Arylamine N-Acetyltransferase: An enzyme that catalyzes the transfer of acetyl groups from ACETYL-COA to arylamines. It can also catalyze acetyl transfer between arylamines without COENZYME A and has a wide specificity for aromatic amines, including SEROTONIN. However, arylamine N-acetyltransferase should not be confused with the enzyme ARYLALKYLAMINE N-ACETYLTRANSFERASE which is also referred to as SEROTONIN ACETYLTRANSFERASE.Acetyltransferases: Enzymes catalyzing the transfer of an acetyl group, usually from acetyl coenzyme A, to another compound. EC 2.3.1.Aminobiphenyl Compounds: Biphenyl compounds substituted in any position by one or more amino groups. Permitted are any substituents except fused rings.Sulfamethazine: A sulfanilamide anti-infective agent. It has a spectrum of antimicrobial action similar to other sulfonamides.4-Aminobenzoic Acid: An aminobenzoic acid isomer that combines with pteridine and GLUTAMIC ACID to form FOLIC ACID. The fact that 4-aminobenzoic acid absorbs light throughout the UVB range has also resulted in its use as an ingredient in SUNSCREENS.Acetylation: Formation of an acetyl derivative. (Stedman, 25th ed)Histone Acetyltransferases: Enzymes that catalyze acyl group transfer from ACETYL-CoA to HISTONES forming CoA and acetyl-histones.Choline O-Acetyltransferase: An enzyme that catalyzes the formation of acetylcholine from acetyl-CoA and choline. EC 2.3.1.6.Fluorenes: A family of diphenylenemethane derivatives.Chloramphenicol O-Acetyltransferase: An enzyme that catalyzes the acetylation of chloramphenicol to yield chloramphenicol 3-acetate. Since chloramphenicol 3-acetate does not bind to bacterial ribosomes and is not an inhibitor of peptidyltransferase, the enzyme is responsible for the naturally occurring chloramphenicol resistance in bacteria. The enzyme, for which variants are known, is found in both gram-negative and gram-positive bacteria. EC 2.3.1.28.Pyrrolnitrin: 3-Chloro-4-(3-chloro-2-nitrophenyl)pyrrole. Antifungal antibiotic isolated from Pseudomonas pyrrocinia. It is effective mainly against Trichophyton, Microsporium, Epidermophyton, and Penicillium.Acetyl Coenzyme A: Acetyl CoA participates in the biosynthesis of fatty acids and sterols, in the oxidation of fatty acids and in the metabolism of many amino acids. It also acts as a biological acetylating agent.Amines: A group of compounds derived from ammonia by substituting organic radicals for the hydrogens. (From Grant & Hackh's Chemical Dictionary, 5th ed)p300-CBP Transcription Factors: A family of histone acetyltransferases that is structurally-related to CREB-BINDING PROTEIN and to E1A-ASSOCIATED P300 PROTEIN. They function as transcriptional coactivators by bridging between DNA-binding TRANSCRIPTION FACTORS and the basal transcription machinery. They also modify transcription factors and CHROMATIN through ACETYLATION.Carnitine O-Acetyltransferase: An enzyme that catalyzes the formation of O-acetylcarnitine from acetyl-CoA plus carnitine. EC 2.3.1.7.Molecular Sequence Data: Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.2-Acetylaminofluorene: A hepatic carcinogen whose mechanism of activation involves N-hydroxylation to the aryl hydroxamic acid followed by enzymatic sulfonation to sulfoxyfluorenylacetamide. It is used to study the carcinogenicity and mutagenicity of aromatic amines.Serine O-Acetyltransferase: An enzyme that catalyzes the conversion of L-SERINE to COENZYME A and O-acetyl-L-serine, using ACETYL-COA as a donor.Isoenzymes: Structurally related forms of an enzyme. Each isoenzyme has the same mechanism and classification, but differs in its chemical, physical, or immunological characteristics.N-Terminal Acetyltransferase A: An N-terminal acetyltransferase subtype that consists of the Naa10p catalytic subunit and the Naa15p auxiliary subunit. The structure of this enzyme is conserved between lower and higher eukaryotes. It has specificity for N-terminal SERINE; ALANINE; THREONINE; GLYCINE; VALINE; and CYSTINE residues and acts on nascent peptide chains after the removal of the initiator METHIONINE by METHIONYL AMINOPEPTIDASES.N-Terminal Acetyltransferase E: An N-terminal acetyltransferase subtype that consists of the Naa50p catalytic subunit, and the Naa10p and Naa15p auxiliary subunits. It has specificity for the N-terminal METHIONINE of peptides where the next amino acid in the chain is hydrophobic.Base Sequence: The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.Dihydrolipoyllysine-Residue Acetyltransferase: An enzyme that catalyzes the acetyltransferase reaction using ACETYL CoA as an acetyl donor and dihydrolipoamide as acceptor to produce COENZYME A (CoA) and S-acetyldihydrolipoamide. It forms the (E2) subunit of the PYRUVATE DEHYDROGENASE COMPLEX.2-Naphthylamine: A naphthalene derivative with carcinogenic action.Acetyl-CoA C-Acetyltransferase: An enzyme that catalyzes the formation of acetoacetyl-CoA from two molecules of ACETYL COA. Some enzymes called thiolase or thiolase-I have referred to this activity or to the activity of ACETYL-COA C-ACYLTRANSFERASE.Hydroxyacetylaminofluorene: A N-hydroxylated derivative of 2-ACETYLAMINOFLUORENE that has demonstrated carcinogenic action.Promoter Regions, Genetic: DNA sequences which are recognized (directly or indirectly) and bound by a DNA-dependent RNA polymerase during the initiation of transcription. Highly conserved sequences within the promoter include the Pribnow box in bacteria and the TATA BOX in eukaryotes.Amino Acid Sequence: The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.Benzidines: Very toxic industrial chemicals. They are absorbed through the skin, causing lethal blood, bladder, liver, and kidney damage and are potent, broad-spectrum carcinogens in most species.Aminosalicylic Acid: An antitubercular agent often administered in association with ISONIAZID. The sodium salt of the drug is better tolerated than the free acid.Coenzyme APineal Gland: A light-sensitive neuroendocrine organ attached to the roof of the THIRD VENTRICLE of the brain. The pineal gland secretes MELATONIN, other BIOGENIC AMINES and NEUROPEPTIDES.para-Aminobenzoates: Benzoic acids, salts, or esters that contain an amino group attached to carbon number 4 of the benzene ring structure.Substrate Specificity: A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.Transcription, Genetic: The biosynthesis of RNA carried out on a template of DNA. The biosynthesis of DNA from an RNA template is called REVERSE TRANSCRIPTION.Xenobiotics: Chemical substances that are foreign to the biological system. They include naturally occurring compounds, drugs, environmental agents, carcinogens, insecticides, etc.Biotransformation: The chemical alteration of an exogenous substance by or in a biological system. The alteration may inactivate the compound or it may result in the production of an active metabolite of an inactive parent compound. The alterations may be divided into METABOLIC DETOXICATION, PHASE I and METABOLIC DETOXICATION, PHASE II.Histones: Small chromosomal proteins (approx 12-20 kD) possessing an open, unfolded structure and attached to the DNA in cell nuclei by ionic linkages. Classification into the various types (designated histone I, histone II, etc.) is based on the relative amounts of arginine and lysine in each.Amino Acid Transport System A: A sodium-dependent neutral amino acid transporter that accounts for most of the sodium-dependent neutral amino acid uptake by mammalian cells. The preferred substrates for this transporter system include ALANINE; SERINE; and GLUTAMINE.Cloning, Molecular: The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.Kinetics: The rate dynamics in chemical or physical systems.Gene Expression Regulation, Enzymologic: Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in enzyme synthesis.Carcinogens: Substances that increase the risk of NEOPLASMS in humans or animals. Both genotoxic chemicals, which affect DNA directly, and nongenotoxic chemicals, which induce neoplasms by other mechanism, are included.CREB-Binding Protein: A member of the p300-CBP transcription factor family that was initially identified as a binding partner for CAMP RESPONSE ELEMENT-BINDING PROTEIN. Mutations in CREB-binding protein are associated with RUBINSTEIN-TAYBI SYNDROME.Saccharomyces cerevisiae Proteins: Proteins obtained from the species SACCHAROMYCES CEREVISIAE. The function of specific proteins from this organism are the subject of intense scientific interest and have been used to derive basic understanding of the functioning similar proteins in higher eukaryotes.DNA: A deoxyribonucleotide polymer that is the primary genetic material of all cells. Eukaryotic and prokaryotic organisms normally contain DNA in a double-stranded state, yet several important biological processes transiently involve single-stranded regions. DNA, which consists of a polysugar-phosphate backbone possessing projections of purines (adenine and guanine) and pyrimidines (thymine and cytosine), forms a double helix that is held together by hydrogen bonds between these purines and pyrimidines (adenine to thymine and guanine to cytosine).Transfection: The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.Plasmids: Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.DNA Adducts: The products of chemical reactions that result in the addition of extraneous chemical groups to DNA.Restriction Mapping: Use of restriction endonucleases to analyze and generate a physical map of genomes, genes, or other segments of DNA.1-Naphthylamine: A suspected industrial carcinogen (and listed as such by OSHA). Its N-hydroxy metabolite is strongly carcinogenic and mutagenic.E1A-Associated p300 Protein: A member of the p300-CBP transcription factors that was originally identified as a binding partner for ADENOVIRUS E1A PROTEINS.Aniline CompoundsLiver: A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.N-Terminal Acetyltransferases: Enzymes that catalyze the transfer of an acetyl group, usually from ACETYL COENZYME A, to the N-terminus of a peptide chain.Pyruvate Dehydrogenase Complex: A multienzyme complex responsible for the formation of ACETYL COENZYME A from pyruvate. The enzyme components are PYRUVATE DEHYDROGENASE (LIPOAMIDE); dihydrolipoamide acetyltransferase; and LIPOAMIDE DEHYDROGENASE. Pyruvate dehydrogenase complex is subject to three types of control: inhibited by acetyl-CoA and NADH; influenced by the energy state of the cell; and inhibited when a specific serine residue in the pyruvate decarboxylase is phosphorylated by ATP. PYRUVATE DEHYDROGENASE (LIPOAMIDE)-PHOSPHATASE catalyzes reactivation of the complex. (From Concise Encyclopedia Biochemistry and Molecular Biology, 3rd ed)N-Terminal Acetyltransferase B: An N-terminal acetyltransferase subtype that consists of the Naa20p catalytic subunit and the Naa25p auxiliary subunit. The structure of this enzyme is conserved between YEASTS and HUMAN. It has specificity for the N-terminal METHIONINE of peptides where the next amino acid in the chain is either ASPARTATE; GLUTAMATE; ASPARAGINE; OR GLUTAMINE.Transcription Factors: Endogenous substances, usually proteins, which are effective in the initiation, stimulation, or termination of the genetic transcription process.Isoniazid: Antibacterial agent used primarily as a tuberculostatic. It remains the treatment of choice for tuberculosis.RNA, Messenger: RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.Mycobacterium smegmatis: A rapid-growing, nonphotochromogenic species of MYCOBACTERIUM originally isolated from human smegma and found also in soil and water. (From Dorland, 28th ed)Mutation: Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.Gene Expression Regulation: Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.Spermine: A biogenic polyamine formed from spermidine. It is found in a wide variety of organisms and tissues and is an essential growth factor in some bacteria. It is found as a polycation at all pH values. Spermine is associated with nucleic acids, particularly in viruses, and is thought to stabilize the helical structure.Escherichia coli: A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.Sequence Homology, Amino Acid: The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.Nuclear Proteins: Proteins found in the nucleus of a cell. Do not confuse with NUCLEOPROTEINS which are proteins conjugated with nucleic acids, that are not necessarily present in the nucleus.Vesicular Acetylcholine Transport Proteins: Vesicular amine transporter proteins that transport the neurotransmitter ACETYLCHOLINE into small SECRETORY VESICLES. Proteins of this family contain 12 transmembrane domains and exchange vesicular PROTONS for cytoplasmic acetylcholine.Cell Line: Established cell cultures that have the potential to propagate indefinitely.Recombinant Proteins: Proteins prepared by recombinant DNA technology.Cholinergic Fibers: Nerve fibers liberating acetylcholine at the synapse after an impulse.Regulatory Sequences, Nucleic Acid: Nucleic acid sequences involved in regulating the expression of genes.PolyaminesSpermidine: A polyamine formed from putrescine. It is found in almost all tissues in association with nucleic acids. It is found as a cation at all pH values, and is thought to help stabilize some membranes and nucleic acid structures. It is a precursor of spermine.Catalysis: The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.Transcriptional Activation: Processes that stimulate the GENETIC TRANSCRIPTION of a gene or set of genes.Cytosol: Intracellular fluid from the cytoplasm after removal of ORGANELLES and other insoluble cytoplasmic components.Polymorphism, Genetic: The regular and simultaneous occurrence in a single interbreeding population of two or more discontinuous genotypes. The concept includes differences in genotypes ranging in size from a single nucleotide site (POLYMORPHISM, SINGLE NUCLEOTIDE) to large nucleotide sequences visible at a chromosomal level.Phenotype: The outward appearance of the individual. It is the product of interactions between genes, and between the GENOTYPE and the environment.Lysine: An essential amino acid. It is often added to animal feed.Cysteine Synthase: An enzyme that catalyzes the biosynthesis of cysteine in microorganisms and plants from O-acetyl-L-serine and hydrogen sulfide. This enzyme was formerly listed as EC 4.2.99.8.DNA-Binding Proteins: Proteins which bind to DNA. The family includes proteins which bind to both double- and single-stranded DNA and also includes specific DNA binding proteins in serum which can be used as markers for malignant diseases.Polymerase Chain Reaction: In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.Blotting, Southern: A method (first developed by E.M. Southern) for detection of DNA that has been electrophoretically separated and immobilized by blotting on nitrocellulose or other type of paper or nylon membrane followed by hybridization with labeled NUCLEIC ACID PROBES.Enzyme Stability: The extent to which an enzyme retains its structural conformation or its activity when subjected to storage, isolation, and purification or various other physical or chemical manipulations, including proteolytic enzymes and heat.Trans-Activators: Diffusible gene products that act on homologous or heterologous molecules of viral or cellular DNA to regulate the expression of proteins.Binding Sites: The parts of a macromolecule that directly participate in its specific combination with another molecule.Chromatin: The material of CHROMOSOMES. It is a complex of DNA; HISTONES; and nonhistone proteins (CHROMOSOMAL PROTEINS, NON-HISTONE) found within the nucleus of a cell.Enhancer Elements, Genetic: Cis-acting DNA sequences which can increase transcription of genes. Enhancers can usually function in either orientation and at various distances from a promoter.Recombinant Fusion Proteins: Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.Protein Binding: The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.Pseudomonas fluorescens: A species of nonpathogenic fluorescent bacteria found in feces, sewage, soil, and water, and which liquefy gelatin.Catalytic Domain: The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.Anacardic Acids: A group of 6-alkyl SALICYLIC ACIDS that are found in ANACARDIUM and known for causing CONTACT DERMATITIS.Acetylcholinesterase: An enzyme that catalyzes the hydrolysis of ACETYLCHOLINE to CHOLINE and acetate. In the CNS, this enzyme plays a role in the function of peripheral neuromuscular junctions. EC 3.1.1.7.Saccharomyces cerevisiae: A species of the genus SACCHAROMYCES, family Saccharomycetaceae, order Saccharomycetales, known as "baker's" or "brewer's" yeast. The dried form is used as a dietary supplement.Cricetinae: A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.HeLa Cells: The first continuously cultured human malignant CELL LINE, derived from the cervical carcinoma of Henrietta Lacks. These cells are used for VIRUS CULTIVATION and antitumor drug screening assays.Chloramphenicol Resistance: Nonsusceptibility of bacteria to the action of CHLORAMPHENICOL, a potent inhibitor of protein synthesis in the 50S ribosomal subunit where amino acids are added to nascent bacterial polypeptides.Glucosamine 6-Phosphate N-Acetyltransferase: An enzyme that catalyses the reaction of D-glucosamine 6-phosphate with ACETYL-COA to form N-acetylglucosamine 6-phosphate.Genes, Reporter: Genes whose expression is easily detectable and therefore used to study promoter activity at many positions in a target genome. In recombinant DNA technology, these genes may be attached to a promoter region of interest.Salmonella typhimurium: A serotype of Salmonella enterica that is a frequent agent of Salmonella gastroenteritis in humans. It also causes PARATYPHOID FEVER.Models, Molecular: Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.Mesocricetus: A genus of the family Muridae having three species. The present domesticated strains were developed from individuals brought from Syria. They are widely used in biomedical research.Genotype: The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.Chromatography, High Pressure Liquid: Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.Genes, Regulator: Genes which regulate or circumscribe the activity of other genes; specifically, genes which code for PROTEINS or RNAs which have GENE EXPRESSION REGULATION functions.Acyltransferases: Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.Chloramphenicol: An antibiotic first isolated from cultures of Streptomyces venequelae in 1947 but now produced synthetically. It has a relatively simple structure and was the first broad-spectrum antibiotic to be discovered. It acts by interfering with bacterial protein synthesis and is mainly bacteriostatic. (From Martindale, The Extra Pharmacopoeia, 29th ed, p106)Platelet Activating Factor: A phospholipid derivative formed by PLATELETS; BASOPHILS; NEUTROPHILS; MONOCYTES; and MACROPHAGES. It is a potent platelet aggregating agent and inducer of systemic anaphylactic symptoms, including HYPOTENSION; THROMBOCYTOPENIA; NEUTROPENIA; and BRONCHOCONSTRICTION.Histone Deacetylases: Deacetylases that remove N-acetyl groups from amino side chains of the amino acids of HISTONES. The enzyme family can be divided into at least three structurally-defined subclasses. Class I and class II deacetylases utilize a zinc-dependent mechanism. The sirtuin histone deacetylases belong to class III and are NAD-dependent enzymes.Amino-Acid N-Acetyltransferase: A mitochondrial matrix enzyme that catalyzes the synthesis of L-GLUTAMATE to N-acetyl-L-glutamate in the presence of ACETYL-COA.Protein Conformation: The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).Genes: A category of nucleic acid sequences that function as units of heredity and which code for the basic instructions for the development, reproduction, and maintenance of organisms.Tumor Cells, Cultured: Cells grown in vitro from neoplastic tissue. If they can be established as a TUMOR CELL LINE, they can be propagated in cell culture indefinitely.Cells, Cultured: Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.Protein Structure, Tertiary: The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.Biogenic Polyamines: Biogenic amines having more than one amine group. These are long-chain aliphatic compounds that contain multiple amino and/or imino groups. Because of the linear arrangement of positive charge on these molecules, polyamines bind electrostatically to ribosomes, DNA, and RNA.Bacterial Proteins: Proteins found in any species of bacterium.Choline: A basic constituent of lecithin that is found in many plants and animal organs. It is important as a precursor of acetylcholine, as a methyl donor in various metabolic processes, and in lipid metabolism.Antitubercular Agents: Drugs used in the treatment of tuberculosis. They are divided into two main classes: "first-line" agents, those with the greatest efficacy and acceptable degrees of toxicity used successfully in the great majority of cases; and "second-line" drugs used in drug-resistant cases or those in which some other patient-related condition has compromised the effectiveness of primary therapy.Cell Nucleus: Within a eukaryotic cell, a membrane-limited body which contains chromosomes and one or more nucleoli (CELL NUCLEOLUS). The nuclear membrane consists of a double unit-type membrane which is perforated by a number of pores; the outermost membrane is continuous with the ENDOPLASMIC RETICULUM. A cell may contain more than one nucleus. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)Urinary Bladder Neoplasms: Tumors or cancer of the URINARY BLADDER.Carnitine: A constituent of STRIATED MUSCLE and LIVER. It is an amino acid derivative and an essential cofactor for fatty acid metabolism.Rabbits: The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.Enzyme Induction: An increase in the rate of synthesis of an enzyme due to the presence of an inducer which acts to derepress the gene responsible for enzyme synthesis.Nucleosomes: The repeating structural units of chromatin, each consisting of approximately 200 base pairs of DNA wound around a protein core. This core is composed of the histones H2A, H2B, H3, and H4.Cholinergic Neurons: Neurons whose primary neurotransmitter is ACETYLCHOLINE.Substantia Innominata: Tissue in the BASAL FOREBRAIN inferior to the anterior perforated substance, and anterior to the GLOBUS PALLIDUS and ansa lenticularis. It contains the BASAL NUCLEUS OF MEYNERT.Cell Cycle Proteins: Proteins that control the CELL DIVISION CYCLE. This family of proteins includes a wide variety of classes, including CYCLIN-DEPENDENT KINASES, mitogen-activated kinases, CYCLINS, and PHOSPHOPROTEIN PHOSPHATASES as well as their putative substrates such as chromatin-associated proteins, CYTOSKELETAL PROTEINS, and TRANSCRIPTION FACTORS.Gene Expression: The phenotypic manifestation of a gene or genes by the processes of GENETIC TRANSCRIPTION and GENETIC TRANSLATION.Putrescine: A toxic diamine formed by putrefaction from the decarboxylation of arginine and ornithine.Acetylcholine: A neurotransmitter found at neuromuscular junctions, autonomic ganglia, parasympathetic effector junctions, a subset of sympathetic effector junctions, and at many sites in the central nervous system.Euonymus: A plant genus of the family CELASTRACEAE.Phosphate Acetyltransferase: An enzyme that catalyzes the synthesis of acetylphosphate from acetyl-CoA and inorganic phosphate. Acetylphosphate serves as a high-energy phosphate compound. EC 2.3.1.8.Oxidation-Reduction: A chemical reaction in which an electron is transferred from one molecule to another. The electron-donating molecule is the reducing agent or reductant; the electron-accepting molecule is the oxidizing agent or oxidant. Reducing and oxidizing agents function as conjugate reductant-oxidant pairs or redox pairs (Lehninger, Principles of Biochemistry, 1982, p471).Microsomes, Liver: Closed vesicles of fragmented endoplasmic reticulum created when liver cells or tissue are disrupted by homogenization. They may be smooth or rough.Hydrogen-Ion Concentration: The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)

Melatonin biosynthesis: the structure of serotonin N-acetyltransferase at 2.5 A resolution suggests a catalytic mechanism. (1/592)

Conversion of serotonin to N-acetylserotonin, the precursor of the circadian neurohormone melatonin, is catalyzed by serotonin N-acetyltransferase (AANAT) in a reaction requiring acetyl coenzyme A (AcCoA). AANAT is a globular protein consisting of an eight-stranded beta sheet flanked by five alpha helices; a conserved motif in the center of the beta sheet forms the cofactor binding site. Three polypeptide loops converge above the AcCoA binding site, creating a hydrophobic funnel leading toward the cofactor and serotonin binding sites in the protein interior. Two conserved histidines not found in other NATs are located at the bottom of the funnel in the active site, suggesting a catalytic mechanism for acetylation involving imidazole groups acting as general acid/base catalysts.  (+info)

Pharmacological characterization of beta2-adrenoceptor in PGT-beta mouse pineal gland tumour cells. (2/592)

1. The adrenoceptor in a mouse pineal gland tumour cell line (PGT-beta) was identified and characterized using pharmacological and physiological approaches. 2. Adrenaline and noradrenaline, adrenoceptor agonists, stimulated cyclic AMP generation in a concentration-dependent manner, but had no effect on inositol 1,4,5-trisphosphate production. Adrenaline was a more potent activator of cyclic AMP generation than noradrenaline, with half maximal-effective concentrations (EC50) seen at 175+/-22 nM and 18+/-2 microM for adrenaline and noradrenaline, respectively. 3. The addition of forskolin synergistically stimulated the adrenaline-mediated cyclic AMP generation in a concentration-dependent manner. 4. The pA2 value for the specific beta2-adrenoceptor antagonist ICI-118,551 (8.7+/-0.4) as an antagonist of the adrenaline-stimulated cyclic AMP generation were 3 units higher than the value for the betaI-adrenoceptor antagonist atenolol (5.6+/-0.3). 5. Treatment of the cells with adrenaline and forskolin evoked a 3 fold increase in the activity of serotonin N-acetyltransferase with the peak occurring 6 h after stimulation. 6. These results suggest the presence of beta2-adrenoceptors in mouse pineal cells and a functional relationship between the adenylyl cyclase system and the regulation of N-acetyltransferase expression.  (+info)

Two arylalkylamine N-acetyltransferase genes mediate melatonin synthesis in fish. (3/592)

Serotonin N-acetyltransferase (arylalkylamine N-acetyltransferase, AANAT, EC 2.3.1.87) is the first enzyme in the conversion of serotonin to melatonin. Large changes in AANAT activity play an important role in the daily rhythms in melatonin production. Although a single AANAT gene has been found in mammals and the chicken, we have now identified two AANAT genes in fish. These genes are designated AANAT-1 and AANAT-2; all known AANATs belong to the AANAT-1 subfamily. Pike AANAT-1 is nearly exclusively expressed in the retina and AANAT-2 in the pineal gland. The abundance of each mRNA changes on a circadian basis, with retinal AANAT-1 mRNA peaking in late afternoon and pineal AANAT-2 mRNA peaking 6 h later. The pike AANAT-1 and AANAT-2 enzymes (66% identical amino acids) exhibit marked differences in their affinity for serotonin, relative affinity for indoleethylamines versus phenylethylamines and temperature-activity relationships. Two AANAT genes also exist in another fish, the trout. The evolution of two AANATs may represent a strategy to optimally meet tissue-related requirements for synthesis of melatonin: pineal melatonin serves an endocrine role and retinal melatonin plays a paracrine role.  (+info)

N-acetyltransferase 1 genetic polymorphism, cigarette smoking, well-done meat intake, and breast cancer risk. (4/592)

N-Acetyltransferase 1 (NAT1), encoded by the polymorphic NAT1 gene, has been shown to be one of the major enzymes in human breast tissue that activates aromatic and heterocyclic amines. Humans are mainly exposed to these carcinogens through cigarette smoking and consumption of well-done meat. To test the hypothesis that variations in the NAT1 gene are related to breast cancer risk, particularly among women who smoke or consume high levels of well-done meat, a nested case-control study was conducted in a prospective cohort study of 41,837 postmenopausal Iowa women. Information on cigarette smoking and other breast cancer risk factors was obtained at the baseline survey conducted in 1986. DNA samples and information on the consumption of well-done meat were obtained, in the case-control study, from breast cancer cases diagnosed from 1992 to 1994 and a random sample of cancer-free cohort members. Genomic DNA samples obtained from 154 cases and 330 controls were assayed for 11 NAT1 alleles (NAT1*3, *4, *5, *10, *11, *14, *15, *16, *17, *19, and *22). The NAT1*4 allele was the predominant allele observed in this study population, accounting for 73.2% (72.4% in cases versus 73.8% in controls) of the total alleles analyzed. Compared to controls, breast cancer cases had a slightly higher frequency of the NAT1*10 allele (18.8% in cases versus 17.3% in controls) and a substantially higher frequency of the NAT1*11 allele (3.6% versus 1.2%). In multivariate analyses, we found a 30% [95% confidence interval (CI) = 0.8-1.9] elevated risk of breast cancer associated with the NAT1*10 allele and a nearly 4-fold (95% CI = 1.5-10.5) elevated risk associated with the NAT1*11 allele. The positive association of breast cancer with the NAT1*11 allele was more evident among smokers [odds ratio (OR) = 13.2, 95% CI = 1.5-116.0] and those who consumed a high level of red meat (OR = 6.1, 95% CI = 1.1-33.2) or consistently consumed their red meat well done (OR = 5.6, 95% CI = 0.5-62.7). The association of the NAT1*10 allele with breast cancer was mainly confined to former smokers (OR = 3.3, 95% CI = 1.2-9.5). These findings are consistent with a role for the NAT1 gene in the etiology of human breast cancer.  (+info)

Selection of RNA replicons capable of persistent noncytopathic replication in mammalian cells. (5/592)

The natural life cycle of alphaviruses, a group of plus-strand RNA viruses, involves transmission to vertebrate hosts via mosquitoes. Chronic infections are established in mosquitoes (and usually in mosquito cell cultures), but infection of susceptible vertebrate cells typically results in rapid shutoff of host mRNA translation and cell death. Using engineered Sindbis virus RNA replicons expressing puromycin acetyltransferase as a dominant selectable marker, we identified mutations allowing persistent, noncytopathic replication in BHK-21 cells. Two of these adaptive mutations involved single-amino-acid substitutions in the C-terminal portion of nsP2, the viral helicase-protease. At one of these loci, nsP2 position 726, numerous substitution mutations were created and characterized in the context of RNA replicons and infectious virus. Our results suggest a direct correlation between the level of viral RNA replication and cytopathogenicity. This work also provides a series of alphavirus replicons for noncytopathic gene expression studies (E. V. Agapov, I. Frolov, B. D. Lindenbach, B. M. Pragai, S. Schlesinger, and C. M. Rice, Proc. Natl. Acad. Sci. USA 95:12989-12994, 1998) and a general strategy for selecting RNA viral mutants adapted to different cellular environments.  (+info)

Chromosomal aberrations in humans induced by urban air pollution: influence of DNA repair and polymorphisms of glutathione S-transferase M1 and N-acetyltransferase 2. (6/592)

We have studied the influence of individual susceptibility factors on the genotoxic effects of urban air pollution in 106 nonsmoking bus drivers and 101 postal workers in the Copenhagen metropolitan area. We used the frequency of chromosomal aberrations in peripheral blood lymphocytes as a biomarker of genotoxic damage and dimethylsulfate-induced unscheduled DNA synthesis in mononuclear WBCs, the glutathione S-transferase M1 (GSTM1) genotype, and the N-acetyltransferase 2 (NAT2) genotype as biomarkers of susceptibility. The bus drivers, who had previously been observed to have elevated levels of aromatic DNA adducts in their peripheral mononuclear cells, showed a significantly higher frequency of cells with chromosomal aberrations as compared with the postal workers. In the bus drivers, unscheduled DNA synthesis correlated negatively with the number of cells with gaps, indicating a protective effect of DNA repair toward chromosome damage. Bus drivers with the GSTM1 null and slow acetylator NAT2 genotype had an increased frequency of cells with chromosomal aberrations. NAT2 slow acetylators also showed elevated chromosomal aberration counts among the postal workers. Our results suggest that long-term exposure to urban air pollution (with traffic as the main contributor) induces chromosome damage in human somatic cells. Low DNA repair capacity and GSTM1 and NAT2 variants associated with reduced detoxification ability increase susceptibility to such damage. The effect of the GSTM1 genotype, which was observed only in the bus drivers, appears to be associated with air pollution, whereas the NAT2 genotype effect, which affected all subjects, may influence the individual response to some other common exposure or the baseline level of chromosomal aberrations.  (+info)

Transcription factors in neuroendocrine regulation: rhythmic changes in pCREB and ICER levels frame melatonin synthesis. (7/592)

Neurotransmitter-driven activation of transcription factors is important for control of neuronal and neuroendocrine functions. We show with an in vivo approach that the norepinephrine cAMP-dependent rhythmic hormone production in rat pineal gland is accompanied by a temporally regulated switch in the ratio of a transcriptional activator, phosphorylated cAMP-responsive element-binding protein (pCREB), and a transcriptional inhibitor, inducible cAMP early repressor (ICER). pCREB accumulates endogenously at the beginning of the dark period and declines during the second half of the night. Concomitant with this decline, the amount of ICER rises. The changing ratio between pCREB and ICER shapes the in vivo dynamics in mRNA and, thus, protein levels of arylalkylamine-N-acetyltransferase, the rate-limiting enzyme of melatonin synthesis. Consequently, a silenced ICER expression in pinealocytes leads to a disinhibited arylalkylamine-N-acetyltransferase transcription and a primarily enhanced melatonin synthesis.  (+info)

Polymorphisms of xenobiotic-metabolizing enzymes and susceptibility to cancer. (8/592)

The variation in individual responses to exogenous agents is exceptionally wide. It is because of this large diversity of responsiveness that risk factors to environmentally induced diseases have been difficult to pinpoint, particularly at low exposure levels. Opportunities now exist for studies of host factors in cancer or other diseases in which an environmental component can be presumed. Many of the studies have shown an elevated disease proneness for individuals carrying the potential at-risk alleles of metabolic genes, but a number of controversial results have also been reported. This article is an overview of the data published to date on metabolic genotypes related to individual susceptibility to cancer.  (+info)

There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a homologue of a drug-metabolising enzyme, appears to be a marker in human oestrogen receptor positive breast cancer. Mouse Nat2 is the mouse equivalent of human NAT1. The development of mouse models of breast cancer is important, and it is essential to explore the biological role of mouse Nat2. We have therefore produced mouse Nat2 as a recombinant protein and have investigated its substrate specificity profile in comparison with human NAT1. In addition, we have tested the effects of inhibitors on mouse Nat2, including compounds which are endogenous and exogenous steroids. We show that tamoxifen, genistein and diethylstilbestrol inhibit mouse Nat2. The steroid analogue, bisphenol A, also inhibits mouse Nat2 enzymic activity and is shown by NMR spectroscopy, through shifts in proton peaks, to bind close to the active site. A three-dimensional structure for human NAT1 has recently
Arylamine N-acetyltransferases (EC 2.3.1.5) (NATs) catalyse the biotransformation of many primary arylamines, hydrazines and their N-hydroxylated metabolites, thereby playing an important role in both the detoxification and metabolic activation of numerous xenobiotics. The recently published crystal structure of the Salmonella typhimurium NAT (StNAT) revealed the existence of a cysteine protease-like (Cys-His-Asp) catalytic triad. In the present study, a three-dimensional homology model of human NAT1, based upon the crystal structure of StNAT [Sinclair, Sandy, Delgoda, Sim and Noble (2000) Nat. Struct. Biol. 7, 560-564], is demonstrated. Alignment of StNAT and NAT1, together with secondary structure predictions, have defined a consensus region (residues 29-131) in which 37% of the residues are conserved. Homology modelling provided a good quality model of the corresponding region in human NAT1. The location of the catalytic triad was found to be identical in StNAT and NAT1. Comparison of ...
N-acetyltransferase 1 (arylamine N-acetyltransferase) is a protein that in humans is encoded by the NAT1 gene. This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat NAT2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]. GRCh38: Ensembl release 89: ENSG00000171428 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000051147 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". "Entrez Gene: N-acetyltransferase 1 (arylamine N-acetyltransferase)". Retrieved 2012-01-27. Gubin AN, Njoroge JM, Bouffard GG, Miller JL (July 1999). "Gene expression in proliferating human erythroid cells". Genomics. 59 ...
Human N-acetyltransferase 2 (NAT2) is polymorphic in humans and may associate with cancer risk by modifying individual susceptibility to cancers from carcinogen exposure. Since molecular epidemiological studies investigating these associations usually include determining NAT2 single-nucleotide polymorphisms (SNPs), haplotypes or genotypes, their conclusions can be compromised by the uncertainty of genotype-phenotype relationships. We characterized NAT2 SNPs and haplotypes by cloning and expressing recombinant NAT2 allozymes in mammalian cells. The reference and variant recombinant NAT2 allozymes were characterized for arylamine N-acetylation and O-acetylation of N-hydroxy-arylamines. SNPs and haplotypes that conferred reduced enzymatic activity did so by reducing NAT2 protein without changing NAT2 mRNA levels. Among SNPs that reduced catalytic activity, G191A (R64Q), G590A (R197Q) and G857A (G286E) reduced protein half-life but T341C (I114T), G499A (E167K) and A411T (L137F) did not. G857A ...
Compare N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
TY - JOUR. T1 - NAT2 fast acetylator genotype is associated with an increased risk of colorectal cancer in Taiwan. AU - Huang, Chi Chou. AU - Chien, Wen Pin. AU - Wong, Ruey Hong. AU - Cheng, Ya Wen. AU - Chen, Meng Cheng. AU - Chou, Ming Chih. AU - Lee, Huei. PY - 2007/7. Y1 - 2007/7. N2 - In Taiwan, colorectal cancer has one of the highest rates of increased incidence in the past two decades. Heterocyclic amines from dietary cooked meats are metabolically activated by NAT2 (N-acetyltransferase 2), which are associated with colorectal cancer incidence. Thus, the NAT2 fast acetylator genotype may be associated with colorectal cancer risk. However, the association between the NAT2 genotype and colorectal cancer risk is not clearly understood. We conducted a study with 244 primary colorectal cancer cases and 299 cancer-free healthy control subjects to verify the association of NAT2 polymorphisms with the risk of Taiwanese colorectal cancer. Our data showed that subjects with the NAT2 W/W ...
Buy NAT8B elisa kit, Human N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) ELISA Kit-NP_057431.2 (MBS9318897) product datasheet at MyBioSource, ELISA Kits
This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq, Jul 2008 ...
Sigma-Aldrich offers abstracts and full-text articles by [Natasa Djordjevic, Juan Antonio Carrillo, Nobuhisa Ueda, Guillermo Gervasini, Takashi Fukasawa, Akira Suda, Slobodan Jankovic, Eleni Aklillu].
Acetyl coenzyme A-dependent N-acetyltransferase and O-acetyltransferase activities were examined in liver cytosols derived from homozygous rapid acetylator C57BL/6J and A.B6 congenic inbred mouse strains, from homozygous slow acetylator A/J and B6.A congenic inbred mouse strains, and from the (C57BL/6J x A/J)F1 heterozygous acetylator hybrid mouse strain. Acetylator genotype-dependent N-acetyltransferase activity was exhibited for the N-acetylation of p-aminobenzoic acid, 2-aminofluorene, and 4-aminobiphenyl. In contrast, levels of isoniazid N-acetyltransferase and N-hydroxy-3,2-dimethyl-4-aminobiphenyl O-acetyltransferase activities in mouse liver cytosol appeared to be independent of the arylamine Nat acetylator gene. Although cytosolic N-acetyltransferase activities differed about 2-fold between the parental C57BL/6J and A/J strains for p-aminobenzoic acid, 2-aminofluorene, and 4-aminobiphenyl, the same N-acetyltransferase activities differed about 6-7-fold between the homozygous rapid ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
The human arylamine N-acetyltransferases first attracted attention because of their role in drug metabolism. However, much of the current literature has focused on their role in the activation and detoxification of environmental carcinogens and how genetic polymorphisms in the genes create predispositions to increased or decreased cancer risk. There are two closely related genes on chromosome 8 that encode the two human arylamine N-acetyltransferases-NAT1 and NAT2. Although NAT2 has restricted tissue expression, NAT1 is found in almost all tissues of the body. There are several single-nucleotide polymorphisms in the protein coding and 3-untranslated regions of the gene that affect enzyme activity. However, NAT1 is also regulated by post-translational and environmental factors, which may be of greater importance than genotype in determining tissue NAT1 activities. Recent studies have suggested a novel role for this enzyme in cancer cell growth. NAT1 is up-regulated in several cancer types, and ...
Christie, Angela, Burgess, Anne P. and Sim, Edith (1987) N-Acetyltransferase activity in cultured-cells. Biochemical Society Transactions, 15(3), p. 449. ISSN (print) 0300-5127 ...
Antila E, Westermark T, On the etiopathogenesis and therapy of Down syndrome. Int. J. Dev. Biol. 33: 183-188, 1989 Medline. Baez S, Segura-Aguilar J, Widersten M, et al. Glutathione transferases catalyze the detoxification of oxidized metabolites (o-quinones) of catecholamines and may serve as an antioxidant system preventing degenerative cellular processes. Biochem. J. 324 (pt.1): 25-28, 1997 Medline. Bandmann O, Vaughen J, Holmans P, et al. Association of slow acetylator genotype for N-acetyltransferase 2 with familiar Parkinsons disease. Lancet 350: 1136-1139, 1997 Medline. Berry T. A selenium transport protein model of a sub-type of schizophrenia. Med. Hypothesis 43: 409-414, 1994 Medline. Brown K, Reid A, White T, et al. Vitamin E, lipids and lipid peroxidation products in tardive dyskinesia. Biol. Psychiatry 43: 863-867, 1998 Medline. Brugge KL, Nichols S, Delis D, et al. The role of alterations in free radical metabolism in mediating cognitive impairments in Down syndrome. EXS 62: ...
In recent times, an increasing number of different haplotypes of the arylamine N-acetyltransferase 2 gene are reported. Since most of the various alleles are defined by linkages of commonly known hereditary point mutations, some confusion may occur when the mutation pattern revealed by genotyping sh
The molecular genetic basis of N-acetylation polymorphism has been investigated in inbred mouse models of the human acetylation polymorphism. Two genomic clones, Nat1 and Nat2, were isolated from a C57BL/6J (B6) mouse (rapid acetylator) genomic library. The Nat1 and Nat2 genes both have intronless coding regions of 870 nucleotides and display greater than 47% deduced amino acid similarity with human, rabbit, and chicken N-acetyltransferases. Amplification of Nat1 and Nat2 from A/J (A) mouse (slow acetylator) genomic DNA by the polymerase chain reaction and subsequent sequencing revealed that Nat1 was identical in B6 and A mice, whereas Nat2 contained a single nucleotide change from adenine in B6 to thymine in A mice. This nucleotide substitution changes the deduced amino acid at position 99 from asparagine in B6 to isoleucine in A mice. Hydropathy analysis revealed that this amino acid change alters the hydropathy of the flanking peptide segment in NAT2 from hydrophilic in the B6 mouse to ...
‎The arylamine N-acetyltransferase 2 (NAT2 [5]; E.C. 2.3.1.5) is a polymorphic enzyme involved in the metabolism of drugs and aromatic amines. About 50% of white individuals are classified as slow acetylators, and these individuals show impaired metabolism of many therapeutically useful arylamine and…
Shop Histidine N-acetyltransferase ELISA Kit, Recombinant Protein and Histidine N-acetyltransferase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
N-Acetyltransferase antibody LS-C200960 is an unconjugated mouse monoclonal antibody to human N-Acetyltransferase. Validated for ELISA and LateralFlow.
In article ,31C894FB.1855 at odyssee.net,, dellaire at ODYSSEE.NET says... , ,I was wondering if the cDNA is out for the acetyl transferase gene for ,mammals.. mouse or human. I know the yeast homolog is cloned but the ,cDNA is not available yet I dont think (at least not through NCBI or ,Entrez). ,Has anyone worked with the yeast acetyl transferase? Youll have to be a bit more specific than acetyltransferase as there are quite a few of them. My own interest is/was arylamine N-acetyltransferases involved in xenobiotic metabolism and the sequences of the two human forms (and variants) and rabbit forms have been available for some time. What do you want acetylated? Bernard Bernard Murray, Ph.D. bernard at elsie.nci.nih.gov (National Cancer Institute, NIH, Bethesda MD, USA) If I knew what was going on Id really be indignant. -Crow T. Robot, MST3k (City Limits ...
We welcome your input and comments. Please use this form to recommend updates to the information in ZFIN. We appreciate as much detail as possible and references as appropriate. We will review your comments promptly ...
NAA60 - NAA60 (Myc-DDK-tagged)-Human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2 available for purchase from OriGene - Your Gene Company.
Purified Recombinant Rat Nat2 Protein, His/GST-tagged from Creative Biomart. Recombinant Rat Nat2 Protein, His/GST-tagged can be used for research.
Buy our Recombinant Human NAT8 protein. Ab160299 is a full length protein produced in Wheat germ and has been validated in WB, ELISA. Abcam provides free…
N-Acetyltransferase phenotype and risk in urinary bladder cancer: approaches in molecular epidemiology. Preliminary results in Sweden and Denmark: A variable bu
Compare N-acetyltransferase 8 (putative) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
There is growing evidence of dysregulated very long non-coding RNAs (lncRNAs) offering mainly because potential biomarkers for malignancy prognosis. eight-lncRNA signature may have important implications for end result prediction and therapy decisions. [23], [24], [26], [27] and [28], possess indicated oncogenic and/or tumor suppressive functions like protein-coding genes in various cancers. As lncRNAs do not code for proteins, lncRNA appearance may be an improved signal from the tumor position, implying the and superiority as independent biomarkers for early prognosis and diagnosis prediction in cancers [29]. Currently, many expression-based lncRNA personal have been discovered to predict sufferers survival in a few malignancies, including glioblastoma multiforme [30], oesophageal squamous cell carcinoma [31], colorectal cancers [32], breast cancer tumor [33C35], lung cancers [36] and multiple myeloma [37]. Latest research have got uncovered that adjustments in lncRNA appearance had been ...
Accumulating evidence demonstrates that lengthy non-coding RNAs (LncRNAs) perform essential roles in regulating gene expression and so are involved in different cancers including colorectal cancer (CRC). evaluated by silencing the LncRNA and and ideals≥0.05 were removed and thus excluded from further analysis. The heat map of the 50 LncRNAs most obvious differences was created using a method of hierarchical clustering by GeneSpring GX version 7.3 (Agilent Technologies). Chosen LncRNAs were finally confirmed for altered transcription level using quantitative real-time PCR (qRT-PCR) between tumour and adjacent normal tissues. Primers used in qRT-PCR were as follows: LncRNA "type":"entrez-nucleotide" attrs :"text":"DQ786243″ term_id :"110631570″ term_text :"DQ786243″DQ786243: 5′-agaggtgggagatgaggg-3′ (forward probe) 5 (reverse probe). Other LncRNAs primer sequences are available upon request. RNA preparation invert transcription and quantitative real-time PCR Total RNAs had been ...
Limited epidemiological evidence suggests that genetic polymorphisms of drug-metabolizing enzymes such as cytochrome P450 (CYP), glutathione S-transferase (GST) and N-acetyltransferase (NAT) may be involved in tobacco-related hepatocarcinogenesis. We conducted a case-control study, including 209 incident cases with hepatocellular carcinoma (HCC) and two different control groups [275 hospital controls and 381 patients with chronic liver disease (CLD) without HCC], to investigate whether CYP1A1, CYP1A2, CYP2A6, CYP2E1, GSTM1 and NAT2 polymorphisms are related to the risk of HCC with any interaction with cigarette smoking. Overall, no significant associations with HCC were observed for any genotypes against either control group. However, we found a significant interaction (P = 0.0045) between CYP1A2 -3860G,A polymorphism and current smoking on HCC risk when we compared HCC cases with CLD patients; adjusted odds ratios [ORs; and 95% confidence intervals (CIs)] for G/A and A/A genotypes relative to ...
Accepted name: phenylalanine N-acetyltransferase. Reaction: acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine. Other name(s): acetyl-CoA-L-phenylalanine α-N-acetyltransferase. Systematic name: acetyl-CoA:L-phenylalanine N-acetyltransferase. Comments: Also acts, more slowly, on L-histidine and L-alanine.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: 9075-16-5. References: 1. Leuzinger, W., Baker, A.L. and Cauvin, E. Acetylcholinesterase. II. Crystallization, absorption spectra, isoionic point. Proc. Natl. Acad. Sci. USA 59 (1968) 620-623. [PMID: 5238989]. ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
Вивчення біохімічної активності ферменту N-ацетилтрансферази, продукції гена NAT2 у дітей з екологічно несприятливих регіонів (ЕНР) є надзвичайно в...
Human NAT2 full-length ORF ( AAH15878.1, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. (H00000010-P02) - Products - Abnova
Complete information for HGSNAT gene (Protein Coding), Heparan-Alpha-Glucosaminide N-Acetyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
Complete information for HGSNAT gene (Protein Coding), Heparan-Alpha-Glucosaminide N-Acetyltransferase, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
When it comes to what we do, how we chose to live, eat and breathe, there certainly isnt a one size fits all kind of method. In fact, you can be forgiven to being totally at a loss whilst youre trying to work out just how you should.... Read more ...
Aralkylamine N-acetyltransferase (AANAT) (EC 2.3.1.87), also known as arylalkylamine N-acetyltransferase or serotonin N-acetyltransferase (SNAT), is an enzyme that is involved in the day/night rhythmic production of melatonin, by modification of serotonin. It is in humans encoded by the ~2.5 kb AANAT gene containing four exons, located on chromosome 17q25. The gene is translated into a 23 kDa large enzyme. It is well conserved through evolution and the human form of the protein is 80% identical to sheep and rat AANAT. It is an acetyl-CoA-dependent enzyme of the GCN5-related family of N-acetyltransferases (GNATs). It may contribute to multifactorial genetic diseases such as altered behavior in sleep/wake cycle and research is on-going with the aim of developing drugs that regulate AANAT function. The systematic name of this enzyme class is acetyl-CoA:2-arylethylamine N-acetyltransferase. Other names in common use include: AANAT Arylalkylamine N-acetyltransferase Melatonin rhythm enzyme Serotonin ...
Science & Technology, Life Sciences & Biomedicine, Neurosciences, Neurosciences & Neurology, NEUROSCIENCES, chicken, pineal gland, retina, circadian rhythm, light, melatonin, serotonin N-acetyltransferase, MELATONIN SYNTHESIS, PERCEIVED LIGHT, JAPANESE-QUAIL, CLOCK, SYSTEM, SUPPRESSION, RECEPTORS, CELLS ...
RESULTS: Forty-five (32.1%) patients were diagnosed with ATDH. No significant differences were reported in age and sex between patients with and without ATDH. Slow acetylators defined by NAT2 genotypes had a higher risk of hepatotoxicity than rapid acetylators (51.2% vs. 25.2%, P = 0.0026). Odds ratio (OR) analysis showed that slow acetylator status (OR 3.15, 95%CI 1.47-6.48) was the only independent risk factor for ATDH. Pyrazinamide co-administration induced hepatitis was also associated with NAT2 acetylator status. CYP2E1 c1/c1 homozygotes are prone to developing more severe hepatotoxicity than other c1/c2 and c2/c2 genotypes ...
Over the past years natural products and/or their derivatives have continued to provide cancer chemotherapeutics. Glycosides derivatives of emodin are known to possess anticancer activities. An in silico study was carried out to evaluate emodin derivatives as inhibitors of Arylamine N-Acetyltransferase 2, Cyclooxygenase 2 and Topoisomerase 1 enzymes, predict their pharmacokinetics and explore their bonding modes. Molecular docking study suggested that D2, D5, D6 and D9 to be potent inhibitors of NAT2, while D8 was suggested to be a potent inhibitor of TOP1. Derivatives D2, D5, D6 and D9 bind to the same pocket with different binding conformation. Pharmacokinetic study suggested that selected emodin derivatives can be potential cancer chemotherapeutic agent. Physicochemical parameters such density, balaban index, surface tension, logP and molar reflectance correlated to compounds activity. These finding provides a potential strategy towards developing NAT2 and TOP1 inhibitors.
Rabbit polyclonal Serotonin N-acetyltransferase (phospho T29) antibody validated for WB and tested in Rat. Immunogen corresponding to synthetic peptide
Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Overexpression Lysate (Native). Tested Reactivity: Hu. Validated: WB. Backed by our 100% Guarantee.
Myc-DDK-tagged ORF clone of Homo sapiens glucosaminyl (N-acetyl) transferase 4, core 2 (GCNT4) as transfection-ready DNA - 10 µg - OriGene - cdna clones
Interindividual and interethnic differences in allele frequencies of N-acetyltransferase (NAT2) single nucleotide polymorphisms (SNPs) are responsible for phenotypic variability of adverse drug reactions and susceptibility to cancer. We genotyped the seven NAT2 common SNPs in 127 randomly selected unrelated northern Sudanese subjects using allele-specific and RFLP polymerase chain reaction (PCR) based methods. Molecular genotyping was enough to designate alleles for 41 individuals unambiguously, whereas 63 individuals alleles were inferred from haplotypes previously described. In the remaining 23 individuals, however, the phase of the SNPs could not be decided because of multiple SNP heterozygotes. Using computational methods in the HAP and Phase programs, we confirmed the inferred alleles of the 62 individuals and predicted the remaining 23 ambiguous alleles. Twelve NAT2 alleles were identified. Four alleles coded for rapid acetylators (18%), and eight alleles coded for slow acetylators (82%). Two
Golka and colleagues (1) critically refer to our observation that NAT2 genotype had no impact on bladder cancer risk (2). We were able to demonstrate in our case-control study nested in the European Prospective Investigation into Cancer and Nutrition (EPIC) that occupational exposure to aromatic amines and polycyclic aromatic amines was associated with an increased bladder cancer risk. On the basis of the comprehensive genotyping of N-acetyltransferase 2 (NAT2), we observed that NAT2 slow acetylation was not itself associated with bladder cancer risk. Notably, our main effect of 1.02 [95% confidence interval (CI), 0.81-1.29] is clearly in line with the OR of 1.02 (95% CI, 0.87-1.19) for a tagging single-nucleotide polymorphism that the authors reported from a pooled analysis of their own studies (3).. We fully recognize that EPIC is a population-based cohort with a low prevalence of rare occupations known to entail a bladder cancer risk. We also mentioned in the article that the metabolism of ...
Triethylenetetramine (TETA), a copper II chelator and a polyamine analog traditionally used for the treatment of Wilsons disease, is currently in Phase I clinical trials for cancer in combination with carboplatin. However, the metabolism of TETA has never been thoroughly investigated, which is crucial for its further development in cancer treatment1. The two major metabolites of TETA found in humans are N1-acetyl-TETA (MAT) and N1,N10-diacetyl-TETA (DAT)2. Traditionally, acetylation of drug is thought to be catalyzed by N-acetyltransferase (NAT2). FDA requires that pharmacological properties of any drug metabolized via acetylation route have to be investigated in population with different NAT2 phenotype. However, our recent clinical study showed that there was no significant difference in pharmacokinetic and metabolites profiles of healthy volunteers with fast or slow NAT2 acetylation phenotype3. We therefore hypothesize that the enzyme responsible to TETA acetylation is spermidine/spermine ...
CP002160.PE153 Location/Qualifiers FT CDS 242742..243257 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="Clocel_0156" FT /product="GCN5-related N-acetyltransferase" FT /note="PFAM: GCN5-related N-acetyltransferase; KEGG: FT hor:Hore_00330 GCN5-related N-acetyltransferase" FT /db_xref="EnsemblGenomes-Gn:Clocel_0156" FT /db_xref="EnsemblGenomes-Tr:ADL49944" FT /db_xref="GOA:D9SNS3" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:D9SNS3" FT /inference="protein motif:PFAM:PF00583" FT /protein_id="ADL49944.1" FT /translation="MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI FT MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG FT KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD FT LQMVCDVD" MIKFQLLTKE NMAENALDNY DRLQNVRRVY RKIDSEYMLV EDVGIMDWSF ERKQAVAKAL 60 ISDDYITFGA IREDEIVGFA SIEKQLQGKY IVLDMMQVSR KYRGKGMGRT LFQLVKEKAK 120 EMGAKQLYIS ACASEETIEF YKSMGCKITD NPIKKIAEDE PFDLQMVCDV D 171 ...
B159 Background: Heterocyclic amines (HCA) are pro-carcinogens produced when meat is cooked in direct heat, such as flame-broiled (FB) food. The N-acetyltransferases (NAT) are enzymes involved in the activation of HCAs. Laboratory data suggest that aspirin may inhibit NAT activity. Methods: In a population based nested case-control study, we assessed the association between flame-broiled food, meat consumption and the risk of breast cancer and whether it varies by NAT2 genotype status or aspirin intake in 312 cases and 316 controls. Genotyping for rapid, intermediate and slow metabolizers of NAT2 was carried out on three NAT2 alleles. Odds ratios (OR) and 95% confidence intervals (CI) were estimated from logistic regression models. The median intake level among controls was used as the cut point for meat consumption. Results: Breast cancer risk was significantly elevated among women who ate FB food greater than twice a month compared to women who never ate FB (O.R. 1.74, 95% CI 1.04, 2.89). Meat ...
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Isoniazid is a drug used for the treatment of both immediate and chronic tuberculosis. It is broken down by the liver through pathways including the NAT2 enzyme. NAT2 slow acetylators accumulate higher levels of isoniazid and are thereby at increased risk for liver damage. Promethease evaluates an individuals NAT2 phenotype based on genosets gs138, gs139 and gs140. ...
Im searching for places that carry one or two special enzymes of the melatonin biosynthetic pathway, (NAT) N-acetyltransferase or (HIOMT) hydroxylindole-O-methyltransferase. Please anyone with any information on where I can buy, borrow from someone in-house stock please contact me. Dr. Klosen any ideas on where I can get the above enzyme(s). Any help or info is greatly appreciated. regards Maria Mejia Smith-Kettlewell Eye Res. Inst. S.F.CA ...
Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 19.3) ...
Synonyms for NAT traversal in Free Thesaurus. Antonyms for NAT traversal. 39 synonyms for stun: overcome, shock, amaze, confuse, astonish, stagger, bewilder, astound, overpower, confound, stupefy, strike (someone) dumb.... What are synonyms for NAT traversal?
Visit Healthgrades for information on Dr. Michael Hnat, DMD Find Phone & Address information, medical practice history, affiliated hospitals and more.
本文解释如何使用cable-modem dhcp-proxy nat命令。此命令主要功能将配置一个网络地址转换(NAT)地址池用Intrernet供应商的DHCP服务器供应的IP地址。
Originálny Mercedes svetlomet pravý alebo ľavý (požadovanú stranu prosíme uviesť do poznámky) - BI-XENON D1S + H7 + LED - Originálna značka BOSCH - vstavaný motorček pre nastavovanie výšky - s funkciou natáčania do zákruty - cena za kus vhodné pre: Mercedes C (W204) 1/2011-
|p|Nat Mur 30C homeopathic potency on 100mg Lactose/Sucrose tablets |/p| |p|30C is ideal for active or acute over the counter (OTC) use. 30C remedies should be taken as a short course only, unless prescribed by a practitioner.|/p| |p|ADULTS 2 tablets |/p|
Plasmid pGal4AD-CIBN from Dr. Chandra Tuckers lab contains the insert CIB1 (1-171aa) and is published in Nat Methods. 2010 Oct 31. ():. This plasmid is available through Addgene.
Die BioTaurus Pflanzen Linie ist ein biologischer Bodenverbesserer und enthält natürliche, im Boden vorkommende Mikroorganismen für gesunde und üppige Pflanzen.
Plasmid pCMVTAG-NEMOL329P from Dr. Jon Ashwells lab contains the insert NEMOL329P and is published in Nat Cell Biol. 2006 Apr . 8(4):398-406. This plasmid is available through Addgene.
Serotonin N-acetyltransferase complex. Molecular model of a complex formed between the serotonin N-acetyltransferase enzyme (AANAT, light blue, light red) and the zeta isoform structure of a 14-3-3 protein (yellow, green). AANAT is the penultimate enzyme involved in the conversion of serotonin to melatonin in the cells of the pineal gland in the brain. Melatonin modulates the function of the circadian clock, influencing activity and sleep. AANAT is rapidly inactivated when animals are exposed to light at night and therefore controls the rhythm of melatonin production. - Stock Image C035/8649
Aminoglutethimide (AG) 500 mg was administered orally to four normal volunteers and eight patients undergoing treatment for metastatic breast cancer. In each subject the acetylator phenotype was established from the monoacetyldapsone (MADDS)/dapsone (DDS) ratio. Acetylaminoglutethimide (acetylAG) rapidly appeared in the plasma and its disposition paralleled that of AG. A close relationship (P less than 0.01) was observed between the acetyl AG/AG and MADDS/DDS ratio suggesting that AG may undergo polymorphic acetylation like DDS. AG half-life was 19.5 +/- 7.7 h in seven fast acetylators of DDS and 12.6 +/- 2.3 h in five slow acetylators and its apparent metabolic clearance was significantly (P less than 0.01) related to the acetylAG/AG ratio. Over 48 h the fast acetylators excreted 7.7 +/- 4.4% of the administered AG dose in the urine as unchanged AG as compared to 12.4 +/- 2.8% in slow acetylators. A much smaller fraction of the dose was excreted as acetylAG: 3.6 +/- 1.5% by fast and 1.9 +/- ...
3) Isoniazid Easy question would be..Which drugs dont cause SLE. Yes. Because they are related to acetylators. The slow and fast acetylators. Can you explain I mean how does it effect? The slow and fast acetylators?. Im not sure.. But the slow acetylators are more prone to DILE. Ill cross check and let you know. Slow acetylators metabolize the drug slowly.. Hence a higher chance of toxicity. Presumably, this is because acetylation of the aromatic amine or hydrazine functional group leads to a non-toxic product. Several other drugs which have been implicated in drug-induced lupus also contain an aromatic amine or hydrazine group. The clinical and laboratory characteristics of drug-induced and idiopathic lupus are similar but the degree to which the pathophysiological mechanisms are related, if at all, is unknown ...
BACKGROUND: The risk of having a child with a neural tube defect (NTD) can be reduced by maternal, periconceptional supplementation with folic acid, but the underlying folate-dependent protective mechanism remains unclear. N-acetyltransferase 1 is involved in acetylation of aromatic and heterocyclic amines and the catabolism of folates. Hence, functional polymorphisms in NAT1, the gene encoding N-acetyltransferase 1, are plausible risk factors for NTDs. Such variants could exert an influence on the risk of NTDs via their role in acetylation or folate catabolism and could act through the maternal or the embryonic genotype ...
This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl groups. This enzyme participates in lysine
Rabbit polyclonal antibody raised against a full-length human NAT1 protein. NAT1 (NP_000653.3, 1 a.a. ~ 290 a.a) full-length human protein. (H00000009-D01P) - Products - Abnova
A large number of diverse enzymes have evolved in animals that apparently function only to metabolize foreign chemicals. As will be discussed later, there are such large differences among species in the ability to metabolize xenobiotics, that animal models cannot be solely relied upon to predict how humans will metabolize a drug. Enzymes that metabolize xenobiotics have historically been called drug-metabolizing enzymes, although they are involved in the metabolism of many foreign chemicals to which humans are exposed. Thus, a more appropriate name would be xenobiotic-metabolizing enzymes.Dietary differences among species during the course of evolution could account for the marked species variation in the complexity of the drug-metabolizing enzymes. Additional diversity within these enzyme systems has also derived from the necessity to detoxify a host of endogenous chemicals that would otherwise prove harmful to the organism, such as bilirubin, steroid hormones, and catecholamines. Many of these ...
type: replace path: /instance_groups/name=bosh/properties/nats/tls/ca? value: ((nats_server_tls_2.ca)) - type: replace path: /instance_groups/name=bosh/properties/nats/tls/server? value: certificate: ((nats_server_tls_2.certificate)) private_key: ((nats_server_tls_2.private_key)) - type: replace path: /instance_groups/name=bosh/properties/nats/tls/client_ca? value: certificate: ((nats_ca_2.certificate)) private_key: ((nats_ca_2.private_key)) - type: replace path: /instance_groups/name=bosh/properties/nats/tls/director? value: certificate: ((nats_clients_director_tls_2.certificate)) private_key: ((nats_clients_director_tls_2.private_key)) - type: replace path: /instance_groups/name=bosh/properties/nats/tls/health_monitor? value: certificate: ((nats_clients_health_monitor_tls_2.certificate)) private_key: ((nats_clients_health_monitor_tls_2.private_key)) - type: replace path: /variables/- value: name: nats_ca_2 type: certificate options: is_ca: true common_name: default.nats-ca.bosh-internal - ...
Background Glioblastoma (GBM) is the most common primary brain malignancy and confers a dismal prognosis. GBMs harbor glioblastoma-initiating cells (GICs) that drive tumorigenesis and contribute to therapeutic resistance and tumor recurrence. Consequently, there is a strong rationale to target this cell population in order to develop new molecular therapies against GBM. Accumulating evidence indicates that Nα-terminal acetyltransferases (NATs), that are dysregulated in numerous human cancers, can serve as therapeutic targets. Methods Microarrays were used to study the expression of several NATs including NAT12/NAA30 in clinical samples and stem cell cultures. The expression of NAT12/NAA30 was analyzed using qPCR, immunolabeling and western blot. We conducted shRNA-mediated knockdown of NAT12/NAA30 gene in GICs and studied the effects on cell viability, sphere-formation and hypoxia sensitivity. Intracranial transplantation to SCID mice enabled us to investigate the effects of NAT12/NAA30 ...
A selection of Jane Austens erotic stories from a recently discovered cache of her suppressed writings. Jane Austen, always the astute observer of human nat...
1R57: Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins.
Not to be too critical of a 98-win team but, among the stuff the Nats say/do thats hard to understand is Daveys comment about Ty Moore coming back soon. I dont understand where hed play. Davey didnt say/wasnt asked by our team of journalists where hed play. Thats the problem. He needs to play every day. The Nats say hes an every day player and needs to play every day -- and hes not getting any younger at 26. The Nats dont have a position for him. Where will he play if he comes back soon or even sometime in 2013? Back on the bench? That does him no good and probably does harm, but maybe he can tolerate it for another month in 2013. But whats the plan for him? Full time 1B in 2015? The Nats have first baseman coming out their ears: LAR, Moore, Marrero, Matt Skole and probably Zimmerman should play there; and theyve draft more last week. Maybe its just Davey being Davey -- say positive things to the guys even if it doesnt make sense. And Rizzo isnt explaining his thinking. ...
1KYA: Crystal structure of a four-copper laccase complexed with an arylamine: insights into substrate recognition and correlation with kinetics.
Highlights Comprehensive 1,122-page market segmentation analysis of the UK NAT market. Major issues pertaining to the UK NAT laboratory practice, as well as key ...
Explore the structures and analogues of NAT · N-Pentyltryptamine in book II of TiHKAL: The Continuation. Alexander & Ann Shulgin
Natúr kozmetikumok oldalunkon az egészséges táplálkozáshoz, az egészséges életmódhoz, és az egészséges szépséghez mutatnak utat termékeink.
Chesapeake will cut nat gas production, sending prices higher. Michael Murphy, Rosecliff Capital, discusses why hes long Cabot Oil and not as bullish on Chesapeake. Dennis Gartman, founder of the Gartman Letter, also weighs in.
ABOUT US: Our Company is New Age Technology and Services, Inc (NATS)- NATS TRADING & FINANCING LLC is a subsidiary of New Age Technology and Services, Inc. NATS has ...
Evidence of a locus on BTA5 involved in the expression of the rat-tail phenotype in the SEGFAM-population. In: 15th Day of the Doctoral Student : abstracts, 13 May 2014 Dummerstorf (Schriftenreihe / Leibniz-Institut für Nutztierbiologie , 23) : 29-32 ...
Evidence of a locus on BTA5 involved in the expression of the rat-tail phenotype in the SEGFAM-population. In: 15th Day of the Doctoral Student : abstracts, 13 May 2014 Dummerstorf (Schriftenreihe / Leibniz-Institut für Nutztierbiologie , 23) : 29-32 ...
Eigenbrod S, Frick P, Bertsch U, Mitteregger-Kretzschmar G, Mielke J, Maringer M, Piening N, Hepp A, Daude N, Windl O, Levin J, Giese A, Sakthivelu V, Tatzelt J, Kretzschmar H, & Westaway D (2017 ...
I{I tLiit, lxlr rI da,r rnenverrlrrrr r,l..,1.]lr, |rr|rr kegratan vang rengkap hrlisan rni bukanlah lap0ran toa...
Some products are available for next-day pick-up, others may require a longer-lead time. If you need a product urgently or within a few days, please call 415-225-0589 ...
Štai kokosų aliejus turi daug riebalų rūgščių, kurios vadinamos vidutinės grandinės trigliceridais. Vaistininkė pabrėžia, kad sumažėjęs apetitas - visiškai normali ir natūrali reakcija į patiriamą stresą, tad natūralu, kad svoris staiga ima kristi.
Elektronische Patientenakte Natürliche Sprache Strukturierte Daten If we look at how content is presented in the HER, so we have these two
Amicetin, an antibacterial and antiviral agent, belongs to a group of disaccharide nucleoside antibiotics featuring an alpha-(1 -> 4)-glycoside bond in the disaccharide moiety. In this study, the amicetin biosynthesis gene cluster was cloned from Streptomyces vinaceusdrappus NRRL 2363 and localized on a 37-kb contiguous DNA region. Heterologous expression of the amicetin biosynthesis gene cluster in Streptomyces lividans TK64 resulted in the production of amicetin and its analogues, thereby confirming the identity of the ami gene cluster. In silico sequence analysis revealed that 21 genes were putatively involved in amicetin biosynthesis, including 3 for regulation and transportation, 10 for disaccharide biosynthesis, and 8 for the formation of the amicetin skeleton by the linkage of cytosine, p-aminobenzoic acid (PABA), and the terminal (+)-alpha-methylserine moieties. The inactivation of the benzoate coenzyme A (benzoate-CoA) ligase gene amiL and the N-acetyltransferase gene amiF led to two ...
4-Aminobiphenyl exposure can be assayed by measuring the extent of adduct formation with hemoglobin. 4-Aminobiphenyl metabolism is catalyzed by N-hydroxylation via cytochrome P450 1A2. It is then followed by O-sulfation and O-acetylation by sulfotransferase 1A1 and arylamine N-acetyltransferase 2. The urinary metabolites of 4-aminobiphenyl include 4-acetylaminobiphenyl, 4-hydroxy-4-aminobiphenyl, 2-hydroxy-4-acetylaminobiphenyl, 4-hydroxy-4-acetylaminobiphenyl, 3-hydroxy, 4-methoxy-4-acetylaminobiphenyl, 4-hydroxy, 3-methoxy-4-acetylaminobiphenyl, and 3,4-dihydroxy-4-acetylaminobiphenyl. (8, 4 ...
Haque, R., Chong, Nelson W., Ali, F., Chaurasia, S.S., Sengupta, T., Chun, E., Howell, J.C., Klein, D.C. and Iuvone, P.M. 2011. Melatonin synthesis in retina: cAMP-dependent transcriptional regulation of chicken arylalkylamine N-acetyltransferase by a CRE-like sequence and a TTATT repeat motif in the proximal promoter. Journal of Neurochemistry. 119 (1), pp. 6-17. doi:10.1111/j.1471-4159.2011.07397.x Cardiac-specific RNAi knockdown of Abra disrupts heart function and alters lifespan in Drosophila melanogaster ...
ClCr ,15 ml/min--2 mg on dailysis day ,3 mg/min: 100 mg at extended intervals ,10 ml/min-- in fast acetylators Q8-16H ClCr 30-50: 0.25 mg QD or 0.5 mg QOD (treatment-naive) ClCr ,10: 0.05 mg QD or 0.5 Q7D (treatment-naive) 10-50 ml/min Q6-12H; ,10 ml/min Q12-18H Clcr,25 ml/min:dosage adjustments may be necessary Clcr,25 ml/min:dosage adjustments may be necessary 1# QD in moderate renal impairment and in patients on 10-50 ml/min 75%; ,10 ml/min 50% of the usual dose 10-50 ml/min ,0.6 mg/day to every other day ClCr,30 ml/min not on hemodialysis: starting dose should be 5 milligrams (mg) once daily with titration not to lower dose and then increased gradually; not recommended for patients with end-stage renal disease (requiring dialysis) or severe renal impairment (ClCr,30 GFR 10 to 50 ml/min: 75% of the usual dose GFR ,10 ml/min: 50% of the usual dose GFR ,50 ml/min Q6H; 10-50 ml/min Q12H; ,10 ml/min Clcr 5-29 ml/min: 5 mg ORALLY twice daily GFR 10 to 50 ml/min: Q24-36H; ,10 ml/min Q48H GFR 10-70 ...
Results Smoking was associated with an increased risk of adenoma. Weak non-significant elevated OR were observed for the main effects of HAA intakes or NAT2 activity. However, the combined effects of HAA intakes and NAT2 activity were statistically significant. Subjects in both the upper tertiles of NAT2 activity and HAA intake were at increased risk of adenoma compared with subjects in the lower tertiles of NAT2 activity and exposure (2-amino-3,4,8-dimethylimidazo[4,5-f]quinoxaline intake OR 1.70, 95% CI I 1.06 to 2.75; 2-amino-3,8-dimethylimidazo[4,5-f]quinoxaline intake OR 1.91, 95% CI 1.16 to 3.16; and 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine intake OR 2.14, 95% CI 1.31 to 3.49).. ...
The mammalian kidney is a complex organ composed of numerous different cell types that function together to facilitate the filtering of blood and the regulation of systemic blood pressure (Guyton, 1991; Tisher and Madsen, 1996). The mammalian kidney also can oxidize and conjugate drugs because xenobiotic-metabolizing enzyme expression and/or activity have been reported in this tissue (for review, see Lohr et al., 1998). Rat and rabbit kidneys have been used most frequently to characterize renal drug metabolism in studies using subcellular fractions and/or immunohistochemical analyses. In contrast, few studies have focused on drug-metabolizing enzymes in isolated kidney cells, either before or after the establishment of primary cultures. We recently determined P450 hemoprotein and glutathione S-transferase (GST) isoform expression in freshly isolated renal proximal tubular cells from male Fischer 344 rats (Cummings et al., 1999, 2000) and found that these cells contained CYP2B1/2,3 CYP2C11, ...
The safety and scientific validity of this study is the responsibility of the study sponsor and investigators. Listing a study does not mean it has been evaluated by the U.S. Federal Government. Read our disclaimer for details ...
Püttmann, M., Arand, M., Oesch, F., Mannschreck, Albrecht and Robertson, L. (1990) Chirality and the Induction of Xenobiotic-Metabolizing Enzymes: Effects of the Atropisomers of 2,2;3,4,4;6-Hexachlorobiphenyl. In: Holmstedt, Bo and Frank, H. and Testa, B., (eds.) Chirality and biological activity: proceedings of an international symposium, Tübingen, Federal Republic of Germany, April 5 - 8, 1988. Liss, New York, p. 177. ISBN 0-471-56226-2. Fulltext not available ...
FREE SHIPPING on Natori Feathers Opaque Thigh Hi! Step into Luxurious indulgence. Designed with high-quality yarns and featuring iconic Natori designs. Signature 3
How many of you dye your hair? You cant let those roots show. You must run to the salon or do it yourself to keep your hair that nice bottled color. Hair dye is a carcinogen. Researchers have been studying a possible link between hair dye use and cancer for many years. Studies have looked…
We use cookies on our website. Some of them are necessary (e.g. for the shopping cart), others help us make our online content better and easier for you over the long term via analysis, external media, and marketing services. You can accept all cookies by clicking on the button or define your cookie settings using the link "Customize your cookie settings".. ...
From BioPortfolio: Highlights Comprehensive 1,125page market segmentation analysis of the German NAT market. Major issues pertaining to the German NAT laboratory practice, as well...
Keto OS NAT Review | Keto OS says nutritionally advanced technology (NAT) is the secret to this NEW product. Isnt it still about ketosis?
Expression of NAT9 (DKFZP564C103) in cancer tissue. The cancer tissue page shows antibody staining of the protein in 20 different cancers.
"Deciphering the Ancient and Complex Evolutionary History of Human Arylamine N-Acetyltransferase Genes". American Journal of ...
... the identification of novel inhibitors of arylamine N-acetyltransferases". Journal of the Royal Society, Interface / the Royal ...
"Deciphering the Ancient and Complex Evolutionary History of Human Arylamine N-Acetyltransferase Genes". American Journal of ...
N-Acetyltransferase is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to arylamines and aromatic amines ... These studies claim that ABT is a more potent inhibitor of N-acetyltransferase 2 compared with N-acetyltransferase 1. Strong JM ... Procainamide is metabolized in the liver to acecainide by N-acetyltransferase, an enzyme that is genetically determined. ... Evans DA (1989). "N-acetyltransferase". Pharmacology & Therapeutics. 42 (2): 157-234. doi:10.1016/0163-7258(89)90036-3. PMID ...
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes ... Molecular cloning of a novel esterase involved in the metabolic activation of arylamine carcinogens with high sequence ... one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens GRCh38: Ensembl release 89: ...
... arylamine N-acetyltransferase EC 2.3.1.6: choline O-acetyltransferase EC 2.3.1.7: carnitine O-acetyltransferase EC 2.3.1.8: ... D-tryptophan N-acetyltransferase EC 2.3.1.35: glutamate N-acetyltransferase EC 2.3.1.36: D-amino-acid N-acetyltransferase EC ... amino-acid N-acetyltransferase EC 2.3.1.2: imidazole N-acetyltransferase EC 2.3.1.3: glucosamine N-acetyltransferase EC 2.3.1.4 ... glycine C-acetyltransferase EC 2.3.1.30: serine O-acetyltransferase EC 2.3.1.31: homoserine O-acetyltransferase EC 2.3.1.32: ...
... is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to arylamines. They have wide ... 50% of the British population are deficient in hepatic N-acetyltransferase. This is known as a negative acetylator status. ... "N-acetyltransferase". Pharmacology & Therapeutics. 42 (2): 157-234. doi:10.1016/0163-7258(89)90036-3. PMID 2664821. Ma Y, ... isoniazid procainamide hydralazine dapsone sulfasalazine The following is a list of human genes that encode N-acetyltransferase ...
... (arylamine N-acetyltransferase), also known as NAT2, is an enzyme which in humans is encoded by the NAT2 ... "Entrez Gene: NAT2 N-acetyltransferase 2 (arylamine N-acetyltransferase)". "NAT2PRED: a computational predictor of the human N- ... A second arylamine N-acetyltransferase gene (NAT1) is located near NAT2. The NAT2 acetylator phenotype can be inferred from ... This gene encodes a type of N-acetyltransferase. The NAT2 isozyme functions to both activate and deactivate arylamine and ...
... (arylamine N-acetyltransferase) is a protein that in humans is encoded by the NAT1 gene. This gene is one ... N-acetyltransferase 1 (arylamine N-acetyltransferase)". Retrieved 2012-01-27. Gubin AN, Njoroge JM, Bouffard GG, Miller JL ( ... "Expression of arylamine N-acetyltransferases in pre-term placentas and in human pre-implantation embryos". Human Molecular ... of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat NAT2 genes. The ...
4-aminobiphenyl N-acetyltransferase, acetyl CoA-arylamine N-acetyltransferase, 2-naphthylamine N-acetyltransferase, arylamine ... arylamine N-acetyltransferase. Other names in common use include arylamine acetylase, beta-naphthylamine N-acetyltransferase, ... N-acetyltransferase, p-aminosalicylate N-acetyltransferase, serotonin acetyltransferase, and serotonin N-acetyltransferase. As ... an arylamine N-acetyltransferase (EC 2.3.1.5) is an enzyme that catalyzes the chemical reaction acetyl-CoA + an arylamine ⇌ {\ ...
Voisin P, Namboodiri MA, Klein DC (1984). "Arylamine N-acetyltransferase and arylalkylamine N-acetyltransferase in the ... The N-acetyltransferase reaction has been suggested to be the rate-determining step, and thus Serotonin N-acetyltransferase has ... Aralkylamine N-acetyltransferase (AANAT) (EC 2.3.1.87), also known as arylalkylamine N-acetyltransferase or serotonin N- ... Aralkylamine N-acetyltransferase belongs to the GCN5-related N-acetyltransferase (GNAT) superfamily which consists 10,000 ...
Other names in common use include arylhydroxamate N,O-acetyltransferase, arylamine N-acetyltransferase, and N-hydroxy-2- ... O-acetyltransferase and arylamine N-acetyltransferase". J. Biochem. Tokyo. 99 (6): 1689-97. PMID 3745141. Molecular and ... In enzymology, a N-hydroxyarylamine O-acetyltransferase (EC 2.3.1.118) is an enzyme that catalyzes the chemical reaction acetyl ... Saito K, Shinohara A, Kamataki T, Kato R (June 1986). "N-hydroxyarylamine O-acetyltransferase in hamster liver: identity with ...
... arylalkylamine n-acetyltransferase MeSH D08.811.913.050.313 --- arylamine N-acetyltransferase MeSH D08.811.913.050.331 --- atp ... acetyl-CoA C-acetyltransferase MeSH D08.811.913.050.134.105 --- amino-acid n-acetyltransferase MeSH D08.811.913.050.134.150 ... acetyltransferases MeSH D08.811.913.050.134.029 --- acyl-carrier protein s-acetyltransferase MeSH D08.811.913.050.134.060 --- ... carnitine O-acetyltransferase MeSH D08.811.913.050.134.170 --- chloramphenicol o-acetyltransferase MeSH D08.811.913.050.134.180 ...
This arylamine is a colorless to pale-yellow liquid with a poor solubility in water. Through biological monitoring it was ... react directly with DNA or be bio-activated via sulfation or acetylation by cytosolic sulfotransferases or N-acetyltransferases ... Eyer, P. (1983). "The red cell as a sensitive target for activated toxic arylamines". Arch. Toxicol. Suppl. 6: 3-12. Hecht, S. ...
"Deciphering the Ancient and Complex Evolutionary History of Human Arylamine N-Acetyltransferase Genes". American Journal of ...
Arylamine N-acetyltransferases (EC 2.3.1.5) (NATs) catalyse the biotransformation of many primary arylamines, hydrazines and ... Abbreviations used: Ac-CoA, acetyl-CoA; NAT, arylamine N-acetyltransferase; StNAT, Salmonella typhimurium NAT; r.m.s.d., root- ... Homology modelling and structural analysis of human arylamine N-acetyltransferase NAT1: evidence for the conservation of a ... Homology modelling and structural analysis of human arylamine N-acetyltransferase NAT1: evidence for the conservation of a ...
Eukaryotic arylamine N-acetyltransferase. Investigation of substrate specificity by high-throughput screening.. 2005 Jan 15 ... Prediction of chronic liver diseases on the basis of the N-acetyltransferase 2 phenotype.. 2004 Mar-Apr ... Functional genomics of C190T single nucleotide polymorphism in human N-acetyltransferase 2.. 2002 Jun ...
There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a ... There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC 2.3.1.5), although first identified as a ... Animals, Arylamine N-Acetyltransferase, Cells, Cultured, Cricetinae, Humans, Isoenzymes, Mice, Protein Structure, Tertiary, ... Mouse N-acetyltransferase type 2, the homologue of human N-acetyltransferase type 1. ...
It is then followed by O-sulfation and O-acetylation by sulfotransferase 1A1 and arylamine N-acetyltransferase 2. The urinary ... and arylamine N-acetyltransferase NAT2, with urothelial cancer in a Japanese population. Int J Cancer. 2002 Dec 1;102(4):418-21 ... and arylamine N-acetyltransferase NAT2, with urothelial cancer in a Japanese population. Int J Cancer. 2002 Dec 1;102(4):418-21 ... then followed by O-sulfation and O-acetylation by sulfotransferase 1A1 and arylamine N-acetyltransferase 2. The metabolites of ...
4-aminobiphenyl N-acetyltransferase, acetyl CoA-arylamine N-acetyltransferase, 2-naphthylamine N-acetyltransferase, arylamine ... arylamine N-acetyltransferase. Other names in common use include arylamine acetylase, beta-naphthylamine N-acetyltransferase, ... N-acetyltransferase, p-aminosalicylate N-acetyltransferase, serotonin acetyltransferase, and serotonin N-acetyltransferase. As ... an arylamine N-acetyltransferase (EC 2.3.1.5) is an enzyme that catalyzes the chemical reaction acetyl-CoA + an arylamine ⇌ {\ ...
A second distinct arylamine N-acetyltransferase isozyme, arylamine N-acetyltransferase type 2, is encoded at the multi-allelic ... of the activity of arylamine N-acetyltransferase type 1 in blood cells. Arylamine N-acetyltransferase type 1 activity in ... Arylamine N-acetyltransferase in erythrocytes of cystic fibrosis patients.. Risch A1, Smelt V, Lane D, Stanley L, van der Slot ... Arylamine N-acetyltransferase type 1 is expressed in erythrocytes and leucocytes and the activity in erythrocytes is shown to ...
Naegleria gruberi nat1 gene for arylamine N-acetyltransferase 1, strain... TPA_inf: Naegleria gruberi nat1 gene for arylamine N ... TPA_inf: Naegleria gruberi nat1 gene for arylamine N-acetyltransferase 1, strain NEG-M, exon 1. GenBank: BN001457.1 ... acetyltransferase 1, strain NEG-M, exon 1. gi,300431652,tpe,BN001457.1, ...
Exopolysaccharide (EPS) adhesins are important determinants of bacterial surface colonization and biofilm formation. Biofilms are a major cause of chronic infections and are responsible for biofouling on water-exposed surfaces. To tackle these problems, it is essential to dissect the processes leading to surface colonization at the molecular and cellular levels. Here we describe a novel c-di-GMP effector, HfsK, that contributes to the... ...
Polymorphic arylamine N-acetyltransferase. Gene Name. NAT2. Organism. Humans. Amino acid sequence. ,lcl,BSEQ0006940,Arylamine N ... Arylamine n-acetyltransferase activity. Specific Function. Participates in the detoxification of a plethora of hydrazine and ... Grant DM, Blum M, Demierre A, Meyer UA: Nucleotide sequence of an intronless gene for a human arylamine N-acetyltransferase ... Grant DM, Lottspeich F, Meyer UA: Evidence for two closely related isozymes of arylamine N-acetyltransferase in human liver. ...
... arylamine N-acetyltransferase) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, ... Transient overexpression lysate of N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 1 ... Your search returned 17 N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules across 5 suppliers. ... N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules. N-acetyltransferase 1 (arylamine N-acetyltransferase) ...
Association of arylamine N-acetyltransferases NAT1 and NAT2 genotypes to laryngeal cancer risk.. Henning S1, Cascorbi I, ...
... mouse arylamine N-acetyltransferase type 2 ( Nat2), is expressed during embryogenesis from the blastocyst stage and in the ... 2006) Structure and mechanism of arylamine N-acetyltransferases. Curr Top Med Chem 6:1641-1654PubMedCrossRefGoogle Scholar ... 2000) Expression of arylamine N-acetyltransferases in pre-term placentas and in human pre-implantation embryos. Hum Mol Genet 9 ... Matas N, Thygesen P, Stacey M, Risch A, Sim E (1997) Mapping AAC1, AAC2 and AACP, the genes for arylamine N-acetyltransferases ...
Edith Sim on Arylamine N-acetyltransferases 3, part of a collection of online lectures. ... Arylamine N-acetyltransferases. Part 3 Im Edith Sim, and I have been working on these enzymes for over 20 years. ... Sim, E. (2016, July 28). Arylamine N-acetyltransferases 3 [Video file]. In The Biomedical & Life Sciences Collection, Henry ... Arylamine N-acetyltransferases 3. Part 3 of 3 *Part 1 of 3 ... Arylamine N-acetyltransferases (recap). *Nat in fungi ...
Background-ArylamineN-acetyltransferases in humans (NAT1 and NAT2) catalyse the acetylation of arylamines including food ... derived heterocyclic arylamine carcinogens. Other substrates include the sulphonamide 5-aminosalicylic acid (5-ASA), which is ...
Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development. Neville J. Butcher and Rodney F. Minchin ... Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development. Neville J. Butcher and Rodney F. Minchin ... Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development. Neville J. Butcher and Rodney F. Minchin ... Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development Message Subject (Your Name) has forwarded a page to ...
Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ... Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ... Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ... Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ...
The polymorphic arylamine N-acetyltransferase (NAT2; EC 2.3.1.5) is supposed to be a susceptibility factor for several drug ... Molecular pharmacology of polymorphic arylamine N-acetyltransferase involved in the metabolism of arylamine drugs]. Deguchi T. ... The polymorphic arylamine N-acetyltransferase (NAT2; EC 2.3.1.5) is supposed to be a susceptibility factor for several drug ... Homozygous rapid arylamine N-acetyltransferase (NAT2) genotype as a susceptibility factor for lung cancer. Cascorbi I, ...
1290 that was significantly down-regulated in luminal A tumors and its potential target arylamine N-acetyltransferase 1 (NAT1 ... We also found 4 potential target genes (FOXA1, arylamine N-acetyltransferase 1 (NAT1), BCL2 and MAPT) of miR-1290 [6]. ... Arylamine N-acetyltransferases (NATs) are present in many species. NATs are cytosolic conjugating enzymes which transfer an ... Wakefield L, Robinson J, Long H, Ibbitt JC, Cooke S, Hurst HC, Sim E: Arylamine N-acetyltransferase 1 expression in breast ...
Levels of N-acetyltransferase activity differed significantly between the strains for many arylamine substrates, with highest ... However, for some other arylamine substrates, levels of N-acetyltransferase activity did not differ significantly between the ... Acetylator phenotype-dependent and -independent expression of arylamine N-acetyltransferase isozymes in rapid and slow ... Acetylator phenotype-dependent and -independent expression of arylamine N-acetyltransferase isozymes in rapid and slow ...
Genetic control of acetyl coenzyme A-dependent arylamine N-acetyltransferase, hydrazine N-acetyltransferase, and N-hydroxy- ... Genetic control of acetyl coenzyme A-dependent arylamine N-acetyltransferase, hydrazine N-acetyltransferase, and N-hydroxy- ... Genetic control of acetyl coenzyme A-dependent arylamine N-acetyltransferase, hydrazine N-acetyltransferase, and N-hydroxy- ... Genetic control of acetyl coenzyme A-dependent arylamine N-acetyltransferase, hydrazine N-acetyltransferase, and N-hydroxy- ...
Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several ... Participates in the detoxification of a plethora of hydrazine and arylamine drugs. ... EC=2.3.1.5, Arylamide acetylase 1, N-acetyltransferase type 1, Monomorphic arylamine N-acetyltransferase. ... NAT1, Recombinant, Human, aa1-290, His-tag (Arylamine N-acetyltransferase 1, AAC1, MNAT, NAT-1, NATI ...
The human arylamine N-acetyltransferase 1 (NAT1) is critical in determining the duration of action and pharmacokinetics of ... Effects of nucleotide variation on the structure and function of human arylamine n-acetyltransferase 1. ...
... catalyse acetylation reactions which can result in either detoxification or activation of arylamine carcinogens. The human NAT ... Arylamine N-acetyltransferases (NATs) catalyse acetylation reactions which can result in either detoxification or activation of ... Chromosome mapping of the genes for murine arylamine N-acetyltransferases (NATs), enzymes involved in the metabolism of ... Chromosome mapping of the genes for murine arylamine N-acetyltransferases (NATs), enzymes involved in the metabolism of ...
Probing the Mechanism of Hamster Arylamine N -Acetyltransferase 2 Acetylation by Active Site Modification, Site-Directed ...
Mapping AAC1, AAC2 and AACP, the genes for arylamine N-acetyltransferases, carcinogen metabolising enzymes on human chromosome ... Matas, N, Thygesen, P, Stacey, M, Risch, A and Sim, Edith (1997) Mapping AAC1, AAC2 and AACP, the genes for arylamine N- ... acetyltransferases, carcinogen metabolising enzymes on human chromosome 8p22, a region frequently deleted in tumours. ...