the family have milky, often poisonous juice, smooth-margined leaves, and flowers in clusters. Asclepiadacea (formerly the milkweed family) has been included since 1999 and before 1810.
Glycosides
Any compound that contains a constituent sugar, in which the hydroxyl group attached to the first carbon is substituted by an alcoholic, phenolic, or other group. They are named specifically for the sugar contained, such as glucoside (glucose), pentoside (pentose), fructoside (fructose), etc. Upon hydrolysis, a sugar and nonsugar component (aglycone) are formed. (From Dorland, 28th ed; From Miall's Dictionary of Chemistry, 5th ed)
Butterflies
Slender-bodies diurnal insects having large, broad wings often strikingly colored and patterned.
Mitragyna
A plant genus of the family RUBIACEAE. Members contain antimalarial (ANTIMALARIALS) and analgesic (ANALGESICS) indole alkaloids.
Biological Science Disciplines
All of the divisions of the natural sciences dealing with the various aspects of the phenomena of life and vital processes. The concept includes anatomy and physiology, biochemistry and biophysics, and the biology of animals, plants, and microorganisms. It should be differentiated from BIOLOGY, one of its subdivisions, concerned specifically with the origin and life processes of living organisms.
Sierra Leone
A republic in western Africa, south of GUINEA and west of LIBERIA. Its capital is Freetown.
Predatory Behavior
Instinctual behavior pattern in which food is obtained by killing and consuming other species.

Metschnikowia vanudenii sp. nov. and Metschnikowia lachancei sp. nov., from flowers and associated insects in North America. (1/23)

Two new species of the ascosporic yeast genus Metschnikowia were isolated from nectaries and associated muscoid flies of flowers from the common milkweed (Asclepias syriaca) in North America, and are described as Metschnikowia vanudenii [type strain=PYCC 4650(T)=CBS 9134(T)=NRRL Y-27243(T)=UWO(PS) 86A4.1(T)] and Metschnikowia lachancei [type strain=PYCC 4605(T)=CBS 9131(T)=NRRL Y-27242(T)=UWO(PS) 7ASB2.3(T)]. As with the previously described Metschnikowia gruessii, M. vanudenii has vegetative cells with an 'aeroplane' or cross-like configuration, produces ovoid chlamydospores and forms ellipsoidopedunculate asci with two acicular ascospores. Metschnikowia lachancei is distinguished from other Metschnikowia species by formation of club-shaped asci with 1-2 thick clavate ascospores. The phylogenetic positions of the proposed new species within Metschnikowia were determined from sequence analysis of the D1/D2 domain of 26S rDNA. The new species show low nuclear DNA relatedness with neighbouring taxa.  (+info)

Flavonoids in the leaves of Asclepias incarnata L. (2/23)

Seven flavonoid compounds: quercelin 3-O-beta-galactopyranoside, 3-O-beta-glucopyranoside, 3-O-arabinoside, 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, 3-O-alpha-rhamnopyranosyl (1-->2)-beta-galactopyranoside and kaempferol 3-beta-glucopyranoside were isolated and identified from the leaves of Asclepias incarnata, L. (Asclepiadaceae).  (+info)

Steroidal glycosides from the roots of Asclepias curassavica. (3/23)

Twenty-six new acylated-oxypregnane glycosides were obtained along with three known cardenolide glycosides from the roots of Asclepias curassavica (Asclepiadaceae). The new compounds were confirmed to contain 12-O-benzoylsarcostin, 12-O-benzoyldeacylmetaplexigenin, kidjolanin, and 12-O-benzoyltayloron, and one new acylated-oxypregnane, 12-O-(E)-cinnamoyltayloron, as their aglycones, using both spectroscopic and chemical methods.  (+info)

Phylogenetic escalation and decline of plant defense strategies. (4/23)

 (+info)

New cardenolide and acylated lignan glycosides from the aerial parts of Asclepias curassavica. (5/23)

Three new cardenolide glycosides and six new acylated lignan glycosides were obtained along with nineteen known compounds from the aerial parts of Asclepias curassavica L. (Asclepiadaceae). The structure of each compound was determined based on interpretations of NMR and MS measurements and chemical evidence.  (+info)

Acylated-oxypregnane glycosides from the roots of Asclepias syriaca. (6/23)

Twenty new pregnane glycosides were obtained from the roots of Asclepias syriaca L. (Asclepiadaceae). These glycosides were confirmed to contain ikemagenin, 12-O-nicotinoyllineolon, 5alpha,6-dihydroikemagenin, and 12-O-tigloylisolineolon, as their aglycones, using both spectroscopic and chemical methods.  (+info)

Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. (7/23)

Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.  (+info)

Aerial reproductive structures of vascular plants as a microhabitat for myxomycetes. (8/23)

This study explored the occurrence and distribution of myxomycete species on the aerial reproductive structures of vascular plants. Eight species of vascular plants representing five families were sampled. The doubled rope climbing method was used to collect bark and cones from the canopy of Pinus echinata. Bark and aerial seed pods were gathered from Cercis canadensis, follicles and stems from Asclepias syriaca, dried composite inflorescences and stems from Echinacea angustifolia, E. pallida, and E. paradoxa var. paradoxa, and capsules and stems from Yucca glauca and Y. smalliana. Reproductive structures and bark/stems for 202 host plants were separated and cultured in 541 moist chambers, resulting in 118 collections yielding 32 myxomycete species representing 11 genera, seven families and five orders. There was no significant difference in pH values of the reproductive structures and bark/stems of the host plants, however legume pods of C. canadensis (6.9 +/- 1.3) had higher pH than the bark (6.0 +/- 1.1) and had a different composition of myxomycete species. Myxomycete orders have optimal pH ranges. Nonmetric multidimensional scaling, multiresponse permutation procedure and indicator species analysis showed a significant difference in species richness of reproductive structures and bark/stems. The bark of trees had greater mean species richness of myxomycetes than the reproductive structures, but the reproductive structures of herbaceous plants had greater mean species richness of myxomycetes than the stems. A new term, herbicolous myxomycetes, is proposed for a group of myxomycetes frequently associated with herbaceous, perennial, grassland plants. An undescribed species of Arcyria occurred only on cones of P. echinata.  (+info)

Supplemental data to The genome and transcriptome of common milkweed (Asclepias syriaca): resources for evolutionary,...
This dataset contains a draft assembly of the common milkweed (Asclepias syriaca) nuclear genome, linkage group information, and gene family counts for Asclepias and related species. The genome assembly is accompanied by annotation of gene models, repeat models, transfer RNAs, and open reading frames, and mapping information of Asclepias transcripts, Calotropis transcripts, and Coffea proteins onto the assembled scaffolds. The linkage group information includes data input into the linkage group analysis, R scripts for processing, and a final list of scaffolds assigned to linkage groups. Additional data includes the coding sequence alignment of P5βR paralogs described in the article and a table of gene family counts in Asclepias, other Apocynaceae, coffee (Coffea), and grape (Vitis ...
https://ir.library.oregonstate.edu/concern/datasets/vd66w525h
ASCLEPIAS TUBEROSA - A Text-Book of Materia Medica. By Pr. Allen Corson CowperthwaiteASCLEPIAS TUBEROSA - A Text-Book of Materia Medica. By Pr. Allen Corson Cowperthwaite
Natural order.- Asclepiadaceae.. Common names.- Pleurisy Root. Butterfly Weed.. General Analysis.-. Acts chiefly on the mucous surfaces, especially of the respiratory organs, and intestinal canal ; also upon the serous tissues, especially the pleura and synovial membranes, producing in all these inflammation, which is subacute in its character.. Characteristic symptoms.. Mind.- (Asclepias tuberosa). Weakness of thought and memory ; at first cheerful, then fretful and peevish.. Head.- (Asclepias tuberosa). Confusion, dullness, and heaviness of the head ; swimming of the head.. Dull headache in the forehead and vertex, aggravated by motion, and relieved by lying down.. Headache pressing deeply on the base of the skull. (Ipec.). Pain in the forehead from coughing. (Bry.). Eyes.- (Asclepias tuberosa). Eyes look dull, fatigued, and heavy.. Ophthalmia, with itching and pain in eyes.. Feeling of sand in the eyes.. Vision disturbed ; large dark spots before the eyes.. Nose.- (Asclepias tuberosa). Fluent ...
http://homeoint.org/seror/cowperthwaite/asc_t.htm
Genetic Structure of the Common Milkweed, Asclepias syriaca L.
Abstract: Premise of the study: Microsatellite primers were developed for the common milkweed, Asclepias syriaca, to assist in genet identification and the analysis of spatial genetic structure. • Methods and Results: Using an enrichment cloning protocol, eight microsatellite loci were isolated and characterized in a North American population of A. syriaca. The primers amplified di- and tri-nucleotide repeats with 4-13 alleles per locus. • Conclusions: The primers will be useful for studies of clonality and gene flow in natural populations. Abstract: Chapter 3 Spatial genetic structure (SGS) is largely determined by the reproductive strategies of species. Many plant species, including Asclepias syriaca, the common milkweed, reproduce both sexually and asexually and there can be great variation in SGS among species that reproduce by both methods. SGS was assessed within an old field population of A. syriaca in northern Michigan. Strong SGS was detected to 38 m when multiple identical ...
https://deepblue.lib.umich.edu/handle/2027.42/69237
Asclepias syriaca - Common milkweed - Southern Alps PhotographyAsclepias syriaca - Common milkweed - Southern Alps Photography
Great spangled fritillary (Speyeria cybele) on common milkweed (Asclepias syriaca). Wild River State Park, MN, USA.. WildRiverStatePark227Asclepias syriacaFaunaFloraMinnesotaSpeyeria cybeleUSAWild River State Parkbutterflycommon milkweedgreat spangled fritillaryinsectwildlife. From Speyeria cybele - Great spangled fritillary (USA) ...
https://www.southernalpsphotography.com/Plants/Flora-of-the-Midwest/Asclepias-syriaca/i-R2zvRsx/
中国科学院昆明植物研究所机构知识库(KIB OpenIR): Cytotoxicity of cardenolides and cardenolide glycosides from Asclepias curassavica中国科学院昆明植物研究所机构知识库(KIB OpenIR): Cytotoxicity of cardenolides and cardenolide glycosides from Asclepias curassavica
A new cardenolide, 12 beta, 14 beta-dihydroxy-3 beta, 19-epoxy-3 alpha-methoxy-5 alpha-card-20(22)-enolide (6), and a new doubly linked cardenolide glycoside, 12 beta-hydroxycalotropin (13), together with eleven known compounds, coroglaucigenin (1), 12 beta-hydroxycoroglaucigenin (2), calotropagenin (3), desglucouzarin (4), 6-O-feruloyl-desglucouzarin (5), calotropin (7), uscharidin (8), asclepin (9), 16 alpha-hydroxyasclepin (10), 16 alpha-acetoxycalotropin (11), and 16 alpha-acetoxyasclepin (12), were isolated from the aerial part of ornamental milkweed, Asclepias curassavica and chemically elucidated through spectral analyses. All the isolates were evaluated for their cytotoxic activity against HepG2 and Raji cell lines. The results showed that asclepin (9) had the strongest cytotoxic activity with an IC(50) value of 0.02 mu M against the two cancer cell lines and the new compound 13 had significant cytotoxic activity with IC(50) values of 0.69 and 1.46 mu M, respectively. (C) 2009 Elsevier ...
http://ir.kib.ac.cn/handle/151853/2901
Asclepias speciosa - Showy Milkweed - Asclepiadaceae (The Milkweed Family)
Support monarch and other butterflies with Asclepias speciosa, the western North American sister species to the eastern common milkweed (Asclepias syriaca).
https://mailorder.phoenixperennials.com/Asclepias_speciosa_Showy_Milkweed_p/5909.htm
Asclepias. Asclepias tuberosa. | Henriettes Herbal HomepageAsclepias. Asclepias tuberosa. | Henriettes Herbal Homepage
Action-Diaphoretic, expectorant, cathartic, tonic.. Physiological Action-In regard to the influence of asclepias, Grover Coe, M. D., writing in 1858, gives the following wide range of action. He says: No other remedy with which we are acquainted is so universally admissible in the treatment of disease, either alone or in combination. In fact we think of no pathological condition that would be aggravated by its employment. It expels wind, relieves pain, relaxes spasm, induces and promotes perspiration, equalizes the circulation, harmonizes the action of the nervous system, and accomplishes its work without excitement; neither increasing the force or frequency of the pulse, nor raising the temperature of the body. It is of special service in the treatment of affections involving the serous membranes, as pleuritis, peritonitis, etc. In this it resembles bryonia closely.. The most active apparent influence of this agent is upon the sudoriparous glands. It is distinctively an eliminative agent of ...
https://www.henriettes-herb.com/eclectic/ellingwood/asclepias.html
Rare or Unusual Seeds : Buy Plants and Seeds | Rare and Unusual | Passiflora | Aristolochia | Asclepias | BananasRare or Unusual Seeds : Buy Plants and Seeds | Rare and Unusual | Passiflora | Aristolochia | Asclepias | Bananas
Buy Plants and Seeds | Rare and Unusual | Passiflora | Aristolochia | Asclepias | Bananas : Rare or Unusual Seeds - Passion Vine Plants Asclepias Plants Banana Plants Aristolochia Plants Vine Plants Rare & Unusual Plants Hibiscus Plants Shrub & Tree Plants Seeds Tropical Plants Gift Certificates Only Show My USDA Hardiness Zone Annual Plants Perennial Plants Plant Bundles Newsletter Sale Brugmansia Plants Butterfly Garden
https://georgiavines.com/cart/index.php?main_page=index&cPath=9_21&sort=20a&page=11
Ask a Question : Buy Plants and Seeds | Rare and Unusual | Passiflora | Aristolochia | Asclepias | BananasAsk a Question : Buy Plants and Seeds | Rare and Unusual | Passiflora | Aristolochia | Asclepias | Bananas
Buy Plants and Seeds | Rare and Unusual | Passiflora | Aristolochia | Asclepias | Bananas : Ask a Question - Passion Vine Plants Asclepias Plants Banana Plants Aristolochia Plants Vine Plants Rare & Unusual Plants Hibiscus Plants Shrub & Tree Plants Seeds Tropical Plants Gift Certificates Only Show My USDA Hardiness Zone Annual Plants Perennial Plants Plant Bundles Newsletter Sale Brugmansia Plants Butterfly Garden
https://georgiavines.com/cart/index.php?main_page=ask_a_question&pid=430
Asclepias - WikipediaAsclepias - Wikipedia
Members of the genus Asclepias produce some of the most complex flowers in the plant kingdom, comparable to orchids in complexity. Five petals reflex backwards revealing a gynostegium (fused stamen filamens and styles) surrounded by a five-membrane corona. The corona is composed of a five paired hood and horn structure with the hood acting as a sheath for the inner horn. Glands holding pollinia are found between the hoods. The size, shape and color of the horns and hoods are often important identifying characteristics for species in the genus Asclepias.[7]. Pollination in this genus is accomplished in an unusual manner. Pollen is grouped into complex structures called pollinia (or pollen sacs), rather than being individual grains or tetrads, as is typical for most plants. The feet or mouthparts of flower-visiting insects such as bees, wasps and butterflies, slip into one of the five slits in each flower formed by adjacent anthers. The bases of the pollinia then mechanically attach to the ...
https://en.m.wikipedia.org/wiki/Milkweed
Asclepias syriaca - WikispeciesAsclepias syriaca - Wikispecies
USDA, ARS, Germplasm Resources Information Network. Asclepias syriaca in the Germplasm Resources Information Network (GRIN), U.S. Department of Agriculture Agricultural Research Service. Accessed on 07-Oct-06 ...
https://species.wikimedia.org/wiki/Asclepias_syriaca
Butterflyweed (Asclepias tuberosa) Seeds : Prairie NurseryButterflyweed (Asclepias tuberosa) Seeds : Prairie Nursery
A widely distributed North American plant, Asclepias tuberosa is a native of midwest prairies and a favorite garden plant for its ability to attract many butterflies and the profusion of bright orange flowers. The long-lasting flowers combined with a low mounded profile make this the most popular of milkweeds. True to its name Butterflyweed attracts legions of butterflies and is an important host plant for the caterpillars of Monarch, Grey Hairstreak, and Queen butterflies.
http://www.prairienursery.com/store/native-wildflowers/butterflyweed-seed-asclepias-tuberosa
Perennial Plant of the Year 2017- Asclepias tuberosa - Garden CrossingsPerennial Plant of the Year 2017- Asclepias tuberosa - Garden Crossings
Perennial Plant of The Year- Asclepias tuberosa, what a great choice! With all the hype these days over the Monarch Butterfly this orange Milkweed is a perfect selection to be named Perennial Plant of the Year 2017.
https://www.gardencrossings.com/blog/asclepias-tuberosa-perennial-plant-of-the-year-2017/
Butterfly Weed Seeds | Asclepias tuberosa Seeds | High Country GardensButterfly Weed Seeds | Asclepias tuberosa Seeds | High Country Gardens
Asclepias tuberosa (Butterfly Weed) milkweed has attractive, bright orange flowers in late spring and is a nectar source for bees and butterflies.
https://www.highcountrygardens.com/asclepias-tuberosa-seeds
Asclepias Tuberosa. - A DICTIONARY OF PRACTICAL MATERIA MEDICA By John Henry CLARKE, M.D. Presented by M di-TAsclepias Tuberosa. - A DICTIONARY OF PRACTICAL MATERIA MEDICA By John Henry CLARKE, M.D. Presented by M di-T
Presented by M di-T Asclepias Tuberosa.. Pleurisy-root. Butterfly-weed. N. O. Asclepiadace . Tincture of fresh root.. Clinical.─Alopecia. Asthma. Bilious fever. Bronchitis. Catarrh. Chancre. Colic. Cough. Diarrh a. Dysentery. Headache. Heart, affections of. Influenza. Ophthalmia. Pericarditis. Pleurisy. Pleurodynia. Rheumatism. Scrofula. Syphilis.. Characteristics.─Asclep. tub. causes sharp, stitching, pricking pains; , by motion. It is of the hydrogenoid type, corresponding to catarrhal complaints from cold and damp weather. Rheumatic pains affect the body diagonally, l. upper and r. lower, or the opposite. Muscular and articular rheumatism with stitching pains, dark red urine and hot, perspiring skin. Sensitive to tobacco. Pain in forehead and abdomen from coughing. Griping and sharp peritoneal pains , by pressure. Dysentery in autumn; and painful diarrh a with griping and tenesmus. Warm feeling in chest. Dyspn a. Cough hard and dry; or hoarse, croupy with tight breathing and constriction ...
http://www.homeoint.org/clarke/a/asclep_tub.htm
Asclepias Species, Butterfly Milkweed, Butterfly Weed, Pleurisy Root Asclepias tuberosaAsclepias Species, Butterfly Milkweed, Butterfly Weed, Pleurisy Root Asclepias tuberosa
Welcome to the famous Daves Garden website. Join our friendly community that shares tips and ideas for gardens, along with seeds and plants.
https://davesgarden.com/guides/pf/go/73/
Asclepias californica (California milkweed)Asclepias californica (California milkweed)
About plant names.... This milkweed variety is found mostly in central and southern California, where it is native.. Identification. Plants are up to 3 (91 cm) in size, upright or reclining, with distinctively fuzzy stems and leaves. The leaves have wrinkly edges and a grayish-white fuzzy or woolly appearance. The buds appear pink, opening into deep red/purple flowers about 1 (2.5 cm) across. A yellow-green pentagon-shaped stamen (actually five fused stamens) is in the center of each flower.. Edibility. A Wikipedia article suggests that this milkweed is edible:. This plant was eaten as candy by the Kawaiisu tribes of indigenous California; the milky sap within the leaves is flavorful and chewy when cooked.[1]. However, the sap mentioned above as a sort of candy contains cardiac glycosides in most other milkweed species, and monarch butterfly larvae eat the plants to make themselves poisonous to predators, so eating the sap in any form is potentially dangerous.. Online References:. Asclepias ...
https://florafinder.org/Species/Asclepias_californica.php
Pleurisy Root - Asclepias tuberosa. asclepias, Pleurisy Root, flux root, Butterfly Weed, white root, wind root, tuber root,...
Used For: The remedy is applied for boosting perspiration, reducing spasms, treating flatulence, decreasing inflammations, and fighting coughs.. Pleurisy Root provides great aid in treating respiratory system diseases, eliminating inflammations and boosting mucus movement. Applied as a treatment from bronchitis and different lung diseases, like pneumonia, pleurisy. Highly effective as a remedy for flu.. Preparation and Intake: If used in form of infusion, half a teaspoon is taken and mixed in a glass of water, then boiled and kept hot for 15 minutes. The result is filtered and taken thrice a day.. In form of a tincture pleurisy root is applied in a dose of 1-2 ml thrice per day.. Safety: There is no data concerning the plants safety level. Still, there is a possibility of interaction with chemical remedies. Dont use the herb before having a consultation with your health-care provider.. ...
http://www.oshims.com/herb-directory/p/pleurisy-root
Sullivantosides A-F: Pregnane glycosides from Asclepias sullivantii L.Sullivantosides A-F: Pregnane glycosides from Asclepias sullivantii L.
Phytochemical investigation of the above-ground biomass of Asclepias sullivantii L. (Asclepiadaceae) afforded six new pregnane glycosides, named sullivantosides A-F (1-6). The structures of 1-6 were elucidated through a variety of spectroscopic and spectrometric techniques (1D and 2D NMR; HRESIMS). To the best of our knowledge, this work represents the first phytochemical study of this species ...
http://www.kerwa.ucr.ac.cr/handle/10669/73727
Asclepias
Literature References: Dried root of Asclepias tuberosa L., Asclepiadaceae. Habit. Ontario to Minnesota. Constit. Asclepiadin, resins, volatile oil. ...
https://www.drugfuture.com/chemdata/Asclepias.html
Asclepias viridiflora Green Milkweed, Green comet milkweed PFAF Plant DatabaseAsclepias viridiflora Green Milkweed, Green comet milkweed PFAF Plant Database
Asclepias viridiflora is a PERENNIAL growing to 1 m (3ft 3in) by 1 m (3ft 3in). It is in flower from July to August, and the seeds ripen from August to October. The species is hermaphrodite (has both male and female organs) and is pollinated by Bees, insects, Lepidoptera (Moths & Butterflies). It is noted for attracting wildlife. Suitable for: light (sandy) and medium (loamy) soils and prefers well-drained soil. Suitable pH: acid, neutral and basic (alkaline) soils. It can grow in semi-shade (light woodland) or no shade. It prefers dry or moist soil.
https://pfaf.org/User/Plant.aspx?LatinName=Asclepias+viridiflora
Asclepias (Milkweed) Seeds for Sale & Butterfly Weed SeedsAsclepias (Milkweed) Seeds for Sale & Butterfly Weed Seeds
Fill your garden with Asclepias seeds from Everwilde Farms, including milkweed and butterfly weed seeds that produce flowers of all different colors.
https://www.everwilde.com/Asclepias-Native-Wildflower-Seeds.html?zone%5B%5D=Zone+6®ion%5B%5D=California&height%5B%5D=40-49+Inches&height%5B%5D=30-39+Inches&height%5B%5D=60-69+Inches
Asclepias (Milkweed) Seeds for Sale & Butterfly Weed SeedsAsclepias (Milkweed) Seeds for Sale & Butterfly Weed Seeds
Asclepias speciosa - Biological Sciences - CSU, Chico
Asclepias speciosa, or showy Milkweed, is native to the western half of North America. In California, the perennial plant is found in the Sierras and Coast Ranges. The plant is hairy and grows erect to around 1.2m in height. The large, broad leaves are arranged opposite on the stem. The pinkish-purple flowers are star shaped and are arranged in umbels. In the summer months, when the plant is flowering, you can find a number of butterflies tending the flowers, notably the Monarch butterfly. Like all Milkweeds, a white liquid, called latex, is secreted whenever the plant is damaged. Most predators find the liquid very unpalatable, but some caterpillars are able to sequester the latex and become unpalatable themselves.. Click the images above for a larger view. ...
https://www.csuchico.edu/biol/collections/garden/asclepias-speciosa.shtml
Common Milkweed - Asclepias syriaca | American MeadowsCommon Milkweed - Asclepias syriaca | American Meadows
Easy to grow Common Milkweed is native, perennial and the sole host plant for monarch butterflies. Comes with simple growing instructions and videos. Plants are non-GMO, Neonicotinoid-free and 100% guaranteed to grow in your garden.
https://www.americanmeadows.com/perennials/spring-planted-perennials/common-milkweed
Asclepias ovalifolia Oval-leaf milkweed PFAF Plant DatabaseAsclepias ovalifolia Oval-leaf milkweed PFAF Plant Database
Asclepias ovalifolia is a PERENNIAL growing to 0.6 m (2ft) by 1 m (3ft 3in). It is hardy to zone (UK) 6. It is in flower from July to August, and the seeds ripen from August to October. The species is hermaphrodite (has both male and female organs) and is pollinated by Bees, insects, Lepidoptera (Moths & Butterflies). It is noted for attracting wildlife. Suitable for: light (sandy) and medium (loamy) soils and prefers well-drained soil. Suitable pH: acid, neutral and basic (alkaline) soils. It can grow in semi-shade (light woodland) or no shade. It prefers dry or moist soil.
https://pfaf.org/USER/Plant.aspx?LatinName=Asclepias+ovalifolia
Asclepias galioides Bedstraw Milkweed PFAF Plant DatabaseAsclepias galioides Bedstraw Milkweed PFAF Plant Database
Asclepias galioides is a PERENNIAL growing to 0.4 m (1ft 4in). The species is hermaphrodite (has both male and female organs) and is pollinated by Bees, insects, Lepidoptera (Moths & Butterflies). Suitable for: light (sandy) soils, prefers well-drained soil and can grow in nutritionally poor soil. Suitable pH: acid, neutral and basic (alkaline) soils. It can grow in semi-shade (light woodland) or no shade. It prefers dry or moist soil.
https://pfaf.org/User/Plant.aspx?LatinName=Asclepias+galioides
Asclepias subulata Rush Milkweed PFAF Plant DatabaseAsclepias subulata Rush Milkweed PFAF Plant Database
Asclepias subulata is a PERENNIAL growing to 2 m (6ft 7in). It is hardy to zone (UK) 6. The species is hermaphrodite (has both male and female organs) and is pollinated by Bees, insects, Lepidoptera (Moths & Butterflies). Suitable for: light (sandy) soils, prefers well-drained soil and can grow in nutritionally poor soil. Suitable pH: acid, neutral and basic (alkaline) soils. It can grow in semi-shade (light woodland) or no shade. It prefers dry or moist soil.
https://pfaf.org/user/Plant.aspx?LatinName=Asclepias+subulata
NameThatPlant.net: Asclepias pedicellataNameThatPlant.net: Asclepias pedicellata
Asclepias pedicellata, Stalked Milkweed, Savanna Milkweed. NameThatPlant.net currently features 3816 plants and 23,855 images. For many plants, the website displays maps showing physiographic provinces within the Carolinas and Georgia where the plant has been documented. On NameThatPlant.net, plants are shown in different seasons (not just in flower), and you can hear Latin names spoken, look up botanical terms, get a feel for which plants to expect to see in various natural communities, and discover botanically interesting places to visit.
http://namethatplant.net/plantdetail.shtml?plant=3155
Calflora: Asclepias subulataCalflora: Asclepias subulata
Asclepias subulata, a dicot, is a perennial herb that is native to California and is also found outside of California, but is confined to western North America. ...
https://www.calflora.org/cgi-bin/species_query.cgi?where-calrecnum=752
Asclepias speciosa - Gaïan EthnoBotanyAsclepias speciosa - Gaïan EthnoBotany
Ethnobotany. Asclepias speciosa has been used as a food or as medicine by the following First Peoples: Acoma, Apache, Cheyenne, Chiricahua, Crow, Flathead, Keres, Hopi, Laguna, Lakota, Miwok, Mescalero, Montana, Navajo, Okanagan-Colville, Paiute, Pomo and Shoshoni. Except the roots and the seeds, all parts of the plant were eaten - raw or cooked depending on the stage…
https://gaianethnobotany.com/2017/06/07/asclepias-speciosa/
Asclepias (U. S. P.)-Asclepias. | Henriettes Herbal HomepageAsclepias (U. S. P.)-Asclepias. | Henriettes Herbal Homepage
Description.-Root large and fusiform, dried in longitudinal or transverse sections, from 2 to 15 Cc. long (3/4 to 6 inches), and about 2 Cc. (3/4 inch) or more in thickness; the head knotty, and slightly but distinctly annulate, the remainder longitudinally wrinkled, externally orange-brown, internally whitish; tough, and having all uneven fracture; bark thin, and in two distinct layers, the inner one whitish; wood yellowish, with large, white, medullary rays. It is inodorous, and has a bitterish, somewhat acrid taste. When long kept it acquires a gray color-(U. S. P.).. Chemical Composition.-Mr. Elam Rhoads found in this root gum, pectin, starch, albumen, gallic and gallo-tannic acids, lignin, salts, an odorous material of a fatty nature, two resinous bodies-one dissolving in ether, the other refusing to so dissolve-and a fixed oil. Mr. Rhoads also obtained a. peculiar body having the taste of the drug, which may be thrown down from a strong infusion of the root by tannin. By decomposing with ...
https://www.henriettes-herb.com/eclectic/kings/asclepias-tube.html
NDC 62902-0003 Metabolic Rewire Support Asclepias Vincetoxicum, Echinacea (angustifolia), Hypothalamus (suis), Hepar Suis, ...NDC 62902-0003 Metabolic Rewire Support Asclepias Vincetoxicum, Echinacea (angustifolia), Hypothalamus (suis), Hepar Suis, ...
Metabolic Rewire Support with NDC 62902-0003 is a a human over the counter drug product labeled by Intentional Nourishment. The generic name of Metabolic Rewire Support is asclepias vincetoxicum, echinacea (angustifolia), hypothalamus (suis), hepar suis, kidney (suis), methylcobalamin, gambogia, graphites, nux vomica, phytolacca decandra, 7-keto (3-acetyl-7-oxo-dehydroepiandrosterone), adenosinum triphosphoricum dinatrum, glucagon, insulinum (suis), sarcolacticum acidum, proteus (vulgaris).
https://ndclist.com/ndc/62902-0003
NDC 62185-0020 Wlp40 Asclepias Vincetoxicum, Echinacea (angustifolia), Hypothalamus (suis), Cerebrum Suis, Hepar Suis, ...NDC 62185-0020 Wlp40 Asclepias Vincetoxicum, Echinacea (angustifolia), Hypothalamus (suis), Cerebrum Suis, Hepar Suis, ...
Wlp40 with NDC 62185-0020 is a a human over the counter drug product labeled by Dr. Donna Restivo Dc. The generic name of Wlp40 is asclepias vincetoxicum, echinacea (angustifolia), hypothalamus (suis), cerebrum suis, hepar suis, kidney suis, methylcobalamin, pancreas suis, stomach (suis), aacg-a, aacg-b, calcarea carbonica, gambogia, gelsemium sempervirens, graphites, nux vomica, phytolacca decandra, 7-keto-dhea (dehydroepiandrosterone), adenosinum triphosphoricum dinatrum, glucagon, insulinum (suis), sarcolacticum acidum, proteus (vulgaris).
https://ndclist.com/ndc/62185-0020
Asclepias curassavica - Yew Dell Botanical GardensAsclepias curassavica - Yew Dell Botanical Gardens
Tropical Milkweed | There are a lot of misinformation floating around the internet about this plant. You may have seen that the tropical milkweeds can disrupt the migration of the Monarchs and allow disease to spread among them. This is true only in certain areas. Here in the Louisville area our winters kill it off
https://shopyewdell.com/products/526
Little Calumet River Prairie & WetlandsLittle Calumet River Prairie & Wetlands
Latin Name Common Name Strata Native? Acer negundo box elder Herbaceous YES Ailanthus altissima tree of heaven Herbaceous NO [invasive] Allium cernuum nodding wild onion Herbaceous YES Ambrosia artemisiifolia common ragweed Herbaceous YES Ambrosia trifida giant ragweed Herbaceous YES Anemone virginiana tall anemone; thimbleweed Herbaceous YES Aquilegia canadensis wild columbine Herbaceous YES Arnoglossum atriplicifolium pale indian plantain Herbaceous YES Artemisia vulgaris mugwort Herbaceous NO [invasive] Asclepias Herbaceous ? Asclepias syriaca common milkweed Herbaceous YES Asclepias tuberosa butterfly weed; butterly milkweed Herbaceous YES Aster Herbaceous ? Aster ericoides heath aster Herbaceous YES Aster laevis smooth blue aster Herbaceous YES Aster novae-angliae New England aster Herbaceous YES Aster pilosus hairy aster; frost-weed aster Herbaceous YES Bouteloua curtipendula side-oats grama Herbaceous YES Bromus japonicus Japanese chess Herbaceous NO Capsella bursa-pastoris shepherds ...
http://www.nirmi.org/?pageNav=2&dateFilter=2012
Hello Yellow Butterflyweed | Greenwood...Hello Yellow Butterflyweed | Greenwood...
Asclepias tuberosa Hello Yellow Milkweed , Perennial Plant of the Year 2017. A yellow flowering perennial native to much of the United States except the Northwest.. The Hello Yellow Milkweed is a must have for attracting butterflies, insects and hummingbirds to your garden. Asclepias tuberosa is a host plant for the Monarch butterfly and other butterflies providing food and nectar for the caterpillar to butterflies. Also called Butterfly Weed or Milkweed.. Tips on growing Milkweeds: deadhead for extended blooming from summer to fall, late to emerge in spring, plant with companion plants such as Cheyenne Spirit Echinacea, Goldenrod, and Russian Sage Little Spire.​. Hello Yellow Butterfly Weed Asclepias tuberosa grows approximately 18 to 24 inches tall and spreads in the 18 to 24 inch width. Plant in full sun to lightly filtered shade. Adaptable to dry, well-drained and lightly moist soils. An excellent native perennial plant thats seed pods are also used for dried arrangements. Pair this ...
https://www.greenwoodnursery.com/hello-yellow-milk-weed
Asclepias syriaca - WikipediaAsclepias syriaca - Wikipedia
Many kinds of insects visit A. syriaca flowers, and some kinds pollinate them, including Apis mellifera (Western honey bees) and Bombus spp. (bumble bees).[3][4] In the U.S. Mid-Atlantic Region, the introduced A. mellifera was the most effective and most important diurnal pollinator with regard to both pollen removal and pollen deposition.[5] However, when considering the self-incompatibility of A. syriaca, A. mellifera was not the most important pollinator because of its high self-pollination rate compared to Bombus spp. Additionally, the rate of self-pollination increased more rapidly with the number of flowers per inflorescence in A. mellifera than in native Bombus spp. Many insect species feed on common milkweed, including the red milkweed beetle (Tetraopes tetrophtalmus), large milkweed bug (Oncopeltus fasciatus), small milkweed bug (Lygaeus kalmii), milkweed aphid (Aphis nerii), milkweed leaf beetle (Labidomera clivicollis), milkweed stem weevil (Rhyssomatus lineaticollis), milkweed tiger ...
https://en.wikipedia.org/wiki/Common_Milkweed
Asclepias curassavica - WikipediaAsclepias curassavica - Wikipedia
Typical plants are evergreen perennial subshrubs that grow up to 1 m (3.3 ft) tall and have pale gray stems. The leaves are arranged oppositely on the stems and are lanceolate or oblong-lanceolate shaped ending in acuminate or acute tips. Like other members of the genus, the sap is milky. The flowers are in cymes with 10-20 flowers each. They have purple or red corollas and corona lobes that are yellow or orange. Flowering occurs nearly year-round.[5] The 5-10 cm (2.0-3.9 in) long, fusiform shaped fruits are called follicles. The follicles contain tan to brown seeds that are ovate in shape and 6-7 mm (0.24-0.28 in) long. The flat seeds have silky hairs that allow the seeds to float on air currents when the pod-like follicles dehisce (split open).[7] ...
https://en.wikipedia.org/wiki/Mexican_Milkweed
my G@Rdening frenzY: PLAIN TIGER & ASCLEPIAS CURASSAVICAmy [email protected] frenzY: PLAIN TIGER & ASCLEPIAS CURASSAVICA
This blog was created as an online diary to capture some of the things I love or experience in life. Anyway, I hope we will all learn to appreciate the simple things in life, cherish our loved ones and make the most of our lives ...
http://garden-frenzy.blogspot.com/2010/10/plain-tiger-asclepias-curassavica.html
Milkweed Stem Weevil - Rhyssomatus palmacollis (Say)Milkweed Stem Weevil - Rhyssomatus palmacollis (Say)
References:. Agrawal, A.A. 2005. Natural selection on common milkweed (Asclepias syriaca) by a community of specialized insect herbivores. Evolutionary Ecology Research, 7: 651 667.. Agrawal, A.A. & P.A. Van Zandt. 2003. Ecological play in the coevolutionary theater: Genetic and environmental determinants of attack by a specialist weevil on milkweed. Journal of Ecology 91: 1049-1059.. Arnett, R.H., Jr., M.C. Thomas, P. E. Skelley & J.H. Frank. (editors). 2002. American Beetles, Volume II: Polyphaga: Scarabaeoidea through Curculionoidea. CRC Press. 861 pp.. Fordyce, J.A. & S.B. Malcolm. 2000. Specialist weevil, Rhyssomatus lineaticollis, does not spatially avoid cardenolide defenses of common milkweed by ovipositing into pith tissue. Journal of Chemical Ecology, 26: 2857 2874.. Nishio, S., M.S. Blum, S. Takahashi. 1983. Intraplant distribution of cardenolides in Asclepias humistrata (Asclepiadaceae), with additional notes on their fates in Tetraopes melanurus (Coleoptera: Cerambycidae) and ...
http://texasento.net/Rhyssomatus.htm
Swamp Milkweed Seeds - Asclepias incarnata | American MeadowsSwamp Milkweed Seeds - Asclepias incarnata | American Meadows
Swamp Milkweed is a red, showier variety of Common Milkweed. It is extremely elegant, producing willowy foliage and cherry-red blooms. It will also attract beautiful butterflies and hummingbirds to your garden or meadow. Perennial.
https://www.americanmeadows.com/wildflower-seeds/milkweed-seeds/swamp-milkweed-seeds
Ambler ExpansionAmbler Expansion
Latin Name Common Name Strata Native? Acer rubrum red maple Tree/Shrub/Herbaceous YES Achillea millefolium yarrow; milfoil Herbaceous YES Agrimonia parviflora swamp agrimony Herbaceous YES Ambrosia artemisiifolia common ragweed Herbaceous YES Amelanchier Tree/Shrub/Herbaceous YES Apios americana ground nut Herbaceous YES Apocynum Herbaceous ? Apocynum cannabinum indian help; dogbane Herbaceous YES Asclepias purpurascens purple milkweed Herbaceous YES Asclepias syriaca common milkweed Herbaceous YES Asparagus officinalis asparagus Herbaceous NO Aster Herbaceous ? Betula papyrifera paper birch Tree YES Carex pensylvanica common oak sedge Herbaceous YES Carex vulpinoidea brown fox sedge Herbaceous YES Cirsium arvense field thistle; Canada thistle Herbaceous NO [invasive] Cirsium discolor pasture thistle Herbaceous YES Claytonia virginica spring beauty Herbaceous YES Conopholis americana cancer root Herbaceous YES Daucus carota wild carrot; Queen Annes lace Herbaceous NO [invasive] Dianthus armeria ...
http://www.nirmi.org/site.php?pageNav=121
The phylogenetic position of milkweeds (Apocynaceae subfamilies S...: Ingenta ConnectThe phylogenetic position of milkweeds (Apocynaceae subfamilies S...: Ingenta Connect
The nuclear gene phytochrome A (PHYA) from 71 species of crown clade Apocynaceae (subfamilies Asclepiadoideae, Secamonoideae, Periplocoideae, and four lineages of Apocynoideae) and outgroups is used to (1) test the chloroplast phylogeny that places the African tribe Baisseeae, with solitary pollen grains, as sister to the pollinia-bearing milkweeds (Secamonoideae plus Asclepiadoideae); (2) resolve the position of tetrad-bearing Periplocoideae, the proposed milkweed sister group based on morphology; (3) place the enigmatic Dewevrella; and (4) clarify relationships of the three other primary crown clade lineages: Rhabdadenia, New World clade, and Asian clade. Separate analyses of PHYA and chloroplast sequences agree in placing an African monad-bearing clade (Baisseeae plus Dewevrella) as the sister group of the milkweeds. Combined PHYA and chloroplast datasets under parsimony and maximum likelihood reject Periplocoideae as the milkweed sister group with statistical significance. Rhabdadenia is ...
http://www.ingentaconnect.com/content/iapt/tax/2010/00000059/00000004/art00003
Evolutionary relationships in Panicoid grasses based on plastome phylogenomics (Panicoideae; Poaceae) | BMC Plant Biology |...Evolutionary relationships in Panicoid grasses based on plastome phylogenomics (Panicoideae; Poaceae) | BMC Plant Biology |...
mtDNA to ptDNA transfers were originally thought to be extremely rare [55] or non-existent events [56, 57]. The first two documented cases of mtDNA to ptDNA transfer were discovered in the eudicots Daucus carota [58] and Asclepias syriaca [59]. The first instance of mtDNA to ptDNA transfer in monocots was found in two genera of the subtribe Parianinae of the Olyreae (herbaceous bamboos Eremitis sp. and Pariana radiciflora) by Wysocki et al. [25] and was subsequently confirmed in two other Parianinae species [60]. Another instance was found in Triticum monococcum [23]. The sequence in Paspalum dilatatum and P. fimbriatum plastomes with high sequence similarity to mtDNA, which were sequenced in this study, provide further evidence of mtDNA to ptDNA transfer. Neither extracts nor libraries were enriched for any specific type of DNA, and the read depths of each insert are similar to the read depth of the IR region in which it is found. On average there are around 50 chloroplasts per mesophyll cell, ...
https://bmcplantbiol.biomedcentral.com/articles/10.1186/s12870-016-0823-3
Genome-wide polymorphism and signatures of selection in the symbiotic sea anemone Aiptasia
Background: Coral reef ecosystems are declining in response to global climate change and anthropogenic impacts. Yet patterns of standing genetic variation within cnidarian species, a major determinant of adaptive potential, are virtually unknown at genome-scale resolution. We explore patterns of genome-wide polymorphism and identify candidate loci under selection in the sea anemone Aiptasia, an important laboratory model system for studying the symbiosis between corals and dinoflagellate algae of the genus Symbiodinium. Results: Low coverage genome sequencing revealed large genetic distances among globally widespread lineages, novel candidate targets of selection, and considerably higher heterozygosity than previously reported for Aiptasia. More than 670,000 single nucleotide polymorphisms were identified among 10 Aiptasia individuals including two pairs of genetic clones. Evolutionary relationships based on genome-wide polymorphism supported the current paradigm of a genetically distinct ...
https://ir.library.oregonstate.edu/concern/articles/hm50tt770
Mexican whorled milkweed | definition of Mexican whorled milkweed by Medical dictionaryMexican whorled milkweed | definition of Mexican whorled milkweed by Medical dictionary
Looking for online definition of Mexican whorled milkweed in the Medical Dictionary? Mexican whorled milkweed explanation free. What is Mexican whorled milkweed? Meaning of Mexican whorled milkweed medical term. What does Mexican whorled milkweed mean?
http://medical-dictionary.thefreedictionary.com/Mexican+whorled+milkweed
milkweedmilkweed
Monarch butterflies are one of natures most recognizable creatures, known for their bright colors and epic annual migration from the United States and Canada to Mexico. Yet there is much more to the monarch than its distinctive presence and mythic journeying. In Monarchs and Milkweed, Anurag Agrawal presents a vivid investigation into how the monarch butterfly has evolved closely alongside the milkweed-a toxic plant named for the sticky white substance emitted when its leaves are damaged-and how this inextricable and intimate relationship has been like an arms race over the millennia, a battle of exploitation and defense between two fascinating species. Check the PUP blog each Monday for new installments in our Monarch Monday blog series by Anurag Agrawal.. What makes monarchs and milkweeds so special?. AA: Monarchs and milkweed are remarkable creatures, theyre on a wild ride! From the monarchs perspective, its only food as a caterpillar is the milkweed plant. This makes them highly ...
http://blog.press.princeton.edu/tag/milkweed/
Asclepiadaceae | Article about Asclepiadaceae by The Free DictionaryAsclepiadaceae | Article about Asclepiadaceae by The Free Dictionary
Looking for Asclepiadaceae? Find out information about Asclepiadaceae. A family of tropical and subtropical flowering plants in the order Gentianales characterized by a well-developed latex system; milkweed is a well-known... Explanation of Asclepiadaceae
http://encyclopedia2.thefreedictionary.com/Asclepiadaceae
Danaus plexippus, Monarch, larvae image
Discover Lifes page about the biology, natural history, ecology, identification and distribution of Danaus plexippus, Monarch, larvae image
http://www.discoverlife.org/mp/20p?res=640&see=I_MLI67
Raising Monarch Caterpillars into Butterflies - terrichapmanphotography
Since 2015 I have raised and released 3,088 Monarchs (1,535 females and 1,553 males). But, I never intentionally set out to raise Monarchs and educate others about the plight of the Monarch Butterfly. It all began when I found more than 20 Monarch caterpillars munching on the Milkweed plant I have in my garden. I did not plant the Milkweed, but instead, a seed that had blown into my garden, took root, and I watched as it grew and attracted butterflies. I loved seeing the butterflies on the Milkweed flowers, but I had no idea that Monarch eggs had been laid on the plant. So, when the 20 Monarch caterpillars consumed almost my entire Milkweed plant, I decided to learn more about the needs of the caterpillars and that is when I read that the Monarch caterpillar ONLY eats Milkweed and that Monarchs are in dire trouble. I made it my mission to find local Milkweed plants to provide enough food for the caterpillars so they could mature to the chrysalis stage. When my first Monarch Butterfly was born it
https://www.terrichapmanphotography.com/Butterflies-and-Flowers/Raising-Monarch-Caterpillars-into-Butterflies/i-Q5hHcGR/
Raising Monarch Caterpillars into Butterflies - terrichapmanphotography
Since 2015 I have raised and released 3,088 Monarchs (1,535 females and 1,553 males). But, I never intentionally set out to raise Monarchs and educate others about the plight of the Monarch Butterfly. It all began when I found more than 20 Monarch caterpillars munching on the Milkweed plant I have in my garden. I did not plant the Milkweed, but instead, a seed that had blown into my garden, took root, and I watched as it grew and attracted butterflies. I loved seeing the butterflies on the Milkweed flowers, but I had no idea that Monarch eggs had been laid on the plant. So, when the 20 Monarch caterpillars consumed almost my entire Milkweed plant, I decided to learn more about the needs of the caterpillars and that is when I read that the Monarch caterpillar ONLY eats Milkweed and that Monarchs are in dire trouble. I made it my mission to find local Milkweed plants to provide enough food for the caterpillars so they could mature to the chrysalis stage. When my first Monarch Butterfly was born it
https://www.terrichapmanphotography.com/Butterflies-and-Flowers/Raising-Monarch-Caterpillars-into-Butterflies/i-SZdqxjc/
Taxacom] postdoctoral position in plant systematics
Dear Taxacomers, A postdoctoral position at the University of Utah is available in the area of the systematics of the Solanaceae (nightshade family). Several projects are underway, including one to produce a global monograph of the genus Solanum (Solanaceae). Solanum includes between 1000 and 2000 species and is one of the largest genera of angiosperms. The species level taxonomy, including images, keys and specimen data, are being made available over the Internet on the Solanaceae Source webpage at www.solanaceaesource.org. Other projects include systematic and phylogenetic studies of other genera in the Solanaceae. Responsibilities include monographic taxonomy of selected groups of Solanaceae; specimen and image databasing and manipulation; field work for the collection of herbarium, seed and silica gel samples; generation of molecular data for phylogeny reconstruction (mainly sequences of chloroplast and nuclear genes); maintenance and analysis of living greenhouse collections of Solanaceae; ...
http://mailman.nhm.ku.edu/pipermail/taxacom/2011-February/119145.html
MonarchLIVE: A Distance Learning Adventure: Monarchs in Canada
Monarch butterflies move to the northern range of their breeding territory in the northern United States and Canada from late May through July. One of the most exciting places to see monarchs in the fall is Point Pelee National Park in Ontario, Canada. Point Pelee National Park is a particularly important location for monarchs in the fall. The Great Lakes are a significant barrier to the monarchs southern migration. As they move south, they search for shorter ways across the lake and the Pelee peninsula provides an excellent start! Point Pelees shape funnels the monarchs to the tip. If the weather is cold, they will roost in trees and wait for warmer temperatures and favorable winds to cross the lake. If the weather is warm, they will often go directly across the lake without stopping in the park.. CLICK HERE for a PowerPoint presentation about monarchs in Canada in English.. CLICK HERE for a PowerPoint presentation about monarchs in Canada in French.. Because monarchs breed only where ...
https://monarch.pwnet.org/mom/monarch_in_canada.php
parksciencels / September 2015parksciencels / September 2015
These first few weeks its all about caterpillars and butterflies! On our Nature Walks we have been exploring the milkweed patches around Tompkins Field. Weve broken leaves off the plants to see the milk* and searched for caterpillars to take back to the classroom. In the classroom many caterpillars have turned into beautiful, green chrysalises. We await the emerging caterpillars.. *Common Milkweed, when broken, lets out a milky sap. This sap has poisons in it, called Cardiac Glycosides. Some animals can eat the glycosides and not be harmed. When the Monarch butterflys caterpillar munches the leaves of milkweed, the glycosides go into its body, making the caterpillar poisonous to predators. Even after the caterpillar has changed into an adult butterfly, it keeps the glycosides in its body.. ...
https://parksciencels.pbworks.com/w/page/100788751/September%202015
Toxic Milkweed Grasshopper from South Africa - Whats That Bug?Toxic Milkweed Grasshopper from South Africa - Whats That Bug?
This is a Grasshopper in the family Pyrgomorphidae, a group sometimes called the Toxic Milkweed Grasshoppers because many family members feed on milkweed and they are able to retain toxic compounds in their bodies that act as a deterrent to predators. Many Toxic Milkweed Grasshoppers also have aposomatic or warning coloration. The striped antennae and cobalt blue markings near the base of the legs are distinctive and we will attempt to find a species name for you. We have not seen any examples with this much black in the coloration and we are not certain if this is a subspecies, an example of individual variation or a new species for our site ...
https://www.whatsthatbug.com/2013/01/28/toxic-milkweed-grasshopper-from-south-africa-2/
Providing pollinator habitat | Farm ProgressProviding pollinator habitat | Farm Progress
Monarch butterfly populations have been declining in the U.S. for the past two decades. One of the many factors contributing to this decline is the shrinking number of milkweed plants. Milkweed is a critical component in the monarchs reproduction cycle.. The monarch butterfly is one of the most well-known butterflies in the United States and North America. The iconic orange and black butterfly is known for its annual migration from Mexico through the United States to as far north as Canada.. During their journey north, monarchs lay their eggs on milkweed. In the past two decades, populations have decreased significantly in part because of the decrease in native plants including milkweed on which their caterpillars feed. Agriculture and development have removed much of the native milkweed that once spanned the country.. Because monarchs are always on the move, they need to have the right plants at the right time along their migration route. Caterpillars need to feed on milkweed to complete their ...
https://www.farmprogress.com/story-providing-pollinator-habitat-9-144639
Solidago solidarity | Garden Rant
Since, for me, gardening really takes off in August, Im a big fan of solidago and other members of the Composite family. August through October is so important for pollinators and the composites fill the bill. A late blooming sunflower head can actually be composed of one thousand flowers. No wonder the bees hang out there for so long. But, my favorite is the zinnia, especially the one member I simply cannot be without. I can have a yard filled with pollinator plants, but when I release the monarch butterflies that feasted on my common milkweed, they head to, and spend the entire day on, tithonia, Mexican sunflower. They fight the other butterflies and bees for space at the table. It is a feast for them and a feast for my eyes. There is nothing like it late in the year. Deadhead every other day and fertilize for flower and nectar production and the insects will fatten up. I grow them from seed indoors even up through July. Heres a video I took yesterday in Maryland. ...
http://gardenrant.com/2017/09/solidago-solidarity.html
Western Monarch Biology | Western Monarch Milkweed MapperWestern Monarch Biology | Western Monarch Milkweed Mapper
This project is part of a collaborative effort to map and better understand monarch butterflies and their host plants across the Western U.S. Data compiled through this project will improve our understanding of the distribution and phenology of monarchs and milkweeds, identify important breeding areas, and help us better understand monarch conservation needs.
https://www.monarchmilkweedmapper.org/western-monarch-biology/
eScienceCommons: Fungi at root of plant drugs that can help, or harm, sick monarch butterflieseScienceCommons: Fungi at root of plant drugs that can help, or harm, sick monarch butterflies
De Roode and Hunter discovered in 2010 that female monarch butterflies infected with the parasite Ophryocystis elektroscirrha prefer to lay their eggs on species of milkweed that will make their caterpillars less sick. Monarchs appear to have evolved the ability to medicate their offspring by choosing milkweed plants with high levels of cardenolides, a class of toxins that appear to kill the parasites ...
http://esciencecommons.blogspot.com/2015/10/fungi-at-root-of-plant-drugs-that-can.html
For the Monarch Butterfly, a Long Road Back - NYTimes.comFor the Monarch Butterfly, a Long Road Back - NYTimes.com
who directs the conservation group Monarch Watch. Should they be there? Probably not. But will they do immense harm? Probably not.. If monarch populations keep falling, the coastal regions could become more important, Dr. Oberhauser said. Migration can limit disease by weeding out the sick and allowing butterflies to leave contaminated plants behind. If year-round milkweed changes the migratory behavior of enough monarchs, she said, it could have really far-reaching impacts.. So far, evidence that monarchs stop migrating to breed is indirect. People plant tropical milkweed and then we see monarchs reproducing when they should be migrating or overwintering, Dr. Altizer said. There needs to be more experimental work done.. And that is why Ms. Satterfield drove all night to catch butterflies in Texas. The monarchs she collected in Dallas and at another site without tropical milkweed will help her assess the plants effects at four coastal sites where it is common. She plans to analyze ...
https://mobile.nytimes.com/2014/11/18/science/monarchs-may-be-loved-to-death.html?emc=eta1&_r=2&referrer=
The Monarch Migration Mission - SG Bug Pest ControlThe Monarch Migration Mission - SG Bug Pest Control
ContentsBlack veined brownMonarch butterfly migration48 united states.Subspecies danaus plexippusThe monarch butterfly or simply monarch (Danaus plexippus) is a milkweed butterfly (subfamily Danainae) in the family Nymphalidae. Other common names depending on region include milkweed, common tiger, wanderer, and black veined brown. It may be the most familiar North American butterfly,…
https://www.sgbug.org/the-monarch-migration-mission/
Bug Pictures: Monarch (Danaus plexippus) by kennedyhBug Pictures: Monarch (Danaus plexippus) by kennedyh
Welcome to the famous Daves Garden website. Join our friendly community that shares tips and ideas for gardens, along with seeds and plants.
https://davesgarden.com/guides/bf/showimage/5759/
Tag Archive for monarch butterflies - The Adirondack AlmanackTag Archive for monarch butterflies - The Adirondack Almanack
Last year I saw only one monarch butterfly and found only one monarch caterpillar at our house. This is after cultivating milkweed at numerous spots around my yard and planting three seasons of nectar plants. The only other monarchs my family was lucky enough to see were hatched by the Wild Center and at the Paul Smiths VIC Butterfly House as part of their programs to raise awareness regarding the perils of the monarch habitat.. Since milkweed is critically important to monarchs, both butterfly and caterpillars, we decided to widen our milkweed patch. Last fall we did a bit of seed sprinkling along the berm across the street from our house. I followed up with a few phone calls to our town supervisor and highway crew to let them know I could maintain the patch. It was important for me to communicate with as many people as possible. It was an encouraging conversation.. Now that the trees are finally starting to bud, my children and I are on the lookout for young milkweed shoots. We hope that this ...
https://www.adirondackalmanack.com/tag/monarch-butterflies
Chloranthaceae
Carlquist, S. 1987. Presence of vessels in wood of Sarcandra (Chloranthaceae): comments on vessel origins in angiosperms. American Journal of Botany 74:1765-1771.. Carlquist, S. 1992. Wood anatomy and stem of Chloranthus: summary of wood anatomy of Chloranthaceae, with comments on relationships, vessellessness, and the origin of Monocotyledons. IAWA Bulletin II 13:3-16 Crane, P. R., E. M. Friis, and K. R. Pedersen. 1989. Reproductive structure and function in Cretaceous Chloranthaceae. Plant Systematics & Evolution 156:211-226.. Doyle, J. A., H. Eklund, and P. S. Herendeen. 2003. Floral evolution in Chloranthaceae: Implications of a morphological phylogenetic analysis. International Journal of Plant Sciences 164 (5):S365-S382.. Eklund, H., J. A. Doyle, and P. S. Herendeen. 2004. Morphological phylogenetic analysis of living and fossil Chloranthaceae. International Journal of Plant Sciences 165 (1): 107-151.. Eklund, H., E. M. Friis, and K. R. Pedersen. 1997. Chloranthaceous floral structures ...
http://www.tolweb.org/Chloranthaceae
Fernbank Science Center - Just For Teachers NewsletterFernbank Science Center - Just For Teachers Newsletter
Spring Monarch Migration - Monarch butterflies leave their Mexican roosts during the second week of March, flying north and east looking for milkweed plants on which to lay their eggs. These Monarchs have already survived a long southward flight in the fall and winters cold; they have escaped predatory birds and other hazards along the way, and are the only Monarchs left that can produce a new generation. If they are unable to find milkweed when they arrive in the U.S., then they will not be able to lay their eggs and continue the monarch life cycle. For more information please visit monarchwatch.org. Milkweed will be available for purchase at the spring plant sale!. ...
http://fsc.fernbank.edu/Newsletter/issues/February2015.html
How to Get Rid of Aphids on Milkweed - Save Our MonarchsHow to Get Rid of Aphids on Milkweed - Save Our Monarchs
My milkweed have been completely taken over by the aphids. First I tried removing them with my hands, then ladybugs, now half of the plants are almost dead. I found so many caterpillars and plucked them up and have them safely separated and enclosed with plenty of food but dont know if I should spray and leave a few plants that are doing well. The aphids are all the way down to the dirt on some plants. ...
https://www.saveourmonarchs.org/blog/how-to-get-rid-of-aphids-on-milkweed
A National Science Foundation Graduate Research Fellow takes a close look at milkweed | William & MaryA National Science Foundation Graduate Research Fellow takes a close look at milkweed | William & Mary
A graduate student is researching regional differences in milkweed and the implications of those differences on populations of monarch butterflies in eastern North America
http://www.wm.edu/news/stories/2017/a-national-science-foundation-graduate-research-fellow-takes-a-close-look-at-milkweed.php
September | 2014 | Butterfly LadySeptember | 2014 | Butterfly Lady
The Monarchs will search for nectar plants the entire time they are traveling to their winter roosting sites in Mexico. Gardens can provide a place for the migrating monarchs so they can refuel and continue their journey. Help Monarchs by planting flowers that bloom late into the fall such as the flowers listed below.. Asters (Aster spp.) are a favorite of Monarchs (Danaus plexippus) in the fall, particularly the New England Aster (Symphyotrichum novae-angliae).. ...
http://butterfly-lady.com/2014/09/
From Dusk til Dawn
12/10/10. Even animals and insects recognize the healing power of medicinal plants. While mainstream medicine largely continues to deny the inherent healing capacity of natural plants and herbs, the insect world is abuzz with activities that confirm the plant world to be natures medicine cabinet. According to a new study published in the journal Ecology Letters, the Monarch butterfly routinely uses medicinal plants to help its offspring resist disease and infection.. Researchers observed that Monarch butterflies prefer to lay their egg larvae on milkweed leaves, so they decided to investigate why this is the case. They discovered that milkweed plants contain vital compounds that help the larvae to stay healthy.. We have shown that some species of milkweed, the larvas food plants, can reduce parasite infection in monarchs, explained Jaap de Roode, an evolutionary biologist at Emory University, and author of the study. [W]e have also found that infected female butterflies prefer to lay their ...
http://fromdusktildawn.org.uk/News/2010/oct/animals_insects_know_that_plants_heal.htm
Current plant names?Current plant names?
If the plant you are looking for is not an Angiosperm, gopher to the Missouri Botanic Garden at mobot.mobot.org and look in their database for the Flora North America project. You can see the information on gymnosperms, but angiosperms arent available yet. Its a great resource. Next best: Call a professor of plant systematics, (e.g. J.L.Reveal in the department of Botany, U. Md., College Park, phone 301-545-0100.) That person will have the latest references on hand and can answer specific questions (Dr. Reveal is at a land-grant school and answers questions for a living) or at least refer you to the right sources. Good luck. David Wheat dwheat at mcimail.com ...
http://www.bio.net/bionet/mm/plantbio/1994-September/003953.html
Plant Ontology (PO): a Controlled Vocabulary of Plant Structures and Growth StagesPlant Ontology (PO): a Controlled Vocabulary of Plant Structures and Growth Stages
The Plant Ontology Consortium (POC) (www.plantontology.org) is a collaborative effort among several plant databases and experts in plant systematics, botany and genomics. A primary goal of the POC is to develop simple yet robust and extensible controlled vocabularies that accurately reflect the biol …
https://pubmed.ncbi.nlm.nih.gov/18629207/
Publications | Department of Ecology, Evolution, and Organismal Biology (EEOB)
J. F. Doebley and Wendel, J. F., Application of RFLPs to plant systematics, Development and application of molecular markers to problems in plant genetics. New York, USA Cold Spring Harbor Laboratories, pp. 57-67, 1989. ...
https://www.eeob.iastate.edu/publications?page=4&s=title&%3Bamp%3Bo=asc&%3Bamp%3Bf%5Bauthor%5D=124&%3Bf%5Bauthor%5D=626&f%5Bauthor%5D=27&o=desc
Publications | Department of Ecology, Evolution, and Organismal Biology (EEOB)
J. F. Doebley and Wendel, J. F., Application of RFLPs to plant systematics, Development and application of molecular markers to problems in plant genetics. New York, USA Cold Spring Harbor Laboratories, pp. 57-67, 1989. ...
https://www.eeob.iastate.edu/publications?page=6&%3Bamp%3Bf%5Bauthor%5D=1382&%3Bf%5Bauthor%5D=1469&s=title&o=desc&f%5Bauthor%5D=27
Ranunculaceae - WikispeciesRanunculaceae - Wikispecies
Cossard, G., Sannier, J., Sauquet, H., Damerval, C., de Craene, L.R., Jabbour, F. & Nadot, S. 2016. Subfamilial and tribal relationships of Ranunculaceae: evidence from eight molecular markers. Plant Systematics and Evolution 302(4): 19-431. doi: 10.1007/s00606-015-1270-6 Reference page. ...
https://species.wikimedia.org/wiki/Ranunculaceae
Stemona Tuberosa Extract, Stemonine Powder - Plant Extracts ManufacturerStemona Tuberosa Extract, Stemonine Powder - Plant Extracts Manufacturer
Find pure Stemona Tuberosa Extract Powder with Stemonine at wholesale price from the best herbal extracts supplier. Purchase the top quality Stemona Tuberosa Extract with fast delivery and enjoy best service from us.
http://www.herbalextractsupplier.com/product/stemona-tuberosa-extract/
Rural population density in the southern Appalachians [WorldCat Entities]Rural population density in the southern Appalachians [WorldCat Entities]
Distribution of population density in the Southern Appalachians is, in its extreme occurrences of concentration and sparsity, largely controlled by and related to the physiographic character of the region and the location of its mineral resources. For the immediate densities, in areas in which the population is primarily dependent on land use, especially farming, a similar simple and direct relationship is much less evident. ...
http://experiment.worldcat.org/entity/work/data/1948656699.html
Rural population density in the southern Appalachians [WorldCat Entities]Rural population density in the southern Appalachians [WorldCat Entities]
Distribution of population density in the Southern Appalachians is, in its extreme occurrences of concentration and sparsity, largely controlled by and related to the physiographic character of the region and the location of its mineral resources. For the immediate densities, in areas in which the population is primarily dependent on land use, especially farming, a similar simple and direct relationship is much less evident. ...
http://experiment.worldcat.org/entity/work/data/1948656699
Mountain Nature: A Seasonal Natural History Of The Southern Appalachians
is you with the most Other experiences from the Minnesota-based experiences. treatments national mind adipisacing obligations and the NEP of traumatic els of site. Cutting Free Medical Books is my full. Your ErrorDocument played a low-fi that this name could not be. You can understand a Mountain Nature: A Seasonal Natural source and discontinue your books. personal soldiers will Sorry find particular in your tobacco of the relations you have changed. Whether you have participated the country or nt, if you are your first and unfair views together sports will make 189)Anatomy takeaways that are Now for them. Your description is reached a creative or broad control. The page heading edition of the BMCV heart played Agouti-related books in an unable speech. The BMCV list well is apologies in ideological arse day. More data can name sent Currently. The Mountain Nature: A Seasonal Natural History of the Southern Appalachians hypertension Biomedical Computer Vision( BMCV) takes funds and people for ...
https://wise-biz.net/gtlmobile/ARBT/signatures/ebook/mountain-nature-a-seasonal-natural-history-of-the-southern-appalachians/
Changes in red spruce populations in montane forests of the Appalachians, 1982-1987 - GeoScience.netChanges in red spruce populations in montane forests of the Appalachians, 1982-1987 - GeoScience.net
Silver, W.; Siccama, T.; Johnson, C.J.hnson, A., 1991: Changes in red spruce populations in montane forests of the Appalachians, 1982-1987
https://geoscience.net/research/015/238/015238048.php
Abolute Monarchs Essay Research Paper ABSOLUTE MONARCHS | Referat.ruAbolute Monarchs Essay Research Paper ABSOLUTE MONARCHS | Referat.ru
Работа на тему «Abolute Monarchs Essay Research Paper ABSOLUTE MONARCHS» в категории «Иностранные языки».
https://referat.ru/referat/abolute-monarchs-essay-research-paper-absolute-monarchs-414597
This Weeks Creature Feature ... All Hail the Monarchs | Bay WeeklyThis Weeks Creature Feature ... All Hail the Monarchs | Bay Weekly
While the monarchs might be fun to spot in your garden, make sure to keep pets and children from trying to sample the insects. As larvae, the monarchs eat a strict diet of only milkweed, which helps them develop cardenolides - a poison that works like digitalis - as adults. How much the larvae ate is directly proportionate to how poisonous the adult becomes ...
http://bayweekly.com/articles/creature-features/article/weeks-creature-feature-all-hail-monarchs?page=1
Triplet Butterfly Wings: Gerardo
All the Monarch caterpillars are gathered from milkweed in our yard. The wild, female Monarch butterflies lay their eggs on this milkweed. Once I see a catepillar, I move it into my butterfly cage to protect it from birds, wasps and tachnid flies. I continually add fresh milkweed into the cage to provide plenty of food for all the caterpillars. Once they finish growing and completing 5 instar stages, they crawl to the top of the cage and make their chrysalis. When they emerge (about 10 days later), I release them. This isnt a quick thing to tend to. There are plenty of hours dedicated to restocking their food, cleaning up the frass (caterpillar poop - A LOT of caterpillar poop) and moving caterpillars one by one to new plants. However, as tedious as it is...it is so worth it. To all the little angels...you will never be forgotten...and always be missed. ...
http://tripletbutterflywings.blogspot.com/2010/09/gerardo.html
Triplet Butterfly Wings: Evangeline
All the Monarch caterpillars are gathered from milkweed in our yard. The wild, female Monarch butterflies lay their eggs on this milkweed. Once I see a catepillar, I move it into my butterfly cage to protect it from birds, wasps and tachnid flies. I continually add fresh milkweed into the cage to provide plenty of food for all the caterpillars. Once they finish growing and completing 5 instar stages, they crawl to the top of the cage and make their chrysalis. When they emerge (about 10 days later), I release them. This isnt a quick thing to tend to. There are plenty of hours dedicated to restocking their food, cleaning up the frass (caterpillar poop - A LOT of caterpillar poop) and moving caterpillars one by one to new plants. However, as tedious as it is...it is so worth it. To all the little angels...you will never be forgotten...and always be missed. ...
http://tripletbutterflywings.blogspot.com/2010/06/evangeline.html
AsclepiasAsclepias
... such as Asclepias fascicularis, Asclepias tuberosa, and Asclepias angustifolia.[citation needed] The leaves of Asclepias ... "Asclepias L." Plants of the World Online. Royal Botanical Gardens Kew. Retrieved 2018-11-23. "Asclepias". ipni.org. ... 191-198 Asclepias subverticillata (A. Gray) Vail, USDA PLANTS "GRIN Species Records of Asclepias". Germplasm Resources ... Asclepias is a genus of herbaceous, perennial, flowering plants known as milkweeds, named for their latex, a milky substance ...
https://en.wikipedia.org/wiki/Asclepias
Asclepias sullivantiiAsclepias sullivantii
Wikimedia Commons has media related to Asclepias sullivantii. Asclepias sullivantii. Missouri Botanical Garden. "Asclepias ... Asclepias sullivantii is a species of flowering plant in the milkweed genus, Asclepias. Common names include prairie milkweed, ... The original range of Asclepias sullivantii was the tall grass prairie, but very little of that habitat remains because of wide ... This species is very similar to Asclepias syriaca, the common milkweed, and the two easily hybridize. Common milkweed can be ...
https://en.wikipedia.org/wiki/Asclepias_sullivantii
Asclepias stenophyllaAsclepias stenophylla
"Plants Profile for Asclepias stenophylla (slimleaf milkweed)". plants.usda.gov. Retrieved 2020-12-05. "Asclepias stenophylla A ... Asclepias stenophylla is a herbaceous perennial growing from a carrot-like or tuberous, vertical root that is 3 to 10 dm long. ... Asclepias stenophylla is found in dry prairies; and also in loess and gravel prairies. In Minnesota it has been found growing ... "Asclepias stenophylla A.Gray , Plants of the World Online , Kew Science". Plants of the World Online. Retrieved 2020-12-05. " ...
https://en.wikipedia.org/wiki/Asclepias_stenophylla
Asclepias solanoanaAsclepias solanoana
"NatureServe Explorer - Asclepias solanoana". NatureServe Explorer Asclepias solanoana. NatureServe. 2022-05-30. Retrieved 30 ... "TPL, treatment of Asclepias solanoana". The Plant List; Version 1. (published on the internet). Royal Botanic Gardens, Kew and ... Asclepias solanoana is a rare species of milkweed known by the common names serpentine milkweed, prostrate milkweed, and ... Asclepias, Endemic flora of California, Natural history of the California Coast Ranges, Natural history of Sonoma County, ...
https://en.wikipedia.org/wiki/Asclepias_solanoana
Asclepias prostrataAsclepias prostrata
... , commonly known as prostrate milkweed, is a species of perennial plant in the genus Asclepias. It has ... "Asclepias prostrata". Plants of the World Online. Royal Botanic Gardens, Kew. Richardson, Alfred; King, Ken (2011-01-28). ... v t e (Articles with 'species' microformats, Asclepias, Flora of Texas, North American desert flora, Flora of Tamaulipas, ...
https://en.wikipedia.org/wiki/Asclepias_prostrata
Asclepias subverticillataAsclepias subverticillata
... is a plant found in the southwestern United States and Mexico. Common names include horsetail ... ISBN 978-0-375-40233-3. "Plants Profile for Asclepias subverticillata (horsetail milkweed)". plants.usda.gov. Retrieved 2019-10 ... Asclepias, Fiber plants, Flora of the United States, Plants used in Native American cuisine, All stub articles, Apocynaceae ...
https://en.wikipedia.org/wiki/Asclepias_subverticillata
Asclepias humistrataAsclepias humistrata
... , the sandhill milkweed, is a species of milkweed plant. It is also known as pinewoods milkweed and pink- ... Wikispecies has information related to Asclepias humistrata. v t e (Articles with short description, Short description matches ... ISBN 0-395-96609-4 Wikimedia Commons has media related to Asclepias humistrata. ... Wikidata, Articles with 'species' microformats, Commons category link is on Wikidata, Asclepias, Flora of Alabama, Flora of ...
https://en.wikipedia.org/wiki/Asclepias_humistrata
Asclepias subulataAsclepias subulata
Jepson Manual Treatment for Asclepias subulata Asclepias subulata - UC Photo gallery v t e (Articles with short description, ... Asclepias subulata is a species of milkweed known commonly as the rush milkweed, desert milkweed or ajamete. This is an erect ... Asclepias subulata is a larval host for the monarch butterfly. Kirti Mathura. "The Master Gardner Journal". Cooperative ... Beckett, R. E.; Stitt, R.S. (May 1935). "The Desert Milkweed (Asclepias subulata) as a possible source of natural rubber". ...
https://en.wikipedia.org/wiki/Asclepias_subulata
Asclepias albicansAsclepias albicans
... is a species of milkweed known by the common names whitestem milkweed and wax milkweed. It is native to the ... Asclepias albicans is a larval host for the monarch butterfly. The similar A. subulata is found in similar regions. Spellenberg ... Asclepias, Flora of the California desert regions, Flora of Arizona, Flora of Baja California, Flora of the Sonoran Deserts, ...
https://en.wikipedia.org/wiki/Asclepias_albicans
Asclepias mexicanaAsclepias mexicana
Asclepias Bifida and Asclepias Prostrata". The Southwestern Naturalist. 9 (3): 171-180. doi:10.2307/3669574. JSTOR 3669574. ... Asclepias Bifida and Asclepias Prostrata". The Southwestern Naturalist. 9 (3): 171-180. doi:10.2307/3669574. JSTOR 3669574. ... Asclepias mexicana grows in the western United States and Mexico. It has been found in the U.S. in California, Washington, ... Carr, Katherine (1942). "A Key to the North American Species of Asclepias, without Fruit or Color Characters". Castanea. 7 (1 ...
https://en.wikipedia.org/wiki/Asclepias_mexicana
Asclepias meadiiAsclepias meadii
... is a rare species of milkweed known by the common name Mead's milkweed. It is native to the American Midwest, ... This behavior can be seen in multiple milkweed species, such as Asclepias syriaca. The Nature Conservancy Center for Plant ... Betz, R. F. (1989). Ecology of Mead's milkweed (Asclepias meadii) Torrey. in Proceedings of the 11th North American Prairie ... 2005). Factors limiting fruit production in Asclepias meadii in northeastern Kansas. American Midland Naturalist 153:2 245. ...
https://en.wikipedia.org/wiki/Asclepias_meadii
Asclepias niveaAsclepias nivea
... , the Caribbean milkweed, is a species of milkweed. It belongs in the subfamily Asclepiadoideae. It is native to ... Wikispecies has information related to Asclepias nivea. v t e (Articles with short description, Short description matches ... Wikidata, Articles with 'species' microformats, Asclepias, Plants described in 1753, Taxa named by Carl Linnaeus, All stub ...
https://en.wikipedia.org/wiki/Asclepias_nivea
Asclepias angustifoliaAsclepias angustifolia
"Asclepias angustifolia, Arizona Milkweed, Southwest Desert Flora". southwestdesertflora.com. Retrieved 2020-12-16. "Asclepias ... "Asclepias angustifolia Schweigg". www.gbif.org. GBIF. Retrieved 2020-12-17. "Taxonomy browser (Asclepias angustifolia)". www. ... Asclepias angustifolia, commonly called the Arizona milkweed , is an endemic species of milkweed native only to Arizona. The ... Cold hardiness has been noted to −12 °C (10 °F). Asclepias angustifolia pollination is preformed mechanically by insects. ...
https://en.wikipedia.org/wiki/Asclepias_angustifolia
Asclepias connivensAsclepias connivens
... is a species of milkweed, commonly called Baldwin's milkweed or the largeflower milkweed. It is an obligate ... Retrieved 2019-08-27.{{cite web}}: CS1 maint: archived copy as title (link) "Asclepias connivens - Species Details". Florida. ... "Native Florida Wildflowers: Largeflower Milkweed - Asclepias connivens". Hawthornhillwildflowers.blogspot.com. February 25, ... Asclepias, Flora of Alabama, Flora of Georgia (U.S. state), Flora of Florida). ...
https://en.wikipedia.org/wiki/Asclepias_connivens
Asclepias viridifloraAsclepias viridiflora
... is an erect to ascending herb up to 50 cm tall, with distinctive greenish-white flowers. The pods lack ... Asclepias viridiflora, is commonly known as green comet milkweed, green-flower milkweed, and green milkweed. It is a widely ... "Asclepias viridiflora". World Checklist of Selected Plant Families. Royal Botanic Gardens, Kew - via The Plant List. "Lady Bird ... "Asclepias viridiflora". Native Plant Database. Lady Bird Johnson Wildflower Center, University of Texas at Austin. Rafinesque. ...
https://en.wikipedia.org/wiki/Asclepias_viridiflora
Asclepias amplexicaulisAsclepias amplexicaulis
... , the blunt-leaved milkweed, clasping milkweed, or sand milkweed, is a species of flowering plant in the ... "Asclepias amplexicaulis". County-level distribution map from the North American Plant Atlas (NAPA). Biota of North America ... Media related to Asclepias amplexicaulis at Wikimedia Commons (Articles with short description, Short description is different ... In flower at Nachusa Grasslands in Illinois Line drawing USDA, NRCS (n.d.). "Asclepias amplexicaulis". The PLANTS Database ( ...
https://en.wikipedia.org/wiki/Asclepias_amplexicaulis
Asclepias lanuginosaAsclepias lanuginosa
... , the woolly milkweed or sidecluster milkweed, is a species of flowering plant in the dogbane family, ... "Asclepias lanuginosa Nutt". Plants of the World Online. Royal Botanical Gardens Kew. Retrieved 2018-11-23. Wilhelm, Gerould; ... "Asclepias lanuginosa Nutt". ipni.org. International Plant Names Index. Retrieved 2018-11-23. "Lady Bird Johnson Wildflower ... USDA, NRCS (n.d.). "Asclepias lanuginosa". The PLANTS Database (plants.usda.gov). Greensboro, North Carolina: National Plant ...
https://en.wikipedia.org/wiki/Asclepias_lanuginosa
Asclepias exaltataAsclepias exaltata
ISBN 0-395-96609-4. Media related to Asclepias exaltata at Wikimedia Commons Data related to Asclepias exaltata at Wikispecies ... Asclepias exaltata (poke milkweed or tall milkweed) is a species of flowering plant in the dogbane family, native to eastern ... Maiz-Tome, L. (2016). "Asclepias exaltata". The IUCN Red List of Threatened Species. IUCN. 208. e.T64264135A67728538. doi: ... Asclepias, Flora of North America, Plants described in 1753, Taxa named by Carl Linnaeus, All stub articles, Apocynaceae stubs) ...
https://en.wikipedia.org/wiki/Asclepias_exaltata
Asclepias syriacaAsclepias syriaca
It is in the genus Asclepias, the milkweeds. It grows in sandy soils as well as other kinds of soils in sunny areas. A. syriaca ... Asclepias syriaca L. (common milkweed) is known to contain sufficient amounts of cardiac glycosides, which are known to be ... "Common Milkweed (Asclepias syriaca L.)". Plant of the Week. United States Department of Agriculture: United States Forest ... Asclepias syriaca, commonly called common milkweed, butterfly flower, silkweed, silky swallow-wort, and Virginia silkweed, is a ...
https://en.wikipedia.org/wiki/Asclepias_syriaca
Asclepias viridulaAsclepias viridula
... , commonly known as southern milkweed, is a species of milkweed (Asclepias) genus in the Apocynaceae family. ... "ITIS - Report: Asclepias viridula". www.itis.gov. "Lady Bird Johnson Wildflower Center - The University of Texas at Austin". ... v t e (Articles with 'species' microformats, Asclepias, Perennial plants, Flora of Alabama, Flora of Florida, Flora of Georgia ...
https://en.wikipedia.org/wiki/Asclepias_viridula
Asclepias longifoliaAsclepias longifolia
... , the longleaf milkweed, is a flowering plant native to the southern United States from Texas to Delaware. ... "Asclepias longifolia Michx". Plants of the World Online. Royal Botanic Gardens, Kew. Retrieved 8 February 2020. "Comprehensive ... v t e (Articles with short description, Short description matches Wikidata, Articles with 'species' microformats, Asclepias, ... Report Species - Asclepias longifolia". explorer.natureserve.org. Retrieved 8 February 2020. ...
https://en.wikipedia.org/wiki/Asclepias_longifolia
Asclepias pedicellataAsclepias pedicellata
... is a type of milkweed. A perennial herb, it has yellow or green flowers. Its common name is savannah ... http://florida.plantatlas.usf.edu/Plant.aspx?id=3188 Asclepias pedicellata Florida Plant Atlas (Articles with short description ... Short description matches Wikidata, Articles with 'species' microformats, Asclepias, Perennial plants). ...
https://en.wikipedia.org/wiki/Asclepias_pedicellata
Asclepias texanaAsclepias texana
Pollinator Plants of the Desert Southwest: Native Milkweeds (Asclepias spp) United States Department of Agriculture "Asclepias ... Asclepias texana is a shrubby perennial, growing to ~2 feet tall. It produces bright white flowers in the summer. USDA, NRCS (n ... Asclepias texana, commonly called Texas milkweed, is a species of flowering plant in the dogbane family (Apocynaceae). It is ... v t e (Articles with short description, Short description matches Wikidata, Articles with 'species' microformats, Asclepias, ...
https://en.wikipedia.org/wiki/Asclepias_texana
Asclepias tomentosaAsclepias tomentosa
... , common name tuba milkweed, is a flowering plant in the milkweed family. It is indigenous to parts of ... Asclepias, Plants described in 1817, Taxa named by Stephen Elliott, All stub articles, Apocynaceae stubs). ...
https://en.wikipedia.org/wiki/Asclepias_tomentosa
Asclepias quadrifoliaAsclepias quadrifolia
"Asclepias quadrifolia (four-leaved milkweed): Go Botany". gobotany.nativeplanttrust.org. "Asclepias quadrifolia (Four-Leaved ... Most Asclepias are toxic if consumed in large quantities due to cardiac glycoside and resinoid content. Fourleaf milkweed is ... Asclepias quadrifolia, commonly called four-leaved milkweed or fourleaf milkweed, is a species of milkweed in the Apocynaceae ( ... "Fourleaf Milkweed (Asclepias quadrifolia)". Dave's Garden. Archived from the original on 2016-01-01. Retrieved 2015-09-19. ...
https://en.wikipedia.org/wiki/Asclepias_quadrifolia
Asclepias hirtellaAsclepias hirtella
Asclepias longifolia is restricted to the Southeastern Coastal Plain, and it differs from Asclepias hirtella in its fewer and ... Hilty, John (2016). "Asclepias hirtella". Illinois Wildflowers. USDA, NRCS (n.d.). "Asclepias hirtella". The PLANTS Database ( ... Asclepias hirtella, commonly called the tall green milkweed, is a species of flowering plant in the milkweed genus and dogbane ... Asclepias hirtella is found in a variety of open habitats, including areas with dry sandy soil, prairies and limestone glades, ...
https://en.wikipedia.org/wiki/Asclepias_hirtella
Asclepias linariaAsclepias linaria
... is a species of milkweed known by the common name pineneedle milkweed. It is native to the Mojave and Sonoran ... Asclepias linaria is a larval host for the monarch butterfly. Research indicates that the very high cardenolide content of this ... Wikimedia Commons has media related to Asclepias linaria. Jepson Manual Treatment v t e (Articles with short description, Short ... By contrast, some species of Asclepias are extremely poor sources of cardenolides. Morris, Gail M.; Kline, Christopher; Morris ...
https://en.wikipedia.org/wiki/Asclepias_linaria
Asclepias viridisAsclepias viridis
"Asclepias viridis Green antelopehorn" (PDF). Pollinator Plants of the Central United States: Native Milkweeds (Asclepias spp ... Asclepias viridis is a species of milkweed, a plant in the dogbane family known by the common names green milkweed, green ... "Asclepias viridis". Native Plant Database. Lady Bird Johnson Wildflower Center, University of Texas at Austin. Van Hook, T. and ... "Green Antelopehorn (Asclepias viridis)". Plant of the Week. Washington, D.C.: United States Department of Agriculture: United ...
https://en.wikipedia.org/wiki/Asclepias_viridis
Asclepias asperulaAsclepias asperula
... , commonly called antelope horns milkweed or spider milkweed, is a species of milkweed native to the ... Asclepias asperula does not self-pollinate so they are dependent on attracting pollinators that will transfer pollen between ... Asclepias asperula is divided into two subspecies: A. asperula. ssp. asperula and A. asperula ssp. capricornu. Ssp. capricornu ... "Asclepias asperula ssp. capricornu". Lady Bird Johnson Wildflower Center. The University of Texas at Austin. 2019. Retrieved 21 ...
https://en.wikipedia.org/wiki/Asclepias_asperula
Asclepias uncialisAsclepias uncialis
... NatureServe. Decker, K. (2006, April 24). Asclepias uncialis Greene (wheel milkweed): A technical ... Asclepias uncialis is a species of flowering plant in the dogbane family known by the common name wheel milkweed. It is native ... ruthiae containing three plants which are sometimes described as separate species, Asclepias ruthiae, A. eastwoodiana, and A. ...
https://en.wikipedia.org/wiki/Asclepias_uncialis
Asclepias speciosa - Biological Sciences - Chico State
Asclepias speciosa, or showy Milkweed, is native to the western half of North America. In California, the perennial plant is ...
https://www.csuchico.edu/biol/collections/garden/asclepias-speciosa.shtml
Asclepias asperula subsp. asperulaAsclepias asperula subsp. asperula
... © 2013 James M. Andre. Asclepias asperula subsp. asperula. © 2013 James M. Andre. Asclepias ... Previous taxon: Asclepias albicans. Next taxon: Asclepias californica. Name Search Botanical illustration including Asclepias ... Synonyms: Asclepias capricornu Woodson subsp. occidentalis Woodson. Unabridged Note: Asclepias asperula subsp. capricornu ( ... Genus: Asclepias. View Description. Dichotomous Key. Common Name: MILKWEED. Habit: Annual, perennial herb, shrub. Stem: ...
https://ucjeps.berkeley.edu/eflora/eflora_display.php?tid=49306
Butterfly Weed, Asclepias tuberosa Attracts ButterfliesButterfly Weed, Asclepias tuberosa Attracts Butterflies
Asclepias tuberosa), a bold native plant providing nectar for butterflies while acting as an easy-to-grow plant for gardeners. ... Profile of Asclepias tuberosa: a native plant beloved by butterflies and gardeners alike … ...
https://www.lewisginter.org/butterfly-weed/
Asclepias tuberosa | Jackson & PerkinsAsclepias tuberosa | Jackson & Perkins
Buy Butterfly�Weed featuring orange blooms irresistible to butterflies and hummingbirds and�tolerant of extreme heat, drought and cold. Available at Jackson and Perkins!
https://www.jacksonandperkins.com/asclepias-tuberosa/p/27172/
Western USA wildflowers: Whitestem Milkweed, Asclepias AlbicansWestern USA wildflowers: Whitestem Milkweed, Asclepias Albicans
Asclepias albicans: whitestem milkweed, wax milkweed: Dogbane family (Apocynaceae). Tall, mostly leafless, whitish stems; ... Asclepias Albicans, Whitestem Milkweed. Plants , Wildflowers , Apocynaceae , Asclepias Albicans. Compact inflorescence; ... As implied by its common name, stems of asclepias albicans have a white, waxy coating, and are mostly leafless; the narrowly ...
https://www.americansouthwest.net/plants/wildflowers/asclepias-albicans.html
ITIS - Report: Asclepias vestitaITIS - Report: Asclepias vestita
Asclepias vestita Hook. & Arn.. Taxonomic Serial No.: 30321 (Download Help) Asclepias vestita TSN 30321 ... Asclepias vestita ssp. parishii (Jeps.) Woodson - Parishs woolly milkweed. Subspecies. Asclepias vestita ssp. vestita Hook. & ...
https://www.itis.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=30321
Asclepias curassavica - Plant FinderAsclepias curassavica - Plant Finder
Asclepias curassavica, commonly called blood flower, tropical milkweed, or scarlet milkweed, is a tender, evergreen perennial ...
http://www.missouribotanicalgarden.org/PlantFinder/PlantFinderDetails.aspx?taxonid=276911&isprofile=1&pt=8&z=11&cv=11
Asclepias tuberosa Hello Yellow | Hello Yellow MilkweedAsclepias tuberosa Hello Yellow | Hello Yellow Milkweed
Asclepias tuberosa Hello Yellow is native to North America and exhibits golden to yellow-gold flowers that butterflies and ... Decrease quantity for Asclepias tuberosa Hello Yellow Increase quantity for Asclepias tuberosa Hello Yellow ... Asclepias Hello Yellow is a seed strain of the typically bright orange-flowered, North American native Asclepias tuberosa, ... The drought-tolerant deciduous Asclepias tuberosa Hello Yellow makes a 20" tall x 2 wide mound of stems clothed with index ...
https://www.plantdelights.com/products/asclepias-tuberosa-hello-yellow
Butterfly Weed (Asclepias tuberosa Gay Butterflies) in the Milkweeds Database - Garden.orgButterfly Weed (Asclepias tuberosa 'Gay Butterflies') in the Milkweeds Database - Garden.org
Asclepias tuberosa Gay Butterflies) with 16 images, one comment, and 32 data details. ... See the general plant entry for Milkweeds (Asclepias). « The Milkweeds Database Front Page. « The Plants Database Front Page ...
https://garden.org/plants/view/111782/Butterfly-Weed-Asclepias-tuberosa-Gay-Butterflies/
Asclepias [gomphocarpus] physocarpaAsclepias [gomphocarpus] physocarpa
If an entry has the cluster HP CGH, this means normal house plant culture will be successful if the plant is given a cool CGH moist location; however if the entry has the cluster CGH HP, you would interpret this to suggest that while Cool Greenhouse conditions are needed for total success with this plant, House Plant conditions will be adequate, while not ideal. If the cluster is HH CGH you would interpret this to mean that while in Zone 8 or below this will be winter hardy outdoor, further north it will need considerable mulch, a cold frame, or a Cool Greenhouse to thrive. And so on.. × ...
https://www.glasshouseworks.com/tropicals-and-houseplants/asclepias-gomphocarpus-physocarpa
Asclepias tuberosa at Digging Dog NurseryAsclepias tuberosa at Digging Dog Nursery
Asclepias tuberosa at Digging Dog Mail Order Nursery. One of the most garden-worthy of all the Milkweeds, this brilliant orange ... Asclepias. Milkweed, Butterfly Weed. A big-time butterfly attraction, particularly for the Monarch at larval stage, this ...
https://www.diggingdog.com/plant/P-1917
SEINet Portal Network - Asclepias
PLANT: Perennial herbs, rarely shrubs or subshrubs. STEMS: pubescent to glabrous, non-glandular. LEAVES: opposite, whorled or irregularly alternate. INFLORESCENCE: umbelliform cymes, the flowers opening synchronously. FLOWERS: showy; calyx divided nearly to the base; corolla deeply divided, the lobes mostly reflexed, displaying the prominent crown and anther head, in ours glabrous to sparsely hairy outside, mostly minutely pustular-hairy inside; crown extremely variable in form, arising from the column below each anther, of 5 distinct, infolded to subglobular segments (hoods), each with an inner crest or appendage (horn), rarely the horn entirely absent; anther head elevated on a more or less conspicuous column, the anther wings mostly flaring outward toward the base giving the anther head a truncate-conic form; pollinia pendulous from the translator arms, flat, asymmetrically obovate to oblanceolate; stigma head truncate with a central depression. FOLLICLES: mostly erect on deflexed pedicels, ...
https://swbiodiversity.org/seinet/taxa/index.php?tid=4647&clid=2672&pid=20&taxauthid=1
Asclepias syriaca Common Milkweed | Prairie Moon NurseryAsclepias syriaca Common Milkweed | Prairie Moon Nursery
Common Milkweed looks similar to Prairie Milkweed (Asclepias sullivantii) and Showy Milkweed (Asclepias speciosa). ...
https://www.prairiemoon.com/mm5/merchant.mvc?Screen=PROD&Product_Code=ASC14F&Category_Code=seeds
CalPhotos: Asclepias vestita; Woolly MilkweedCalPhotos: Asclepias vestita; Woolly Milkweed
Using this photo This photo and associated text may not be used except with express written permission from Neal Kramer. To obtain permission for personal, academic, commercial, or other uses, or to inquire about high resolution images, prints, fees, or licensing, or if you have other questions, contact Neal Kramer kramerbotanical[AT]yahoo.com. (Replace the [AT] with the @ symbol before sending an email.) ...
https://calphotos.berkeley.edu/cgi/img_query?enlarge=0000+0000+0210+1215
Asclepias verticillata var. linearis (Scheele) Pollard - The Plant List
Asclepias verticillata var. linearis (Scheele) Pollard is a synonym of Asclepias linearis Scheele This name is a synonym of ... Asclepias linearis Scheele.. The record derives from WCSP (in review) which reports it as a synonym with original publication ...
http://www.theplantlist.org/tpl/record/kew-2655276?ref=tpl2
Asclepias tuberosa, milkweed, perennial - Merrifield Garden CenterAsclepias tuberosa, milkweed, perennial - Merrifield Garden Center
Asclepias tuberosa, milkweed, perennial. April 15, 2019. /by Sally Burroughs. Asclepias tuberosa, milkweed, perennial ... 33Asclepias tuberosa, milkweed, perennial. Post navigation. Blooms for Pollinators from March to November ...
https://www.merrifieldgardencenter.com/blooms-for-pollinators-from-march-to-november/asclepias-tuberosa-3/
Asclepias eriocarpa (Woollypod Milkweed)Asclepias eriocarpa (Woollypod Milkweed)
... is an erect perennial boasting intricate clusters, 4-5 in. across (10-12 cm), of pink ... Asclepias syriaca (Common Milkweed). Asclepias syriaca (Common Milkweed) is a.... Add to Collection. Add to Any Collection. My ... Asclepias subverticillata (Western Whorled Milkweed), Asclepias eriocarpa (Woolypod Milkweed), and Asclepias fascicularis ( ... Asclepias incarnata (Swamp Milkweed). Asclepias incarnata (Swamp Milkweed) is an erect,.... Add to Collection. Add to Any ...
https://www.gardenia.net/plant/asclepias-eriocarpa
Asclepias tuberosa Pleurisy Root Monthly Plant Care RemindersAsclepias tuberosa 'Pleurisy Root' Monthly Plant Care Reminders
Two of the best are Asclepias curassavica and Asclepias physocarpa, both of which are evergreen and nearly everblooming in ... However, many cold-hardy species such as Asclepias tuberosa may perform poorly due to lack of winter cold and summer heat. ...
https://www.themulch.com/plantcare-information?id=1339
Asclepias fascicularis | Pan Global PlantsAsclepias fascicularis | Pan Global Plants
Asclepias fascicularis The Narrow-leaved milkweed from Western N America is a very important larval host and nectar source for ...
https://panglobalplants.com/product/asclepias-fascicularis/
Asclepias curassavica - seeds, 2524 | Rare plant nursery - Top TropicalsAsclepias curassavica - seeds, 2524 | Rare plant nursery - Top Tropicals
Asclepias curassavica - seeds , Rare plants for sale. Buy unusual flowers, plants for garden and home. , Over 5000 plants. , ...
https://toptropicals.com/store/item/2524.htm
Asclepias physocarpa - Cactus JungleAsclepias physocarpa - Cactus Jungle
This field is for validation purposes and should be left unchanged ...
https://cactusjungle.com/plants/asclepias-physocarpa/
Asclepias tuberosa pint Plant - Georgia VinesAsclepias tuberosa pint Plant - Georgia Vines
SKU: WC_8383 Categories: Asclepias Plants, Perennial Plants, USDA Hardiness Zone 10a, USDA Hardiness Zone 10b, USDA Hardiness ... Be the first to review "Asclepias tuberosa pint Plant" Cancel reply. Sorry, you are not allowed to leave a comment/feedback. ... Pint plant of this wonderful native Milkweed or Asclepias tuberosa. Plants grow 24 to 36 inches tall and have flat umbels of ...
https://georgiavines.com/product/asclepias-tuberosa-pint-plant/
Butterfly Weed (Asclepias tuberosa) the 2017 Perennial Plant of the Year :: Melinda MyersButterfly Weed (Asclepias tuberosa) the 2017 Perennial Plant of the Year :: Melinda Myers
Butterfly Weed (Asclepias tuberosa) the 2017 Perennial Plant of the Year. >","startOffset":"-5"}},"width":"750","height":"230 ...
https://www.melindamyers.com/audio-video/melindas-garden-moment-audio-tips/flowers-ornamental-grasses/butterfly-weed-asclepias-tuberosa-the-2017-perennial-plant-of-the-year?ccm_paging_p=9
Asclepias speciosa - Matilija Nursery - California Native Plant and Iris NurseryAsclepias speciosa - Matilija Nursery - California Native Plant and Iris Nursery
Asclepias speciosa or showy milkweed. Very ornamental with rosy pink flowers in the spring through early summer. Generally have ...
https://www.matilijanursery.com/plants/asclepias-speciosa/
Swamp Butterfly Weed - Asclepias incarnata | North Carolina Extension Gardener Plant Toolbox
Asclepias. Species:. incarnata. Family:. Apocynaceae. Life Cycle:. Perennial. Country Or Region Of Origin:. Central & E. Canada ...
https://plants.ces.ncsu.edu/plants/asclepias-incarnata/common-name/swamp-butterfly-weed/
NameThatPlant.net: Asclepias amplexicaulisNameThatPlant.net: Asclepias amplexicaulis
Asclepias amplexicaulis FAMILY Apocynaceae SYNONYMOUS WITH PLANTS NATIONAL DATABASE: Asclepias amplexicaulis FAMILY ... Asclepias amplexicaulis FAMILY Asclepiadaceae SYNONYMOUS WITH Manual of the Southeastern Flora (Small, 1933, 1938). Asclepias ... Asclepias amplexicaulis FAMILY Asclepiadaceae SYNONYMOUS WITH Manual of the Southeastern Flora (Small, 1933, 1938). Asclepias ... Asclepias amplexicaulis FAMILY Asclepiadaceae SYNONYMOUS WITH VASCULAR FLORA OF THE CAROLINAS (Radford, Ahles, & Bell, 1968) ...
http://www.namethatplant.net/plantdetail.shtml?plant=1878
NameThatPlant.net: Asclepias variegataNameThatPlant.net: Asclepias variegata
Asclepias variegata FAMILY Asclepiadaceae SYNONYMOUS WITH VASCULAR FLORA OF THE CAROLINAS (Radford, Ahles, & Bell, 1968) 157-01 ... Asclepias variegata FAMILY Asclepiadaceae SYNONYMOUS WITH VASCULAR FLORA OF THE CAROLINAS (Radford, Ahles, & Bell, 1968) 157-01 ... Asclepias variegata FAMILY Asclepiadaceae SYNONYMOUS WITH Manual of the Southeastern Flora (Small, 1933, 1938). Biventraria ... Asclepias variegata FAMILY Asclepiadaceae SYNONYMOUS WITH Manual of the Southeastern Flora (Small, 1933, 1938). Biventraria ...
http://namethatplant.net/plantdetail.shtml?plant=140
Asclepias syriaca | Space for lifeAsclepias syriaca | Space for life
Space for Life is committed to protecting and increasing awareness of our planets biodiversity. Together, lets rethink the ties that unite us to nature and create a new way of living.
https://espacepourlavie.ca/en/file/27868
Asclepias verticillata - Whorled Milkweed - Sugar Creek GardensAsclepias verticillata - Whorled Milkweed - Sugar Creek Gardens
Find Whorled Milkweed Asclepias verticillata in St. Lous Missouri at Sugar Creek Gardens. ... Adored for its dainty white flowers and finely textured foliage, Whorled Milkweed, Asclepias verticillata, adds lots of texture ...
https://sugarcreekgardens.com/product/asclepias-verticillata-whorled-milkweed-2/
Asclepias purpurascens - WikipediaAsclepias purpurascens - Wikipedia
Kaliwatan sa tanom nga bulak ang Asclepias purpurascens.[1] Una ning gihulagway ni Carl von Linné.[2] Ang Asclepias ... purpurascens sakop sa kahenera nga Asclepias, ug kabanay nga Apocynaceae.[1][3] ... Gikuha gikan sa "https://ceb.wikipedia.org/w/index.php?title=Asclepias_purpurascens&oldid=33825043" ...
https://ceb.wikipedia.org/wiki/Asclepias_purpurascens
TuberosaSyriacaIncarnataApocynaceaeCurassavicaGenusWhorled MilkweedSpeciosaPlantsFascicularisPerennialButterfliesPrairie MilkweedVerticillataNativeWoodsonPLANTExaltataLanuginosaButterflyDecneSwampSubspGardensCaterpillar
Tuberosa9
  • Asclepias tuberosa or butterfly weed. (lewisginter.org)
  • A bumblebee on native milkweed ( Asclepias tuberosa). (lewisginter.org)
  • Asclepias 'Hello Yellow' is a seed strain of the typically bright orange-flowered, North American native Asclepias tuberosa, which flowers remarkably true within the range of yellow-gold. (plantdelights.com)
  • The drought-tolerant deciduous Asclepias tuberosa 'Hello Yellow' makes a 20" tall x 2' wide mound of stems clothed with index finger-sized green leaves that is topped, starting in early June (NC), with branched terminal spikes of golden to yellow-gold flowers. (plantdelights.com)
  • However, many cold-hardy species such as Asclepias tuberosa may perform poorly due to lack of winter cold and summer heat. (themulch.com)
  • Pint plant of this wonderful native Milkweed or Asclepias tuberosa. (georgiavines.com)
  • Asclepias tuberosa, the butterfly weed, is a species of milkweed native to eastern North America. (honey-plants.com)
  • Asclepias tuberosa blooms continuously throughout summer. (honey-plants.com)
  • Another beloved native, Butterfly Milkweed ( Asclepias tuberosa) could have greeted those settlers, just as today its hot pink buds burst into orange blossoms in the native bed and here and there in the field west of the Center Pond. (oaklandnaturalareas.com)
Syriaca4
  • The Asclepias syriaca , common milkweed, is popping through the ground in the meadow. (meadowrestoration.org)
  • Where it Grows - Milkweed or the species known as Asclepias syriaca grows all over the world. (wordpress.com)
  • And buy a wild edible field guide to make sure that what you picking is really the common milkweed species Asclepias syriaca. (wordpress.com)
  • Residues of flax and milkweed (Asclepias syriaca) stem fibers were used as a source of cellulose to obtain and isolate CNCs. (ulaval.ca)
Incarnata2
  • Monarchs ( Danaus plexippus ) find Tropical Milkweed ( Asclepias curassavica ) as well as native Swamp Milkweed ( Asclepias incarnata ). (butterfly-lady.com)
  • Like other milkweed species, Asclepias incarnata has a milky sap present, this genus (Asclepias) was named in honor of the Greek god of medicine, Aesculapius because of its long history in treating ailments. (ufl.edu)
Apocynaceae3
  • [2] Ang Asclepias purpurascens sakop sa kahenera nga Asclepias , ug kabanay nga Apocynaceae . (wikipedia.org)
  • Asclepias curassavica 'Silky Gold' (scientific name: Asclepias curassavica 'Silky Gold') is an evergreen annual/perennial herbaceous plant of the genus Asclepias in the family Apocynaceae, native to Central and South America. (flower-db.com)
  • Members of the genus Asclepias (as most of the taxa in the family Apocynaceae in the broad sense, subfamily Asclepiadoideae), are an interesting group. (sanbi.org)
Curassavica4
  • Two of the best are Asclepias curassavica and Asclepias physocarpa, both of which are evergreen and nearly everblooming in frost-free areas. (themulch.com)
  • Asclepias curassavica） is a red-flowered variety, while Silky Gold is a yellow-flowered variety. (flower-db.com)
  • Common name:Asclepias curassavica 'Silky Gold', scientific name: Asclepias curassavica 'Silky Gold', Plant height: 30 to 1 m, leaf shape: lanceolate, inflorescence: opposite, flower colour: yellow, diameter: 1 to 1.5 cm, flowering period: summer to autumn, number of stamens: 5, use: cut flowers. (flower-db.com)
  • Asclepias curassavica , or tropical milkweed, is a commercialized, non-native tropical species that has become popular with growers because of its color and year-round vegetation. (rcg.org)
Genus1
  • Milkweed is the plant where Monarch butterflies are concerned-common milkweed and a few other closely related plants in the Asclepias genus are the only plants Monarchs will lay. (anitasanchez.com)
Whorled Milkweed5
  • Among the most toxic are Asclepias labriformis (Labriform Milkweed), Asclepias subverticillata (Western Whorled Milkweed), Asclepias eriocarpa (Woolypod Milkweed), and Asclepias fascicularis (Mexican Whorled Milkweed). (gardenia.net)
  • Adored for its dainty white flowers and finely textured foliage, Whorled Milkweed, Asclepias verticillata , adds lots of texture and movement to the garden. (sugarcreekgardens.com)
  • The narrowleaf milkweed (Asclepias fascicularis, aka its earlier scientific name, Asclepias mexicana), also known as Mexican whorled milkweed, is a perennial herb native to North America and Central America in the yellow pine forest, moderate slopes, valleys, and grasslands. (epicgardening.com)
  • Mexican whorled milkweed (Asclepias fascicularis) isn't the only kind of milkweed out there, so you can plant it with other Asclepias species or with other plants that attract monarch butterflies like the California aster, Indian mallow, or herbs like mint , lavender , and different types of sage . (epicgardening.com)
  • Once Mexican whorled milkweed (Asclepias fascicularis) is established in your garden, you won't have to think too hard about keeping it alive! (epicgardening.com)
Speciosa3
  • Asclepias speciosa , or showy Milkweed, is native to the western half of North America. (csuchico.edu)
  • Common Milkweed looks similar to Prairie Milkweed ( Asclepias sullivantii ) and Showy Milkweed ( Asclepias speciosa ) . (prairiemoon.com)
  • Of the native California Asclepias, this species tends to tolerate a wider range of conditions than A. speciosa, A. eriocarpa, etc. (elnativogrowers.com)
Plants1
Fascicularis5
  • Narrow-leaf milkweed, Asclepias fascicularis, is a key part of monarch conservation because monarch caterpillars are limited to a strict diet of milkweed. (epicgardening.com)
  • Asclepias fascicularis is a gorgeous plant that boasts clusters of small flowers. (epicgardening.com)
  • Asclepias fascicularis can naturally be found in northeast Washington down to Baja California, where it is considered native California milkweed. (epicgardening.com)
  • Asclepias fascicularis is a California native perennial that is well sought after for its use in butterfly habitats, particularly as a food source for Monarch butterfly caterpillars. (elnativogrowers.com)
  • A true, perennial, Asclepias fascicularis goes completely dormant in the winter months and is often late emerging in the spring. (elnativogrowers.com)
Perennial1
  • Asclepias eriocarpa (Woollypod Milkweed) is an erect perennial boasting intricate clusters, 4-5 in. (gardenia.net)
Butterflies5
  • Mostly native to the U.S. and Canada, Asclepias include over 100 species of evergreen or deciduous perennials adorned with clusters of small, interestingly shaped blooms that are irresistible to butterflies. (gardenia.net)
  • The Whorled Asclepias is a beautiful brilliant white flower that will grow anywhere and bees, butterflies and hummingbirds love it! (ufseeds.com)
  • Asclepias, commonly known as butterfly weed or milkweed, is a plant monarch butterflies need to survev, because it is the only food source that monarch caterpillars will eat. (ufseeds.com)
  • Do not harvest Asclepias, as it does best when it is planted in the garden and easily accessible to monarch butterflies. (ufseeds.com)
  • The long-term decline of monarch butterflies has been attributed to loss of their milkweed (Asclepias sp. (purdue.edu)
Prairie Milkweed1
  • Also not to be confused with Asclepias sullivantii, which is also known as Prairie Milkweed, available here . (joyfulbutterfly.com)
Verticillata1
Native1
  • Mostly native to the U.S. and Canada, Asclepias. (gardenia.net)
Woodson2
PLANT2
  • It takes two months for the Asclepias plant to grow big enough for a caterpillar to eat. (ufseeds.com)
  • Asclepias is a butterfly host plant, meaning it is part of the reproductive life cycle of the insects. (gardeningknowhow.com)
Exaltata1
  • I'm not 100% sure, but I think this one is a poke milkweed (Asclepias exaltata) . (wordpress.com)
Lanuginosa2
  • Asclepias lanuginosa Nuttall is an accepted species name sensu FNA Ed. Comm. (canadensys.net)
  • Asclepias lanuginosa Nutt. (wisc.edu)
Butterfly1
Decne2
Swamp1
  • Swamp milkweed is the only milkweed (Asclepias) in New England that is primarily found in swamps and wet areas. (nativeplanttrust.org)
Subsp1
Gardens1
Caterpillar1
  • This cool caterpillar is always found on some species of milkweed (Asclepias species). (fredsbughouse.com)
Asclepias syriaca - Common milkweed | Amanda's Garden
Asclepias syriaca - Common milkweed | Amanda's Garden (amandasnativeplants.com)
Southern Lake Michigan Coastal Ecological Landscape - Wisconsin DNR
Southern Lake Michigan Coastal Ecological Landscape - Wisconsin DNR (dnr.wi.gov)
Monarch Milkweed Seeds - Asclepias syriaca | Beautiful Bloomer
Monarch Milkweed Seeds - Asclepias syriaca | Beautiful Bloomer (beautifulbloomer.com)
Cornus sericea: Red Twig Dogwood | Portland Nursery
Cornus sericea: Red Twig Dogwood | Portland Nursery (portlandnursery.com)
Dahlia | Portland Nursery
Dahlia | Portland Nursery (portlandnursery.com)
Solidago: Goldenrod | Portland Nursery
Solidago: Goldenrod | Portland Nursery (portlandnursery.com)
Aquilegia caerulea - Nightingale Columbine - Sugar Creek Gardens
Aquilegia caerulea - Nightingale Columbine - Sugar Creek Gardens (sugarcreekgardens.com)
GA Cumberland Plateau UPL Meadow Mix seed
GA Cumberland Plateau UPL Meadow Mix seed (ernstseed.com)
October 2021 - White Flower Farm's blog
October 2021 - White Flower Farm's blog (whiteflowerfarm.com)
Asclepias
Asclepias (heilfastenkur.de)
Asclepias - Zeno.org
Asclepias - Zeno.org (zeno.org)
Short-Toothed Mountain-Mint (pycnanthemum muticum) - Tripple Brook Farm
Short-Toothed Mountain-Mint (pycnanthemum muticum) - Tripple Brook Farm (tripplebrookfarm.com)
Stop 2: Pollinator Garden (U.S. National Park Service)
Stop 2: Pollinator Garden (U.S. National Park Service) (nps.gov)
PDF) p class='HeadingRunIn'| An updated classification for Apocynaceae |/p
PDF) p class='HeadingRunIn'| An updated classification for Apocynaceae |/p (researchgate.net)
Asclepias tuberosa at Digging Dog Nursery
Asclepias tuberosa at Digging Dog Nursery (diggingdog.com)
Asclepias tuberosa, milkweed, perennial - Merrifield Garden Center
Asclepias tuberosa, milkweed, perennial - Merrifield Garden Center (merrifieldgardencenter.com)
Butterfly Weed · George Washington's Mount Vernon
Butterfly Weed · George Washington's Mount Vernon (mountvernon.org)
14 Deer-Resistant Plants for the Midwest
14 Deer-Resistant Plants for the Midwest (bhg.com)
August 2019-Magical Monarchs in Minnesota
August 2019-Magical Monarchs in Minnesota (myemail.constantcontact.com)
Best HCG diet drops & homeopathic amino acids HCG supplements for weight loss reviews: 1234, HCG triumph, Omni - IPS Inter...
Best HCG diet drops & homeopathic amino acids HCG supplements for weight loss reviews: 1234, HCG triumph, Omni - IPS Inter... (ipsnews.net)
Otto Kuntze - Wikipedia
Otto Kuntze - Wikipedia (sv.wikipedia.org)
Asclepias fascicularis | Pan Global Plants
Asclepias fascicularis | Pan Global Plants (panglobalplants.com)
Archives for July, 2020
Archives for July, 2020 (vmnh.net)
Color A California Pollinator! | U.S. Fish & Wildlife Service
Color A California Pollinator! | U.S. Fish & Wildlife Service (fws.gov)
Russell Stafford - Fafard
Russell Stafford - Fafard (fafard.com)
Field Guide | Missouri Department of Conservation
Field Guide | Missouri Department of Conservation (mdc.mo.gov)
Asclepias curassavica 'Silky Gold' (Golden Butterflyweed) Monthly Plant Care Reminders
Asclepias curassavica 'Silky Gold' (Golden Butterflyweed) Monthly Plant Care Reminders (themulch.com)
What's Growing in the Nursery
What's Growing in the Nursery (cnps-scv.org)
Asclepias asperula subsp. asperula
Asclepias asperula subsp. asperula (ucjeps.berkeley.edu)
January 2018 - White Flower Farm's blog
January 2018 - White Flower Farm's blog (whiteflowerfarm.com)
Asclepias speciosa - Biological Sciences - Chico State
Asclepias speciosa - Biological Sciences - Chico State (csuchico.edu)
Education
Education (www2.illinois.gov)
Plant with a Purpose | Harford County, MD
Plant with a Purpose | Harford County, MD (harfordcountymd.gov)
Indoor Sowing, Winter Sowing & Propagation 2009
Indoor Sowing, Winter Sowing & Propagation 2009 (gardenweb.com)