An enzyme that catalyzes the transfer of acetyl groups from ACETYL-COA to arylamines. It can also catalyze acetyl transfer between arylamines without COENZYME A and has a wide specificity for aromatic amines, including SEROTONIN. However, arylamine N-acetyltransferase should not be confused with the enzyme ARYLALKYLAMINE N-ACETYLTRANSFERASE which is also referred to as SEROTONIN ACETYLTRANSFERASE.
Enzymes catalyzing the transfer of an acetyl group, usually from acetyl coenzyme A, to another compound. EC 2.3.1.
Biphenyl compounds substituted in any position by one or more amino groups. Permitted are any substituents except fused rings.
A sulfanilamide anti-infective agent. It has a spectrum of antimicrobial action similar to other sulfonamides.
An aminobenzoic acid isomer that combines with pteridine and GLUTAMIC ACID to form FOLIC ACID. The fact that 4-aminobenzoic acid absorbs light throughout the UVB range has also resulted in its use as an ingredient in SUNSCREENS.
Formation of an acetyl derivative. (Stedman, 25th ed)
Enzymes that catalyze acyl group transfer from ACETYL-CoA to HISTONES forming CoA and acetyl-histones.
An enzyme that catalyzes the formation of acetylcholine from acetyl-CoA and choline. EC
A family of diphenylenemethane derivatives.
An enzyme that catalyzes the acetylation of chloramphenicol to yield chloramphenicol 3-acetate. Since chloramphenicol 3-acetate does not bind to bacterial ribosomes and is not an inhibitor of peptidyltransferase, the enzyme is responsible for the naturally occurring chloramphenicol resistance in bacteria. The enzyme, for which variants are known, is found in both gram-negative and gram-positive bacteria. EC
3-Chloro-4-(3-chloro-2-nitrophenyl)pyrrole. Antifungal antibiotic isolated from Pseudomonas pyrrocinia. It is effective mainly against Trichophyton, Microsporium, Epidermophyton, and Penicillium.
Acetyl CoA participates in the biosynthesis of fatty acids and sterols, in the oxidation of fatty acids and in the metabolism of many amino acids. It also acts as a biological acetylating agent.
A group of compounds derived from ammonia by substituting organic radicals for the hydrogens. (From Grant & Hackh's Chemical Dictionary, 5th ed)
A family of histone acetyltransferases that is structurally-related to CREB-BINDING PROTEIN and to E1A-ASSOCIATED P300 PROTEIN. They function as transcriptional coactivators by bridging between DNA-binding TRANSCRIPTION FACTORS and the basal transcription machinery. They also modify transcription factors and CHROMATIN through ACETYLATION.
An enzyme that catalyzes the formation of O-acetylcarnitine from acetyl-CoA plus carnitine. EC
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
A hepatic carcinogen whose mechanism of activation involves N-hydroxylation to the aryl hydroxamic acid followed by enzymatic sulfonation to sulfoxyfluorenylacetamide. It is used to study the carcinogenicity and mutagenicity of aromatic amines.
An enzyme that catalyzes the conversion of L-SERINE to COENZYME A and O-acetyl-L-serine, using ACETYL-COA as a donor.
Structurally related forms of an enzyme. Each isoenzyme has the same mechanism and classification, but differs in its chemical, physical, or immunological characteristics.
An N-terminal acetyltransferase subtype that consists of the Naa10p catalytic subunit and the Naa15p auxiliary subunit. The structure of this enzyme is conserved between lower and higher eukaryotes. It has specificity for N-terminal SERINE; ALANINE; THREONINE; GLYCINE; VALINE; and CYSTINE residues and acts on nascent peptide chains after the removal of the initiator METHIONINE by METHIONYL AMINOPEPTIDASES.
An N-terminal acetyltransferase subtype that consists of the Naa50p catalytic subunit, and the Naa10p and Naa15p auxiliary subunits. It has specificity for the N-terminal METHIONINE of peptides where the next amino acid in the chain is hydrophobic.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
An enzyme that catalyzes the acetyltransferase reaction using ACETYL CoA as an acetyl donor and dihydrolipoamide as acceptor to produce COENZYME A (CoA) and S-acetyldihydrolipoamide. It forms the (E2) subunit of the PYRUVATE DEHYDROGENASE COMPLEX.
A naphthalene derivative with carcinogenic action.
An enzyme that catalyzes the formation of acetoacetyl-CoA from two molecules of ACETYL COA. Some enzymes called thiolase or thiolase-I have referred to this activity or to the activity of ACETYL-COA C-ACYLTRANSFERASE.
A N-hydroxylated derivative of 2-ACETYLAMINOFLUORENE that has demonstrated carcinogenic action.
DNA sequences which are recognized (directly or indirectly) and bound by a DNA-dependent RNA polymerase during the initiation of transcription. Highly conserved sequences within the promoter include the Pribnow box in bacteria and the TATA BOX in eukaryotes.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Very toxic industrial chemicals. They are absorbed through the skin, causing lethal blood, bladder, liver, and kidney damage and are potent, broad-spectrum carcinogens in most species.
An antitubercular agent often administered in association with ISONIAZID. The sodium salt of the drug is better tolerated than the free acid.
A light-sensitive neuroendocrine organ attached to the roof of the THIRD VENTRICLE of the brain. The pineal gland secretes MELATONIN, other BIOGENIC AMINES and NEUROPEPTIDES.
Benzoic acids, salts, or esters that contain an amino group attached to carbon number 4 of the benzene ring structure.
A characteristic feature of enzyme activity in relation to the kind of substrate on which the enzyme or catalytic molecule reacts.
The biosynthesis of RNA carried out on a template of DNA. The biosynthesis of DNA from an RNA template is called REVERSE TRANSCRIPTION.
Chemical substances that are foreign to the biological system. They include naturally occurring compounds, drugs, environmental agents, carcinogens, insecticides, etc.
The chemical alteration of an exogenous substance by or in a biological system. The alteration may inactivate the compound or it may result in the production of an active metabolite of an inactive parent compound. The alterations may be divided into METABOLIC DETOXICATION, PHASE I and METABOLIC DETOXICATION, PHASE II.
Small chromosomal proteins (approx 12-20 kD) possessing an open, unfolded structure and attached to the DNA in cell nuclei by ionic linkages. Classification into the various types (designated histone I, histone II, etc.) is based on the relative amounts of arginine and lysine in each.
A sodium-dependent neutral amino acid transporter that accounts for most of the sodium-dependent neutral amino acid uptake by mammalian cells. The preferred substrates for this transporter system include ALANINE; SERINE; and GLUTAMINE.
The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
The rate dynamics in chemical or physical systems.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control of gene action in enzyme synthesis.
Substances that increase the risk of NEOPLASMS in humans or animals. Both genotoxic chemicals, which affect DNA directly, and nongenotoxic chemicals, which induce neoplasms by other mechanism, are included.
A member of the p300-CBP transcription factor family that was initially identified as a binding partner for CAMP RESPONSE ELEMENT-BINDING PROTEIN. Mutations in CREB-binding protein are associated with RUBINSTEIN-TAYBI SYNDROME.
Proteins obtained from the species SACCHAROMYCES CEREVISIAE. The function of specific proteins from this organism are the subject of intense scientific interest and have been used to derive basic understanding of the functioning similar proteins in higher eukaryotes.
A deoxyribonucleotide polymer that is the primary genetic material of all cells. Eukaryotic and prokaryotic organisms normally contain DNA in a double-stranded state, yet several important biological processes transiently involve single-stranded regions. DNA, which consists of a polysugar-phosphate backbone possessing projections of purines (adenine and guanine) and pyrimidines (thymine and cytosine), forms a double helix that is held together by hydrogen bonds between these purines and pyrimidines (adenine to thymine and guanine to cytosine).
The uptake of naked or purified DNA by CELLS, usually meaning the process as it occurs in eukaryotic cells. It is analogous to bacterial transformation (TRANSFORMATION, BACTERIAL) and both are routinely employed in GENE TRANSFER TECHNIQUES.
Extrachromosomal, usually CIRCULAR DNA molecules that are self-replicating and transferable from one organism to another. They are found in a variety of bacterial, archaeal, fungal, algal, and plant species. They are used in GENETIC ENGINEERING as CLONING VECTORS.
The products of chemical reactions that result in the addition of extraneous chemical groups to DNA.
Use of restriction endonucleases to analyze and generate a physical map of genomes, genes, or other segments of DNA.
A suspected industrial carcinogen (and listed as such by OSHA). Its N-hydroxy metabolite is strongly carcinogenic and mutagenic.
A member of the p300-CBP transcription factors that was originally identified as a binding partner for ADENOVIRUS E1A PROTEINS.
A large lobed glandular organ in the abdomen of vertebrates that is responsible for detoxification, metabolism, synthesis and storage of various substances.
Enzymes that catalyze the transfer of an acetyl group, usually from ACETYL COENZYME A, to the N-terminus of a peptide chain.
A multienzyme complex responsible for the formation of ACETYL COENZYME A from pyruvate. The enzyme components are PYRUVATE DEHYDROGENASE (LIPOAMIDE); dihydrolipoamide acetyltransferase; and LIPOAMIDE DEHYDROGENASE. Pyruvate dehydrogenase complex is subject to three types of control: inhibited by acetyl-CoA and NADH; influenced by the energy state of the cell; and inhibited when a specific serine residue in the pyruvate decarboxylase is phosphorylated by ATP. PYRUVATE DEHYDROGENASE (LIPOAMIDE)-PHOSPHATASE catalyzes reactivation of the complex. (From Concise Encyclopedia Biochemistry and Molecular Biology, 3rd ed)
An N-terminal acetyltransferase subtype that consists of the Naa20p catalytic subunit and the Naa25p auxiliary subunit. The structure of this enzyme is conserved between YEASTS and HUMAN. It has specificity for the N-terminal METHIONINE of peptides where the next amino acid in the chain is either ASPARTATE; GLUTAMATE; ASPARAGINE; OR GLUTAMINE.
Endogenous substances, usually proteins, which are effective in the initiation, stimulation, or termination of the genetic transcription process.
Antibacterial agent used primarily as a tuberculostatic. It remains the treatment of choice for tuberculosis.
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
A rapid-growing, nonphotochromogenic species of MYCOBACTERIUM originally isolated from human smegma and found also in soil and water. (From Dorland, 28th ed)
Any detectable and heritable change in the genetic material that causes a change in the GENOTYPE and which is transmitted to daughter cells and to succeeding generations.
Any of the processes by which nuclear, cytoplasmic, or intercellular factors influence the differential control (induction or repression) of gene action at the level of transcription or translation.
A biogenic polyamine formed from spermidine. It is found in a wide variety of organisms and tissues and is an essential growth factor in some bacteria. It is found as a polycation at all pH values. Spermine is associated with nucleic acids, particularly in viruses, and is thought to stabilize the helical structure.
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
The degree of similarity between sequences of amino acids. This information is useful for the analyzing genetic relatedness of proteins and species.
Proteins found in the nucleus of a cell. Do not confuse with NUCLEOPROTEINS which are proteins conjugated with nucleic acids, that are not necessarily present in the nucleus.
Vesicular amine transporter proteins that transport the neurotransmitter ACETYLCHOLINE into small SECRETORY VESICLES. Proteins of this family contain 12 transmembrane domains and exchange vesicular PROTONS for cytoplasmic acetylcholine.
Established cell cultures that have the potential to propagate indefinitely.
Proteins prepared by recombinant DNA technology.
Nerve fibers liberating acetylcholine at the synapse after an impulse.
Nucleic acid sequences involved in regulating the expression of genes.
A polyamine formed from putrescine. It is found in almost all tissues in association with nucleic acids. It is found as a cation at all pH values, and is thought to help stabilize some membranes and nucleic acid structures. It is a precursor of spermine.
The facilitation of a chemical reaction by material (catalyst) that is not consumed by the reaction.
Processes that stimulate the GENETIC TRANSCRIPTION of a gene or set of genes.
Intracellular fluid from the cytoplasm after removal of ORGANELLES and other insoluble cytoplasmic components.
The regular and simultaneous occurrence in a single interbreeding population of two or more discontinuous genotypes. The concept includes differences in genotypes ranging in size from a single nucleotide site (POLYMORPHISM, SINGLE NUCLEOTIDE) to large nucleotide sequences visible at a chromosomal level.
The outward appearance of the individual. It is the product of interactions between genes, and between the GENOTYPE and the environment.
An essential amino acid. It is often added to animal feed.
An enzyme that catalyzes the biosynthesis of cysteine in microorganisms and plants from O-acetyl-L-serine and hydrogen sulfide. This enzyme was formerly listed as EC
Proteins which bind to DNA. The family includes proteins which bind to both double- and single-stranded DNA and also includes specific DNA binding proteins in serum which can be used as markers for malignant diseases.
In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
A method (first developed by E.M. Southern) for detection of DNA that has been electrophoretically separated and immobilized by blotting on nitrocellulose or other type of paper or nylon membrane followed by hybridization with labeled NUCLEIC ACID PROBES.
The extent to which an enzyme retains its structural conformation or its activity when subjected to storage, isolation, and purification or various other physical or chemical manipulations, including proteolytic enzymes and heat.
Diffusible gene products that act on homologous or heterologous molecules of viral or cellular DNA to regulate the expression of proteins.
The parts of a macromolecule that directly participate in its specific combination with another molecule.
The material of CHROMOSOMES. It is a complex of DNA; HISTONES; and nonhistone proteins (CHROMOSOMAL PROTEINS, NON-HISTONE) found within the nucleus of a cell.
Cis-acting DNA sequences which can increase transcription of genes. Enhancers can usually function in either orientation and at various distances from a promoter.
Recombinant proteins produced by the GENETIC TRANSLATION of fused genes formed by the combination of NUCLEIC ACID REGULATORY SEQUENCES of one or more genes with the protein coding sequences of one or more genes.
The process in which substances, either endogenous or exogenous, bind to proteins, peptides, enzymes, protein precursors, or allied compounds. Specific protein-binding measures are often used as assays in diagnostic assessments.
A species of nonpathogenic fluorescent bacteria found in feces, sewage, soil, and water, and which liquefy gelatin.
The region of an enzyme that interacts with its substrate to cause the enzymatic reaction.
A group of 6-alkyl SALICYLIC ACIDS that are found in ANACARDIUM and known for causing CONTACT DERMATITIS.
An enzyme that catalyzes the hydrolysis of ACETYLCHOLINE to CHOLINE and acetate. In the CNS, this enzyme plays a role in the function of peripheral neuromuscular junctions. EC
A species of the genus SACCHAROMYCES, family Saccharomycetaceae, order Saccharomycetales, known as "baker's" or "brewer's" yeast. The dried form is used as a dietary supplement.
A subfamily in the family MURIDAE, comprising the hamsters. Four of the more common genera are Cricetus, CRICETULUS; MESOCRICETUS; and PHODOPUS.
The first continuously cultured human malignant CELL LINE, derived from the cervical carcinoma of Henrietta Lacks. These cells are used for VIRUS CULTIVATION and antitumor drug screening assays.
Nonsusceptibility of bacteria to the action of CHLORAMPHENICOL, a potent inhibitor of protein synthesis in the 50S ribosomal subunit where amino acids are added to nascent bacterial polypeptides.
An enzyme that catalyses the reaction of D-glucosamine 6-phosphate with ACETYL-COA to form N-acetylglucosamine 6-phosphate.
Genes whose expression is easily detectable and therefore used to study promoter activity at many positions in a target genome. In recombinant DNA technology, these genes may be attached to a promoter region of interest.
A serotype of Salmonella enterica that is a frequent agent of Salmonella gastroenteritis in humans. It also causes PARATYPHOID FEVER.
Models used experimentally or theoretically to study molecular shape, electronic properties, or interactions; includes analogous molecules, computer-generated graphics, and mechanical structures.
A genus of the family Muridae having three species. The present domesticated strains were developed from individuals brought from Syria. They are widely used in biomedical research.
The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.
Liquid chromatographic techniques which feature high inlet pressures, high sensitivity, and high speed.
Genes which regulate or circumscribe the activity of other genes; specifically, genes which code for PROTEINS or RNAs which have GENE EXPRESSION REGULATION functions.
Enzymes from the transferase class that catalyze the transfer of acyl groups from donor to acceptor, forming either esters or amides. (From Enzyme Nomenclature 1992) EC 2.3.
An antibiotic first isolated from cultures of Streptomyces venequelae in 1947 but now produced synthetically. It has a relatively simple structure and was the first broad-spectrum antibiotic to be discovered. It acts by interfering with bacterial protein synthesis and is mainly bacteriostatic. (From Martindale, The Extra Pharmacopoeia, 29th ed, p106)
A phospholipid derivative formed by PLATELETS; BASOPHILS; NEUTROPHILS; MONOCYTES; and MACROPHAGES. It is a potent platelet aggregating agent and inducer of systemic anaphylactic symptoms, including HYPOTENSION; THROMBOCYTOPENIA; NEUTROPENIA; and BRONCHOCONSTRICTION.
Deacetylases that remove N-acetyl groups from amino side chains of the amino acids of HISTONES. The enzyme family can be divided into at least three structurally-defined subclasses. Class I and class II deacetylases utilize a zinc-dependent mechanism. The sirtuin histone deacetylases belong to class III and are NAD-dependent enzymes.
A mitochondrial matrix enzyme that catalyzes the synthesis of L-GLUTAMATE to N-acetyl-L-glutamate in the presence of ACETYL-COA.
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
A category of nucleic acid sequences that function as units of heredity and which code for the basic instructions for the development, reproduction, and maintenance of organisms.
Cells grown in vitro from neoplastic tissue. If they can be established as a TUMOR CELL LINE, they can be propagated in cell culture indefinitely.
Cells propagated in vitro in special media conducive to their growth. Cultured cells are used to study developmental, morphologic, metabolic, physiologic, and genetic processes, among others.
The level of protein structure in which combinations of secondary protein structures (alpha helices, beta sheets, loop regions, and motifs) pack together to form folded shapes called domains. Disulfide bridges between cysteines in two different parts of the polypeptide chain along with other interactions between the chains play a role in the formation and stabilization of tertiary structure. Small proteins usually consist of only one domain but larger proteins may contain a number of domains connected by segments of polypeptide chain which lack regular secondary structure.
Biogenic amines having more than one amine group. These are long-chain aliphatic compounds that contain multiple amino and/or imino groups. Because of the linear arrangement of positive charge on these molecules, polyamines bind electrostatically to ribosomes, DNA, and RNA.
Proteins found in any species of bacterium.
A basic constituent of lecithin that is found in many plants and animal organs. It is important as a precursor of acetylcholine, as a methyl donor in various metabolic processes, and in lipid metabolism.
Drugs used in the treatment of tuberculosis. They are divided into two main classes: "first-line" agents, those with the greatest efficacy and acceptable degrees of toxicity used successfully in the great majority of cases; and "second-line" drugs used in drug-resistant cases or those in which some other patient-related condition has compromised the effectiveness of primary therapy.
Within a eukaryotic cell, a membrane-limited body which contains chromosomes and one or more nucleoli (CELL NUCLEOLUS). The nuclear membrane consists of a double unit-type membrane which is perforated by a number of pores; the outermost membrane is continuous with the ENDOPLASMIC RETICULUM. A cell may contain more than one nucleus. (From Singleton & Sainsbury, Dictionary of Microbiology and Molecular Biology, 2d ed)
Tumors or cancer of the URINARY BLADDER.
A constituent of STRIATED MUSCLE and LIVER. It is an amino acid derivative and an essential cofactor for fatty acid metabolism.
The species Oryctolagus cuniculus, in the family Leporidae, order LAGOMORPHA. Rabbits are born in burrows, furless, and with eyes and ears closed. In contrast with HARES, rabbits have 22 chromosome pairs.
An increase in the rate of synthesis of an enzyme due to the presence of an inducer which acts to derepress the gene responsible for enzyme synthesis.
The repeating structural units of chromatin, each consisting of approximately 200 base pairs of DNA wound around a protein core. This core is composed of the histones H2A, H2B, H3, and H4.
Neurons whose primary neurotransmitter is ACETYLCHOLINE.
Tissue in the BASAL FOREBRAIN inferior to the anterior perforated substance, and anterior to the GLOBUS PALLIDUS and ansa lenticularis. It contains the BASAL NUCLEUS OF MEYNERT.
Proteins that control the CELL DIVISION CYCLE. This family of proteins includes a wide variety of classes, including CYCLIN-DEPENDENT KINASES, mitogen-activated kinases, CYCLINS, and PHOSPHOPROTEIN PHOSPHATASES as well as their putative substrates such as chromatin-associated proteins, CYTOSKELETAL PROTEINS, and TRANSCRIPTION FACTORS.
The phenotypic manifestation of a gene or genes by the processes of GENETIC TRANSCRIPTION and GENETIC TRANSLATION.
A toxic diamine formed by putrefaction from the decarboxylation of arginine and ornithine.
A neurotransmitter found at neuromuscular junctions, autonomic ganglia, parasympathetic effector junctions, a subset of sympathetic effector junctions, and at many sites in the central nervous system.
A plant genus of the family CELASTRACEAE.
An enzyme that catalyzes the synthesis of acetylphosphate from acetyl-CoA and inorganic phosphate. Acetylphosphate serves as a high-energy phosphate compound. EC
A chemical reaction in which an electron is transferred from one molecule to another. The electron-donating molecule is the reducing agent or reductant; the electron-accepting molecule is the oxidizing agent or oxidant. Reducing and oxidizing agents function as conjugate reductant-oxidant pairs or redox pairs (Lehninger, Principles of Biochemistry, 1982, p471).
Closed vesicles of fragmented endoplasmic reticulum created when liver cells or tissue are disrupted by homogenization. They may be smooth or rough.
The normality of a solution with respect to HYDROGEN ions; H+. It is related to acidity measurements in most cases by pH = log 1/2[1/(H+)], where (H+) is the hydrogen ion concentration in gram equivalents per liter of solution. (McGraw-Hill Dictionary of Scientific and Technical Terms, 6th ed)

Melatonin biosynthesis: the structure of serotonin N-acetyltransferase at 2.5 A resolution suggests a catalytic mechanism. (1/592)

Conversion of serotonin to N-acetylserotonin, the precursor of the circadian neurohormone melatonin, is catalyzed by serotonin N-acetyltransferase (AANAT) in a reaction requiring acetyl coenzyme A (AcCoA). AANAT is a globular protein consisting of an eight-stranded beta sheet flanked by five alpha helices; a conserved motif in the center of the beta sheet forms the cofactor binding site. Three polypeptide loops converge above the AcCoA binding site, creating a hydrophobic funnel leading toward the cofactor and serotonin binding sites in the protein interior. Two conserved histidines not found in other NATs are located at the bottom of the funnel in the active site, suggesting a catalytic mechanism for acetylation involving imidazole groups acting as general acid/base catalysts.  (+info)

Pharmacological characterization of beta2-adrenoceptor in PGT-beta mouse pineal gland tumour cells. (2/592)

1. The adrenoceptor in a mouse pineal gland tumour cell line (PGT-beta) was identified and characterized using pharmacological and physiological approaches. 2. Adrenaline and noradrenaline, adrenoceptor agonists, stimulated cyclic AMP generation in a concentration-dependent manner, but had no effect on inositol 1,4,5-trisphosphate production. Adrenaline was a more potent activator of cyclic AMP generation than noradrenaline, with half maximal-effective concentrations (EC50) seen at 175+/-22 nM and 18+/-2 microM for adrenaline and noradrenaline, respectively. 3. The addition of forskolin synergistically stimulated the adrenaline-mediated cyclic AMP generation in a concentration-dependent manner. 4. The pA2 value for the specific beta2-adrenoceptor antagonist ICI-118,551 (8.7+/-0.4) as an antagonist of the adrenaline-stimulated cyclic AMP generation were 3 units higher than the value for the betaI-adrenoceptor antagonist atenolol (5.6+/-0.3). 5. Treatment of the cells with adrenaline and forskolin evoked a 3 fold increase in the activity of serotonin N-acetyltransferase with the peak occurring 6 h after stimulation. 6. These results suggest the presence of beta2-adrenoceptors in mouse pineal cells and a functional relationship between the adenylyl cyclase system and the regulation of N-acetyltransferase expression.  (+info)

Two arylalkylamine N-acetyltransferase genes mediate melatonin synthesis in fish. (3/592)

Serotonin N-acetyltransferase (arylalkylamine N-acetyltransferase, AANAT, EC is the first enzyme in the conversion of serotonin to melatonin. Large changes in AANAT activity play an important role in the daily rhythms in melatonin production. Although a single AANAT gene has been found in mammals and the chicken, we have now identified two AANAT genes in fish. These genes are designated AANAT-1 and AANAT-2; all known AANATs belong to the AANAT-1 subfamily. Pike AANAT-1 is nearly exclusively expressed in the retina and AANAT-2 in the pineal gland. The abundance of each mRNA changes on a circadian basis, with retinal AANAT-1 mRNA peaking in late afternoon and pineal AANAT-2 mRNA peaking 6 h later. The pike AANAT-1 and AANAT-2 enzymes (66% identical amino acids) exhibit marked differences in their affinity for serotonin, relative affinity for indoleethylamines versus phenylethylamines and temperature-activity relationships. Two AANAT genes also exist in another fish, the trout. The evolution of two AANATs may represent a strategy to optimally meet tissue-related requirements for synthesis of melatonin: pineal melatonin serves an endocrine role and retinal melatonin plays a paracrine role.  (+info)

N-acetyltransferase 1 genetic polymorphism, cigarette smoking, well-done meat intake, and breast cancer risk. (4/592)

N-Acetyltransferase 1 (NAT1), encoded by the polymorphic NAT1 gene, has been shown to be one of the major enzymes in human breast tissue that activates aromatic and heterocyclic amines. Humans are mainly exposed to these carcinogens through cigarette smoking and consumption of well-done meat. To test the hypothesis that variations in the NAT1 gene are related to breast cancer risk, particularly among women who smoke or consume high levels of well-done meat, a nested case-control study was conducted in a prospective cohort study of 41,837 postmenopausal Iowa women. Information on cigarette smoking and other breast cancer risk factors was obtained at the baseline survey conducted in 1986. DNA samples and information on the consumption of well-done meat were obtained, in the case-control study, from breast cancer cases diagnosed from 1992 to 1994 and a random sample of cancer-free cohort members. Genomic DNA samples obtained from 154 cases and 330 controls were assayed for 11 NAT1 alleles (NAT1*3, *4, *5, *10, *11, *14, *15, *16, *17, *19, and *22). The NAT1*4 allele was the predominant allele observed in this study population, accounting for 73.2% (72.4% in cases versus 73.8% in controls) of the total alleles analyzed. Compared to controls, breast cancer cases had a slightly higher frequency of the NAT1*10 allele (18.8% in cases versus 17.3% in controls) and a substantially higher frequency of the NAT1*11 allele (3.6% versus 1.2%). In multivariate analyses, we found a 30% [95% confidence interval (CI) = 0.8-1.9] elevated risk of breast cancer associated with the NAT1*10 allele and a nearly 4-fold (95% CI = 1.5-10.5) elevated risk associated with the NAT1*11 allele. The positive association of breast cancer with the NAT1*11 allele was more evident among smokers [odds ratio (OR) = 13.2, 95% CI = 1.5-116.0] and those who consumed a high level of red meat (OR = 6.1, 95% CI = 1.1-33.2) or consistently consumed their red meat well done (OR = 5.6, 95% CI = 0.5-62.7). The association of the NAT1*10 allele with breast cancer was mainly confined to former smokers (OR = 3.3, 95% CI = 1.2-9.5). These findings are consistent with a role for the NAT1 gene in the etiology of human breast cancer.  (+info)

Selection of RNA replicons capable of persistent noncytopathic replication in mammalian cells. (5/592)

The natural life cycle of alphaviruses, a group of plus-strand RNA viruses, involves transmission to vertebrate hosts via mosquitoes. Chronic infections are established in mosquitoes (and usually in mosquito cell cultures), but infection of susceptible vertebrate cells typically results in rapid shutoff of host mRNA translation and cell death. Using engineered Sindbis virus RNA replicons expressing puromycin acetyltransferase as a dominant selectable marker, we identified mutations allowing persistent, noncytopathic replication in BHK-21 cells. Two of these adaptive mutations involved single-amino-acid substitutions in the C-terminal portion of nsP2, the viral helicase-protease. At one of these loci, nsP2 position 726, numerous substitution mutations were created and characterized in the context of RNA replicons and infectious virus. Our results suggest a direct correlation between the level of viral RNA replication and cytopathogenicity. This work also provides a series of alphavirus replicons for noncytopathic gene expression studies (E. V. Agapov, I. Frolov, B. D. Lindenbach, B. M. Pragai, S. Schlesinger, and C. M. Rice, Proc. Natl. Acad. Sci. USA 95:12989-12994, 1998) and a general strategy for selecting RNA viral mutants adapted to different cellular environments.  (+info)

Chromosomal aberrations in humans induced by urban air pollution: influence of DNA repair and polymorphisms of glutathione S-transferase M1 and N-acetyltransferase 2. (6/592)

We have studied the influence of individual susceptibility factors on the genotoxic effects of urban air pollution in 106 nonsmoking bus drivers and 101 postal workers in the Copenhagen metropolitan area. We used the frequency of chromosomal aberrations in peripheral blood lymphocytes as a biomarker of genotoxic damage and dimethylsulfate-induced unscheduled DNA synthesis in mononuclear WBCs, the glutathione S-transferase M1 (GSTM1) genotype, and the N-acetyltransferase 2 (NAT2) genotype as biomarkers of susceptibility. The bus drivers, who had previously been observed to have elevated levels of aromatic DNA adducts in their peripheral mononuclear cells, showed a significantly higher frequency of cells with chromosomal aberrations as compared with the postal workers. In the bus drivers, unscheduled DNA synthesis correlated negatively with the number of cells with gaps, indicating a protective effect of DNA repair toward chromosome damage. Bus drivers with the GSTM1 null and slow acetylator NAT2 genotype had an increased frequency of cells with chromosomal aberrations. NAT2 slow acetylators also showed elevated chromosomal aberration counts among the postal workers. Our results suggest that long-term exposure to urban air pollution (with traffic as the main contributor) induces chromosome damage in human somatic cells. Low DNA repair capacity and GSTM1 and NAT2 variants associated with reduced detoxification ability increase susceptibility to such damage. The effect of the GSTM1 genotype, which was observed only in the bus drivers, appears to be associated with air pollution, whereas the NAT2 genotype effect, which affected all subjects, may influence the individual response to some other common exposure or the baseline level of chromosomal aberrations.  (+info)

Transcription factors in neuroendocrine regulation: rhythmic changes in pCREB and ICER levels frame melatonin synthesis. (7/592)

Neurotransmitter-driven activation of transcription factors is important for control of neuronal and neuroendocrine functions. We show with an in vivo approach that the norepinephrine cAMP-dependent rhythmic hormone production in rat pineal gland is accompanied by a temporally regulated switch in the ratio of a transcriptional activator, phosphorylated cAMP-responsive element-binding protein (pCREB), and a transcriptional inhibitor, inducible cAMP early repressor (ICER). pCREB accumulates endogenously at the beginning of the dark period and declines during the second half of the night. Concomitant with this decline, the amount of ICER rises. The changing ratio between pCREB and ICER shapes the in vivo dynamics in mRNA and, thus, protein levels of arylalkylamine-N-acetyltransferase, the rate-limiting enzyme of melatonin synthesis. Consequently, a silenced ICER expression in pinealocytes leads to a disinhibited arylalkylamine-N-acetyltransferase transcription and a primarily enhanced melatonin synthesis.  (+info)

Polymorphisms of xenobiotic-metabolizing enzymes and susceptibility to cancer. (8/592)

The variation in individual responses to exogenous agents is exceptionally wide. It is because of this large diversity of responsiveness that risk factors to environmentally induced diseases have been difficult to pinpoint, particularly at low exposure levels. Opportunities now exist for studies of host factors in cancer or other diseases in which an environmental component can be presumed. Many of the studies have shown an elevated disease proneness for individuals carrying the potential at-risk alleles of metabolic genes, but a number of controversial results have also been reported. This article is an overview of the data published to date on metabolic genotypes related to individual susceptibility to cancer.  (+info)

There is increasing evidence that human arylamine N-acetyltransferase type 1 (NAT1, EC, although first identified as a homologue of a drug-metabolising enzyme, appears to be a marker in human oestrogen receptor positive breast cancer. Mouse Nat2 is the mouse equivalent of human NAT1. The development of mouse models of breast cancer is important, and it is essential to explore the biological role of mouse Nat2. We have therefore produced mouse Nat2 as a recombinant protein and have investigated its substrate specificity profile in comparison with human NAT1. In addition, we have tested the effects of inhibitors on mouse Nat2, including compounds which are endogenous and exogenous steroids. We show that tamoxifen, genistein and diethylstilbestrol inhibit mouse Nat2. The steroid analogue, bisphenol A, also inhibits mouse Nat2 enzymic activity and is shown by NMR spectroscopy, through shifts in proton peaks, to bind close to the active site. A three-dimensional structure for human NAT1 has recently
Sinclair, John and Sim, Edith (1997) A fragment consisting of the first 204 amino-terminal amino acids of human arylamine N-acetyltransferase one (NAT1) and the first transacetylation step of catalysis. Biochemical Pharmacology, 53(1), pp. 11-16. ISSN (print) 0006-2952 ...
Arylamine N-acetyltransferases (EC (NATs) catalyse the biotransformation of many primary arylamines, hydrazines and their N-hydroxylated metabolites, thereby playing an important role in both the detoxification and metabolic activation of numerous xenobiotics. The recently published crystal structure of the Salmonella typhimurium NAT (StNAT) revealed the existence of a cysteine protease-like (Cys-His-Asp) catalytic triad. In the present study, a three-dimensional homology model of human NAT1, based upon the crystal structure of StNAT [Sinclair, Sandy, Delgoda, Sim and Noble (2000) Nat. Struct. Biol. 7, 560-564], is demonstrated. Alignment of StNAT and NAT1, together with secondary structure predictions, have defined a consensus region (residues 29-131) in which 37% of the residues are conserved. Homology modelling provided a good quality model of the corresponding region in human NAT1. The location of the catalytic triad was found to be identical in StNAT and NAT1. Comparison of ...
Arylamine N-acetyltransferases (NAT) are xenobiotic-metabolizing enzymes responsible for N-acetylation of many arylamines. They are also important for O-acetylation of N-hydroxylated heterocyclic amines. These enzymes play thus an important role in the detoxification and activation of numerous thera …
Experimental and clinical evidence indicates that AcCoA:arylamine N-acetyltransferases (NATs; EC are involved in the bioactivation and inactivation of a wide variety of arylamine, hydrazine, and carcinogenic arylamine xenobiotics. Longitudinal distribution of NATs in the intestine of the ha …
N-acetyltransferase 1 (arylamine N-acetyltransferase) is a protein that in humans is encoded by the NAT1 gene. This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat NAT2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]. GRCh38: Ensembl release 89: ENSG00000171428 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000051147 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Entrez Gene: N-acetyltransferase 1 (arylamine N-acetyltransferase). Retrieved 2012-01-27. Gubin AN, Njoroge JM, Bouffard GG, Miller JL (July 1999). Gene expression in proliferating human erythroid cells. Genomics. 59 ...
Human N-acetyltransferase 2 (NAT2) is polymorphic in humans and may associate with cancer risk by modifying individual susceptibility to cancers from carcinogen exposure. Since molecular epidemiological studies investigating these associations usually include determining NAT2 single-nucleotide polymorphisms (SNPs), haplotypes or genotypes, their conclusions can be compromised by the uncertainty of genotype-phenotype relationships. We characterized NAT2 SNPs and haplotypes by cloning and expressing recombinant NAT2 allozymes in mammalian cells. The reference and variant recombinant NAT2 allozymes were characterized for arylamine N-acetylation and O-acetylation of N-hydroxy-arylamines. SNPs and haplotypes that conferred reduced enzymatic activity did so by reducing NAT2 protein without changing NAT2 mRNA levels. Among SNPs that reduced catalytic activity, G191A (R64Q), G590A (R197Q) and G857A (G286E) reduced protein half-life but T341C (I114T), G499A (E167K) and A411T (L137F) did not. G857A ...
Compare N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
TY - JOUR. T1 - NAT2 fast acetylator genotype is associated with an increased risk of colorectal cancer in Taiwan. AU - Huang, Chi Chou. AU - Chien, Wen Pin. AU - Wong, Ruey Hong. AU - Cheng, Ya Wen. AU - Chen, Meng Cheng. AU - Chou, Ming Chih. AU - Lee, Huei. PY - 2007/7. Y1 - 2007/7. N2 - In Taiwan, colorectal cancer has one of the highest rates of increased incidence in the past two decades. Heterocyclic amines from dietary cooked meats are metabolically activated by NAT2 (N-acetyltransferase 2), which are associated with colorectal cancer incidence. Thus, the NAT2 fast acetylator genotype may be associated with colorectal cancer risk. However, the association between the NAT2 genotype and colorectal cancer risk is not clearly understood. We conducted a study with 244 primary colorectal cancer cases and 299 cancer-free healthy control subjects to verify the association of NAT2 polymorphisms with the risk of Taiwanese colorectal cancer. Our data showed that subjects with the NAT2 W/W ...
Arylamine N-acetyltransferases metabolise a range of hydrazines and arylamines (see Weber and Hein1 for review). The arylamine substrates include environmental carcinogens found in the rubber and dye industry (see Sim et al 2 for review) and cigarette smoke.3 ,4 More importantly for intestinal exposure to carcinogens, heterocyclic amines and their hydroxylamine metabolites, which are substrates for NAT,5 are generated during the cooking of well done meat.6-8 NAT also metabolises arylamine drugs including 5-aminosalicylic acid (5-ASA).1 ,9 There are two NAT isozymes in humans, NAT1 and NAT2, both of which are now known to be polymorphic.10 There has been a continued discussion on the role of NAT polymorphism in determining susceptibility to colorectal cancer. Most of the investigations of NAT as a susceptibility factor in colorectal cancer have involved NAT2 polymorphism11 as it has been better characterised than NAT1 polymorphism. The situation with colorectal cancer is not as clear cut as in ...
Buy NAT8B elisa kit, Human N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) ELISA Kit-NP_057431.2 (MBS9318897) product datasheet at MyBioSource, ELISA Kits
This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq, Jul 2008 ...
Sigma-Aldrich offers abstracts and full-text articles by [Natasa Djordjevic, Juan Antonio Carrillo, Nobuhisa Ueda, Guillermo Gervasini, Takashi Fukasawa, Akira Suda, Slobodan Jankovic, Eleni Aklillu].
Acetyl coenzyme A-dependent N-acetyltransferase and O-acetyltransferase activities were examined in liver cytosols derived from homozygous rapid acetylator C57BL/6J and A.B6 congenic inbred mouse strains, from homozygous slow acetylator A/J and B6.A congenic inbred mouse strains, and from the (C57BL/6J x A/J)F1 heterozygous acetylator hybrid mouse strain. Acetylator genotype-dependent N-acetyltransferase activity was exhibited for the N-acetylation of p-aminobenzoic acid, 2-aminofluorene, and 4-aminobiphenyl. In contrast, levels of isoniazid N-acetyltransferase and N-hydroxy-3,2-dimethyl-4-aminobiphenyl O-acetyltransferase activities in mouse liver cytosol appeared to be independent of the arylamine Nat acetylator gene. Although cytosolic N-acetyltransferase activities differed about 2-fold between the parental C57BL/6J and A/J strains for p-aminobenzoic acid, 2-aminofluorene, and 4-aminobiphenyl, the same N-acetyltransferase activities differed about 6-7-fold between the homozygous rapid ...
There is ample evidence that the human acetylator phenotypes are associated with drug induced phenomena. It is principally the slow acetylators who exhibit toxic adverse effects because of their relative inability to detoxify the original drug compounds. In rare instances, however, it is the rapid acetylators who are at a disadvantage. In the matter of association of spontaneous disease with either acetylator phenotype, there are two groups of disorders to consider. First, disorders in which carcinogenic amines are known to be an aetiological factor. This is because these amines are substrates for the polymorphic N-acetyltransferase activity and hence there is a possible rational basis for searching for an association. Secondly, other disorders where searches for associations are based more on hunches. In the first group there is a definite statistical association between cancer of the bladder and the slow acetylator phenotype. In prevalence studies the slow phenotype is 39% more associated with ...
PubMed comprises more than 30 million citations for biomedical literature from MEDLINE, life science journals, and online books. Citations may include links to full-text content from PubMed Central and publisher web sites.
RTI uses cookies to offer you the best experience online. By and clicking accept on this website, you opt in and you agree to the use of cookies. If you would like to know more about how RTI uses cookies and how to manage them please view our Privacy Policy here. You can opt out or change your mind by visiting: Click accept to agree.. Accept ...
The human arylamine N-acetyltransferases first attracted attention because of their role in drug metabolism. However, much of the current literature has focused on their role in the activation and detoxification of environmental carcinogens and how genetic polymorphisms in the genes create predispositions to increased or decreased cancer risk. There are two closely related genes on chromosome 8 that encode the two human arylamine N-acetyltransferases-NAT1 and NAT2. Although NAT2 has restricted tissue expression, NAT1 is found in almost all tissues of the body. There are several single-nucleotide polymorphisms in the protein coding and 3-untranslated regions of the gene that affect enzyme activity. However, NAT1 is also regulated by post-translational and environmental factors, which may be of greater importance than genotype in determining tissue NAT1 activities. Recent studies have suggested a novel role for this enzyme in cancer cell growth. NAT1 is up-regulated in several cancer types, and ...
The occurrence of head and neck cancer (HNC) is associated with smoking and alcohol drinking. Tobacco smoking exposes smokers to a series of carcinogenic chemicals. Cytochrome P450 enzymes (|i|CYP450s|/i|), such as |i|CYP1A1|/i|, |i|CYP1B1|/i|, and |i|CYP2D6|/i|, usually metabolize carcinogens to their inactive derivatives, but they occasionally convert the chemicals to more potent carcinogens. In addition, via |i|CYP450|/i| (|i|CYP2E1|/i|) oxidase, alcohol is metabolized to acetaldehyde, a highly toxic compound, which plays an important role in carcinogenesis. Furthermore, two |i|N|/i|-acetyltransferase isozymes (|i|NATs|/i|), |i|NAT1|/i| and |i|NAT2|/i|, are polymorphic and catalyze both |i|N|/i|-acetylation and |i|O|/i|-acetylation of aromatic and heterocyclic amine carcinogens. Genetic polymorphisms are associated with a number of enzymes involved in the metabolism of carcinogens important in the induction of HNC. It has been suggested that such polymorphisms may be linked to cancer susceptibility.
Christie, Angela, Burgess, Anne P. and Sim, Edith (1987) N-Acetyltransferase activity in cultured-cells. Biochemical Society Transactions, 15(3), p. 449. ISSN (print) 0300-5127 ...
Antila E, Westermark T, On the etiopathogenesis and therapy of Down syndrome. Int. J. Dev. Biol. 33: 183-188, 1989 Medline. Baez S, Segura-Aguilar J, Widersten M, et al. Glutathione transferases catalyze the detoxification of oxidized metabolites (o-quinones) of catecholamines and may serve as an antioxidant system preventing degenerative cellular processes. Biochem. J. 324 (pt.1): 25-28, 1997 Medline. Bandmann O, Vaughen J, Holmans P, et al. Association of slow acetylator genotype for N-acetyltransferase 2 with familiar Parkinsons disease. Lancet 350: 1136-1139, 1997 Medline. Berry T. A selenium transport protein model of a sub-type of schizophrenia. Med. Hypothesis 43: 409-414, 1994 Medline. Brown K, Reid A, White T, et al. Vitamin E, lipids and lipid peroxidation products in tardive dyskinesia. Biol. Psychiatry 43: 863-867, 1998 Medline. Brugge KL, Nichols S, Delis D, et al. The role of alterations in free radical metabolism in mediating cognitive impairments in Down syndrome. EXS 62: ...
In recent times, an increasing number of different haplotypes of the arylamine N-acetyltransferase 2 gene are reported. Since most of the various alleles are defined by linkages of commonly known hereditary point mutations, some confusion may occur when the mutation pattern revealed by genotyping sh
The molecular genetic basis of N-acetylation polymorphism has been investigated in inbred mouse models of the human acetylation polymorphism. Two genomic clones, Nat1 and Nat2, were isolated from a C57BL/6J (B6) mouse (rapid acetylator) genomic library. The Nat1 and Nat2 genes both have intronless coding regions of 870 nucleotides and display greater than 47% deduced amino acid similarity with human, rabbit, and chicken N-acetyltransferases. Amplification of Nat1 and Nat2 from A/J (A) mouse (slow acetylator) genomic DNA by the polymerase chain reaction and subsequent sequencing revealed that Nat1 was identical in B6 and A mice, whereas Nat2 contained a single nucleotide change from adenine in B6 to thymine in A mice. This nucleotide substitution changes the deduced amino acid at position 99 from asparagine in B6 to isoleucine in A mice. Hydropathy analysis revealed that this amino acid change alters the hydropathy of the flanking peptide segment in NAT2 from hydrophilic in the B6 mouse to ...
‎The arylamine N-acetyltransferase 2 (NAT2 [5]; E.C. is a polymorphic enzyme involved in the metabolism of drugs and aromatic amines. About 50% of white individuals are classified as slow acetylators, and these individuals show impaired metabolism of many therapeutically useful arylamine and…
Shop Histidine N-acetyltransferase ELISA Kit, Recombinant Protein and Histidine N-acetyltransferase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
N-Acetyltransferase antibody LS-C200960 is an unconjugated mouse monoclonal antibody to human N-Acetyltransferase. Validated for ELISA and LateralFlow.
In article ,31C894FB.1855 at,, dellaire at ODYSSEE.NET says... , ,I was wondering if the cDNA is out for the acetyl transferase gene for ,mammals.. mouse or human. I know the yeast homolog is cloned but the ,cDNA is not available yet I dont think (at least not through NCBI or ,Entrez). ,Has anyone worked with the yeast acetyl transferase? Youll have to be a bit more specific than acetyltransferase as there are quite a few of them. My own interest is/was arylamine N-acetyltransferases involved in xenobiotic metabolism and the sequences of the two human forms (and variants) and rabbit forms have been available for some time. What do you want acetylated? Bernard Bernard Murray, Ph.D. bernard at (National Cancer Institute, NIH, Bethesda MD, USA) If I knew what was going on Id really be indignant. -Crow T. Robot, MST3k (City Limits ...
We welcome your input and comments. Please use this form to recommend updates to the information in ZFIN. We appreciate as much detail as possible and references as appropriate. We will review your comments promptly ...
NAA60 - NAA60 (Myc-DDK-tagged)-Human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2 available for purchase from OriGene - Your Gene Company.
Purified Recombinant Rat Nat2 Protein, His/GST-tagged from Creative Biomart. Recombinant Rat Nat2 Protein, His/GST-tagged can be used for research.
Buy our Recombinant Human NAT8 protein. Ab160299 is a full length protein produced in Wheat germ and has been validated in WB, ELISA. Abcam provides free…
N-Acetyltransferase phenotype and risk in urinary bladder cancer: approaches in molecular epidemiology. Preliminary results in Sweden and Denmark: A variable bu
TY - GEN. T1 - N-Acetyltransferase 8-like regulates lipid metabolism in brown adipocytes. AU - Bogner-Strauß, Juliane Gertrude. AU - Pelzmann, Helmut Josef. PY - 2013. Y1 - 2013. M3 - Conference contribution. SP - 15. EP - 15. BT - 3rd Scientific Retreat of the DK-Metabolic and Cardiovascular Disease. PB - .. ER - ...
Compare N-acetyltransferase 8 (putative) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
There is growing evidence of dysregulated very long non-coding RNAs (lncRNAs) offering mainly because potential biomarkers for malignancy prognosis. eight-lncRNA signature may have important implications for end result prediction and therapy decisions. [23], [24], [26], [27] and [28], possess indicated oncogenic and/or tumor suppressive functions like protein-coding genes in various cancers. As lncRNAs do not code for proteins, lncRNA appearance may be an improved signal from the tumor position, implying the and superiority as independent biomarkers for early prognosis and diagnosis prediction in cancers [29]. Currently, many expression-based lncRNA personal have been discovered to predict sufferers survival in a few malignancies, including glioblastoma multiforme [30], oesophageal squamous cell carcinoma [31], colorectal cancers [32], breast cancer tumor [33C35], lung cancers [36] and multiple myeloma [37]. Latest research have got uncovered that adjustments in lncRNA appearance had been ...
Accumulating evidence demonstrates that lengthy non-coding RNAs (LncRNAs) perform essential roles in regulating gene expression and so are involved in different cancers including colorectal cancer (CRC). evaluated by silencing the LncRNA and and ideals≥0.05 were removed and thus excluded from further analysis. The heat map of the 50 LncRNAs most obvious differences was created using a method of hierarchical clustering by GeneSpring GX version 7.3 (Agilent Technologies). Chosen LncRNAs were finally confirmed for altered transcription level using quantitative real-time PCR (qRT-PCR) between tumour and adjacent normal tissues. Primers used in qRT-PCR were as follows: LncRNA type:entrez-nucleotide attrs :text:DQ786243″ term_id :110631570″ term_text :DQ786243″DQ786243: 5′-agaggtgggagatgaggg-3′ (forward probe) 5 (reverse probe). Other LncRNAs primer sequences are available upon request. RNA preparation invert transcription and quantitative real-time PCR Total RNAs had been ...
Aralkylamine N-acetyltransferase (AANAT) (EC, also known as arylalkylamine N-acetyltransferase or serotonin N-acetyltransferase (SNAT), is an enzyme that is involved in the day/night rhythmic production of melatonin, by modification of serotonin. It is in humans encoded by the ~2.5 kb AANAT gene containing four exons, located on chromosome 17q25. The gene is translated into a 23 kDa large enzyme. It is well conserved through evolution and the human form of the protein is 80% identical to sheep and rat AANAT. It is an acetyl-CoA-dependent enzyme of the GCN5-related family of N-acetyltransferases (GNATs). It may contribute to multifactorial genetic diseases such as altered behavior in sleep/wake cycle and research is on-going with the aim of developing drugs that regulate AANAT function. The systematic name of this enzyme class is acetyl-CoA:2-arylethylamine N-acetyltransferase. Other names in common use include: AANAT Arylalkylamine N-acetyltransferase Melatonin rhythm enzyme Serotonin ...
Science & Technology, Life Sciences & Biomedicine, Neurosciences, Neurosciences & Neurology, NEUROSCIENCES, chicken, pineal gland, retina, circadian rhythm, light, melatonin, serotonin N-acetyltransferase, MELATONIN SYNTHESIS, PERCEIVED LIGHT, JAPANESE-QUAIL, CLOCK, SYSTEM, SUPPRESSION, RECEPTORS, CELLS ...
TY - JOUR. T1 - Tobacco smoking, NAT2 acetylation genotype and breast cancer risk. AU - Lissowska, Jolanta. AU - Brinton, Louise A.. AU - Zatonski, Witold. AU - Blair, Aaron. AU - Bardin-Mikolajczak, Alicja. AU - Peplonska, Beata. AU - Sherman, Mark E.. AU - Szeszenia-Da̧browska, Neonila. AU - Chanock, Stephen. AU - García-Closas, Montserrat. N1 - Copyright: Copyright 2008 Elsevier B.V., All rights reserved.. PY - 2006/10/15. Y1 - 2006/10/15. N2 - The role of active and passive cigarette smoking in breast cancer etiology remains controversial. Using data from a large population-based case-control study in Poland (2386 cases, 2502 controls) conducted during 2000-2003, we examined the associations between active and passive smoking overall and for different age categories. We also evaluated differences in risk by estrogen receptor (ER) and progesterone receptor (PR) status in tumors, and the potential modification of the smoking association by N-acetyl transferase 2 (NAT2) genotype. Women ever ...
Matt & Nat Gene Yoga Bag Black Womens Apparel at Vickerey This sophisticated unisex yoga from Matt combines supreme functionality with urban edge. substanti
RESULTS: Forty-five (32.1%) patients were diagnosed with ATDH. No significant differences were reported in age and sex between patients with and without ATDH. Slow acetylators defined by NAT2 genotypes had a higher risk of hepatotoxicity than rapid acetylators (51.2% vs. 25.2%, P = 0.0026). Odds ratio (OR) analysis showed that slow acetylator status (OR 3.15, 95%CI 1.47-6.48) was the only independent risk factor for ATDH. Pyrazinamide co-administration induced hepatitis was also associated with NAT2 acetylator status. CYP2E1 c1/c1 homozygotes are prone to developing more severe hepatotoxicity than other c1/c2 and c2/c2 genotypes ...
Over the past years natural products and/or their derivatives have continued to provide cancer chemotherapeutics. Glycosides derivatives of emodin are known to possess anticancer activities. An in silico study was carried out to evaluate emodin derivatives as inhibitors of Arylamine N-Acetyltransferase 2, Cyclooxygenase 2 and Topoisomerase 1 enzymes, predict their pharmacokinetics and explore their bonding modes. Molecular docking study suggested that D2, D5, D6 and D9 to be potent inhibitors of NAT2, while D8 was suggested to be a potent inhibitor of TOP1. Derivatives D2, D5, D6 and D9 bind to the same pocket with different binding conformation. Pharmacokinetic study suggested that selected emodin derivatives can be potential cancer chemotherapeutic agent. Physicochemical parameters such density, balaban index, surface tension, logP and molar reflectance correlated to compounds activity. These finding provides a potential strategy towards developing NAT2 and TOP1 inhibitors.
Rabbit polyclonal Serotonin N-acetyltransferase (phospho T29) antibody validated for WB and tested in Rat. Immunogen corresponding to synthetic peptide
Glucosaminyl (N-acetyl) Transferase 1/GCNT1 Overexpression Lysate (Native). Tested Reactivity: Hu. Validated: WB. Backed by our 100% Guarantee.
Myc-DDK-tagged ORF clone of Homo sapiens glucosaminyl (N-acetyl) transferase 4, core 2 (GCNT4) as transfection-ready DNA - 10 µg - OriGene - cdna clones
Interindividual and interethnic differences in allele frequencies of N-acetyltransferase (NAT2) single nucleotide polymorphisms (SNPs) are responsible for phenotypic variability of adverse drug reactions and susceptibility to cancer. We genotyped the seven NAT2 common SNPs in 127 randomly selected unrelated northern Sudanese subjects using allele-specific and RFLP polymerase chain reaction (PCR) based methods. Molecular genotyping was enough to designate alleles for 41 individuals unambiguously, whereas 63 individuals alleles were inferred from haplotypes previously described. In the remaining 23 individuals, however, the phase of the SNPs could not be decided because of multiple SNP heterozygotes. Using computational methods in the HAP and Phase programs, we confirmed the inferred alleles of the 62 individuals and predicted the remaining 23 ambiguous alleles. Twelve NAT2 alleles were identified. Four alleles coded for rapid acetylators (18%), and eight alleles coded for slow acetylators (82%). Two
Golka and colleagues (1) critically refer to our observation that NAT2 genotype had no impact on bladder cancer risk (2). We were able to demonstrate in our case-control study nested in the European Prospective Investigation into Cancer and Nutrition (EPIC) that occupational exposure to aromatic amines and polycyclic aromatic amines was associated with an increased bladder cancer risk. On the basis of the comprehensive genotyping of N-acetyltransferase 2 (NAT2), we observed that NAT2 slow acetylation was not itself associated with bladder cancer risk. Notably, our main effect of 1.02 [95% confidence interval (CI), 0.81-1.29] is clearly in line with the OR of 1.02 (95% CI, 0.87-1.19) for a tagging single-nucleotide polymorphism that the authors reported from a pooled analysis of their own studies (3).. We fully recognize that EPIC is a population-based cohort with a low prevalence of rare occupations known to entail a bladder cancer risk. We also mentioned in the article that the metabolism of ...
Triethylenetetramine (TETA), a copper II chelator and a polyamine analog traditionally used for the treatment of Wilsons disease, is currently in Phase I clinical trials for cancer in combination with carboplatin. However, the metabolism of TETA has never been thoroughly investigated, which is crucial for its further development in cancer treatment1. The two major metabolites of TETA found in humans are N1-acetyl-TETA (MAT) and N1,N10-diacetyl-TETA (DAT)2. Traditionally, acetylation of drug is thought to be catalyzed by N-acetyltransferase (NAT2). FDA requires that pharmacological properties of any drug metabolized via acetylation route have to be investigated in population with different NAT2 phenotype. However, our recent clinical study showed that there was no significant difference in pharmacokinetic and metabolites profiles of healthy volunteers with fast or slow NAT2 acetylation phenotype3. We therefore hypothesize that the enzyme responsible to TETA acetylation is spermidine/spermine ...
Remodelin, a specific inhibitor of N-acetyltransferase NAT10, can ameliorate Hutchinson-Gilford Progeria Syndrom (HGPS) cellular phenotypes. Remodelin acts in a progerin- and FTI-independent pathway, by targeting and inhibiting NAT10. NAT10 is a protein with histone acetylation activity and primarily identified to be involved in regulation of telomerase activity. - Mechanism of Action & Protocol.
CP002160.PE153 Location/Qualifiers FT CDS 242742..243257 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Clocel_0156 FT /product=GCN5-related N-acetyltransferase FT /note=PFAM: GCN5-related N-acetyltransferase; KEGG: FT hor:Hore_00330 GCN5-related N-acetyltransferase FT /db_xref=EnsemblGenomes-Gn:Clocel_0156 FT /db_xref=EnsemblGenomes-Tr:ADL49944 FT /db_xref=GOA:D9SNS3 FT /db_xref=InterPro:IPR000182 FT /db_xref=InterPro:IPR016181 FT /db_xref=UniProtKB/TrEMBL:D9SNS3 FT /inference=protein motif:PFAM:PF00583 FT /protein_id=ADL49944.1 FT /translation=MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI FT MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG FT KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD FT LQMVCDVD MIKFQLLTKE NMAENALDNY DRLQNVRRVY RKIDSEYMLV EDVGIMDWSF ERKQAVAKAL 60 ISDDYITFGA IREDEIVGFA SIEKQLQGKY IVLDMMQVSR KYRGKGMGRT LFQLVKEKAK 120 EMGAKQLYIS ACASEETIEF YKSMGCKITD NPIKKIAEDE PFDLQMVCDV D 171 ...
B159 Background: Heterocyclic amines (HCA) are pro-carcinogens produced when meat is cooked in direct heat, such as flame-broiled (FB) food. The N-acetyltransferases (NAT) are enzymes involved in the activation of HCAs. Laboratory data suggest that aspirin may inhibit NAT activity. Methods: In a population based nested case-control study, we assessed the association between flame-broiled food, meat consumption and the risk of breast cancer and whether it varies by NAT2 genotype status or aspirin intake in 312 cases and 316 controls. Genotyping for rapid, intermediate and slow metabolizers of NAT2 was carried out on three NAT2 alleles. Odds ratios (OR) and 95% confidence intervals (CI) were estimated from logistic regression models. The median intake level among controls was used as the cut point for meat consumption. Results: Breast cancer risk was significantly elevated among women who ate FB food greater than twice a month compared to women who never ate FB (O.R. 1.74, 95% CI 1.04, 2.89). Meat ...
secret brazil on nat geo wild - has secret brazil news, listings, dvds, episode guides and more for secret brazil
Fullscreen (supported by IE11, latest versions of Firefox, Chrome, Safari (not including iOS Safari), Edge, Chrome for Android, Samsung Internet) ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Opens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More... ...
Isoniazid is a drug used for the treatment of both immediate and chronic tuberculosis. It is broken down by the liver through pathways including the NAT2 enzyme. NAT2 slow acetylators accumulate higher levels of isoniazid and are thereby at increased risk for liver damage. Promethease evaluates an individuals NAT2 phenotype based on genosets gs138, gs139 and gs140. ...
Im searching for places that carry one or two special enzymes of the melatonin biosynthetic pathway, (NAT) N-acetyltransferase or (HIOMT) hydroxylindole-O-methyltransferase. Please anyone with any information on where I can buy, borrow from someone in-house stock please contact me. Dr. Klosen any ideas on where I can get the above enzyme(s). Any help or info is greatly appreciated. regards Maria Mejia Smith-Kettlewell Eye Res. Inst. S.F.CA ...
Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC,; HMM-score: 19.3) ...
Synonyms for NAT traversal in Free Thesaurus. Antonyms for NAT traversal. 39 synonyms for stun: overcome, shock, amaze, confuse, astonish, stagger, bewilder, astound, overpower, confound, stupefy, strike (someone) dumb.... What are synonyms for NAT traversal?
Visit Healthgrades for information on Dr. Michael Hnat, DMD Find Phone & Address information, medical practice history, affiliated hospitals and more.
本文解释如何使用cable-modem dhcp-proxy nat命令。此命令主要功能将配置一个网络地址转换(NAT)地址池用Intrernet供应商的DHCP服务器供应的IP地址。
Originálny Mercedes svetlomet pravý alebo ľavý (požadovanú stranu prosíme uviesť do poznámky) - BI-XENON D1S + H7 + LED - Originálna značka BOSCH - vstavaný motorček pre nastavovanie výšky - s funkciou natáčania do zákruty - cena za kus vhodné pre: Mercedes C (W204) 1/2011-
|p|Nat Mur 30C homeopathic potency on 100mg Lactose/Sucrose tablets |/p| |p|30C is ideal for active or acute over the counter (OTC) use. 30C remedies should be taken as a short course only, unless prescribed by a practitioner.|/p| |p|ADULTS 2 tablets |/p|
Plasmid pGal4AD-CIBN from Dr. Chandra Tuckers lab contains the insert CIB1 (1-171aa) and is published in Nat Methods. 2010 Oct 31. ():. This plasmid is available through Addgene.
Plasmid moxVenus from Dr. Erik Snapps lab is published in Nat Commun. 2015 Jul 9;6:7670. doi: 10.1038/ncomms8670. This plasmid is available through Addgene.
March 2006). "Deciphering the Ancient and Complex Evolutionary History of Human Arylamine N-Acetyltransferase Genes". American ...
... the identification of novel inhibitors of arylamine N-acetyltransferases". Journal of the Royal Society, Interface. 7 (43): 335 ...
"Bacillus cereus strain 10-L-2 produces two arylamine N-acetyltransferases that transform 4-phenylenediamine into 4- ...
N-Acetyltransferase is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to arylamines and aromatic amines ... These studies claim that ABT is a more potent inhibitor of N-acetyltransferase 2 compared with N-acetyltransferase 1. Strong JM ... Procainamide is metabolized in the liver to acecainide by N-acetyltransferase, an enzyme that is genetically determined. ... Evans DA (1989). "N-acetyltransferase". Pharmacology & Therapeutics. 42 (2): 157-234. doi:10.1016/0163-7258(89)90036-3. PMID ...
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes ... Molecular cloning of a novel esterase involved in the metabolic activation of arylamine carcinogens with high sequence ... one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens GRCh38: Ensembl release 89: ...
... arylamine N-acetyltransferase EC choline O-acetyltransferase EC carnitine O-acetyltransferase EC ... D-tryptophan N-acetyltransferase EC glutamate N-acetyltransferase EC D-amino-acid N-acetyltransferase EC ... amino-acid N-acetyltransferase EC imidazole N-acetyltransferase EC glucosamine N-acetyltransferase EC ... glycine C-acetyltransferase EC serine O-acetyltransferase EC homoserine O-acetyltransferase EC ...
... and arylamine-N-acetyltransferase (TBNAT). Limited studies of the bioavailability of fucoxanthin in humans suggest that it is ...
... (NAT) is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to arylamines, ... Sinclair, J.C.; Sandy, J.; Delgoda, R.; Sim, E.; Noble, M.E. (2000). "Structure of arylamine N-acetyltransferase reveals a ... May 2008). "Arylamine N-acetyltransferases: Structural and functional implications of polymorphisms". Toxicology. 254 (3): 170- ... June 2008). "Identification of the Xenobiotic-Metabolizing Enzyme Arylamine N-Acetyltransferase 1 as a New Target of Cisplatin ...
... may refer to: Arylamine N-acetyltransferase Serotonin N-acetyltransferase This disambiguation page ... lists articles associated with the title Serotonin acetyltransferase. If an internal link led you here, you may wish to change ...
... (arylamine N-acetyltransferase), also known as NAT2, is an enzyme which in humans is encoded by the NAT2 ... "Entrez Gene: NAT2 N-acetyltransferase 2 (arylamine N-acetyltransferase)". "NAT2PRED: a computational predictor of the human N- ... A second arylamine N-acetyltransferase gene (NAT1) is located near NAT2. The NAT2 acetylator phenotype can be inferred from ... The Arylamine N-acetyltransferase Gene Nomenclature Committee homepage PDBe-KB provides an overview of all the structure ...
... (arylamine N-acetyltransferase) is a protein that in humans is encoded by the NAT1 gene. This gene is one ... "Entrez Gene: N-acetyltransferase 1 (arylamine N-acetyltransferase)". Retrieved 2012-01-27. Gubin AN, Njoroge JM, Bouffard GG, ... "Expression of arylamine N-acetyltransferases in pre-term placentas and in human pre-implantation embryos". Human Molecular ... of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat NAT2 genes. The ...
4-aminobiphenyl N-acetyltransferase, acetyl CoA-arylamine N-acetyltransferase, 2-naphthylamine N-acetyltransferase, arylamine ... arylamine N-acetyltransferase. Other names in common use include arylamine acetylase, beta-naphthylamine N-acetyltransferase, ... N-acetyltransferase, p-aminosalicylate N-acetyltransferase, serotonin acetyltransferase, and serotonin N-acetyltransferase. As ... an arylamine N-acetyltransferase (EC is an enzyme that catalyzes the chemical reaction acetyl-CoA + an arylamine ⇌ {\ ...
Voisin P, Namboodiri MA, Klein DC (1984). "Arylamine N-acetyltransferase and arylalkylamine N-acetyltransferase in the ... The N-acetyltransferase reaction has been suggested to be the rate-determining step, and thus Serotonin N-acetyltransferase has ... Aralkylamine N-acetyltransferase (AANAT) (EC, also known as arylalkylamine N-acetyltransferase or serotonin N- ... Aralkylamine N-acetyltransferase belongs to the GCN5-related N-acetyltransferase (GNAT) superfamily which consists 10,000 ...
Other names in common use include arylhydroxamate N,O-acetyltransferase, arylamine N-acetyltransferase, and N-hydroxy-2- ... O-acetyltransferase and arylamine N-acetyltransferase". J. Biochem. Tokyo. 99 (6): 1689-97. doi:10.1093/oxfordjournals.jbchem. ... In enzymology, a N-hydroxyarylamine O-acetyltransferase (EC is an enzyme that catalyzes the chemical reaction acetyl ... Saito K, Shinohara A, Kamataki T, Kato R (June 1986). "N-hydroxyarylamine O-acetyltransferase in hamster liver: identity with ...
... arylalkylamine n-acetyltransferase MeSH D08.811.913.050.313 - arylamine N-acetyltransferase MeSH D08.811.913.050.331 - atp ... acetyl-CoA C-acetyltransferase MeSH D08.811.913.050.134.105 - amino-acid n-acetyltransferase MeSH D08.811.913.050.134.150 - ... phosphate acetyltransferase MeSH D08.811.913.050.134.850 - serine O-acetyltransferase MeSH D08.811.913.050.170 - acyl-carrier ... acetyltransferases MeSH D08.811.913.050.134.029 - acyl-carrier protein s-acetyltransferase MeSH D08.811.913.050.134.060 - ...
The N-hydroxy aryl amine N-glucuronide conjugate is thought to be excreted from the liver and to build up in the bladder lumen ... O-Acetylation reactions are catalyzed by NAT, N-acetyltransferase; and UDP-glucuronosyltransferase (UGT) enzymes. Two different ... Exposure to this aryl-amine can happen through contact with chemical dyes and from inhalation of cigarette smoke. Researches ... of 4-aminobiphenyl and N-hydroxy-4-aminobiphenyl can be hydrolyzed by acidic urine to their corresponding arylamines, they can ...
Eyer, P. (1983). "The red cell as a sensitive target for activated toxic arylamines". Arch. Toxicol. Suppl. Archives of ... react directly with DNA or be bio-activated via sulfation or acetylation by cytosolic sulfotransferases or N-acetyltransferases ...
"Deciphering the Ancient and Complex Evolutionary History of Human Arylamine N-Acetyltransferase Genes". American Journal of ...
"Deciphering the Ancient and Complex Evolutionary History of Human Arylamine N-Acetyltransferase Genes". American Journal of ...
4-aminobiphenyl N-acetyltransferase, acetyl CoA-arylamine N-acetyltransferase, 2-naphthylamine N-acetyltransferase, arylamine ... arylamine N-acetyltransferase. Other names in common use include arylamine acetylase, beta-naphthylamine N-acetyltransferase, ... N-acetyltransferase, p-aminosalicylate N-acetyltransferase, serotonin acetyltransferase, and serotonin N-acetyltransferase. As ... an arylamine N-acetyltransferase (EC is an enzyme that catalyzes the chemical reaction acetyl-CoA + an arylamine ⇌ {\ ...
A second distinct arylamine N-acetyltransferase isozyme, arylamine N-acetyltransferase type 2, is encoded at the multi-allelic ... of the activity of arylamine N-acetyltransferase type 1 in blood cells. Arylamine N-acetyltransferase type 1 activity in ... Arylamine N-acetyltransferase in erythrocytes of cystic fibrosis patients.. Risch A1, Smelt V, Lane D, Stanley L, van der Slot ... Arylamine N-acetyltransferase type 1 is expressed in erythrocytes and leucocytes and the activity in erythrocytes is shown to ...
Naegleria gruberi nat1 gene for arylamine N-acetyltransferase 1, strain... TPA_inf: Naegleria gruberi nat1 gene for arylamine N ... TPA_inf: Naegleria gruberi nat1 gene for arylamine N-acetyltransferase 1, strain NEG-M, exon 1. GenBank: BN001457.1 ... acetyltransferase 1, strain NEG-M, exon 1. gi,300431652,tpe,BN001457.1, ...
Exopolysaccharide (EPS) adhesins are important determinants of bacterial surface colonization and biofilm formation. Biofilms are a major cause of chronic infections and are responsible for biofouling on water-exposed surfaces. To tackle these problems, it is essential to dissect the processes leading to surface colonization at the molecular and cellular levels. Here we describe a novel c-di-GMP effector, HfsK, that contributes to the... ...
Polymorphic arylamine N-acetyltransferase. Gene Name. NAT2. Organism. Humans. Amino acid sequence. ,lcl,BSEQ0006940,Arylamine N ... Arylamine n-acetyltransferase activity. Specific Function. Participates in the detoxification of a plethora of hydrazine and ... Grant DM, Blum M, Demierre A, Meyer UA: Nucleotide sequence of an intronless gene for a human arylamine N-acetyltransferase ... Grant DM, Lottspeich F, Meyer UA: Evidence for two closely related isozymes of arylamine N-acetyltransferase in human liver. ...
... arylamine N-acetyltransferase) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, ... Transient overexpression lysate of N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 1 ... Your search returned 17 N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules across 5 suppliers. ... N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules. N-acetyltransferase 1 (arylamine N-acetyltransferase) ...
... mouse arylamine N-acetyltransferase type 2 ( Nat2), is expressed during embryogenesis from the blastocyst stage and in the ... 2006) Structure and mechanism of arylamine N-acetyltransferases. Curr Top Med Chem 6:1641-1654PubMedCrossRefGoogle Scholar ... 2000) Expression of arylamine N-acetyltransferases in pre-term placentas and in human pre-implantation embryos. Hum Mol Genet 9 ... Matas N, Thygesen P, Stacey M, Risch A, Sim E (1997) Mapping AAC1, AAC2 and AACP, the genes for arylamine N-acetyltransferases ...
Furthermore, two ,i,N,/i,-acetyltransferase isozymes (,i,NATs,/i,), ,i,NAT1,/i, and ,i,NAT2,/i,, are polymorphic and catalyze ... acetyltransferase isozymes (,i,NAT1,/i, and ,i,NAT2,/i,) in order to summarize and analyze findings from the literature related ... 3. Arylamine N-Acetyltransferases (NATs). NAT1 and NAT2 human isoforms are encoded by two genes with intronic less coding ... E. Sim, K. Walters, and S. Boukouvala, "Arylamine N-acetyltransferases: from structure to function," Drug Metabolism Reviews, ...
... and humans can be categorized as either fast or slow acetylators according to their ability to N-acetylate certain arylamine ... catalyses the N-acetylation of primary arylamine and hydrazine drugs and chemicals. N-Acetylation is subject to polymorphism, ... Arylamine N-acetyltransferase (NAT2) catalyses the N-acetylation of primary arylamine and hydrazine drugs and chemicals. N- ... Data show that the apparent Km of the slow variant NAT2 7B for the arylamine sulphamethazine was 10-fold lower than all the ...
Human arylamine N-acetyltransferase (NAT) is known to exist as two isoenzymes, NAT1 and NAT2, with different though overlapping ... Genotyping human arylamine N-acetyltransferase type 1 (NAT1): the identification of two novel allelic variants Biochem ... Human arylamine N-acetyltransferase (NAT) is known to exist as two isoenzymes, NAT1 and NAT2, with different though overlapping ...
Edith Sim on Arylamine N-acetyltransferases 3, part of a collection of multimedia lectures. ... Arylamine N-acetyltransferases. Part 3 Im Edith Sim, and I have been working on these enzymes for over 20 years. ... Sim, E. (2016, July 28). Arylamine N-acetyltransferases 3 [Video file]. In The Biomedical & Life Sciences Collection, Henry ... Arylamine N-acetyltransferases 3. Part 3 of 3 *Part 1 of 3 ... Arylamine N-acetyltransferases (recap). *Nat in fungi ...
Background-ArylamineN-acetyltransferases in humans (NAT1 and NAT2) catalyse the acetylation of arylamines including food ... derived heterocyclic arylamine carcinogens. Other substrates include the sulphonamide 5-aminosalicylic acid (5-ASA), which is ...
Arylamine N-acetyltransferases metabolise a range of hydrazines and arylamines (see Weber and Hein1 for review). The arylamine ... Background-ArylamineN-acetyltransferases in humans (NAT1 and NAT2) catalyse the acetylation of arylamines including food ... 1996) Immunochemical detection of arylamine N-acetyltransferase in normal and neoplastic bladder. J Histochem Cytochem 44:1059- ... Arylamine N-acetyltransferase activities in human liver and intestine. 8th Japanese-American Conference on Pharmacokinetics and ...
Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development. Neville J. Butcher and Rodney F. Minchin ... Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development. Neville J. Butcher and Rodney F. Minchin ... Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development. Neville J. Butcher and Rodney F. Minchin ... Arylamine N-Acetyltransferase 1: A Novel Drug Target in Cancer Development Message Subject (Your Name) has forwarded a page to ...
Arylamine N-acetyltransferases (NATs; EC catalyze both the N-acetylation and O-acetylation of arylamines and N- ... The human genome contains two functional arylamine N-acetyltransferase loci, NAT1 and NAT2, coding for arylamine N- ... Identification and Characterization of Functional Rat Arylamine N-Acetyltransferase 3: Comparisons with Rat Arylamine N- ... Identification and Characterization of Functional Rat Arylamine N-Acetyltransferase 3: Comparisons with Rat Arylamine N- ...
Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ... Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ... Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ... Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of ...
arylamine N-acetyltransferase-1. bp. base pairs. TSA. trichostatin A. HDAC. histone deacetylase. DMSO. dimethyl sulfoxide. PBS ... Arylamine N-acetyltransferase-1 (NAT1) has been associated with disorders involving folate metabolism, such as spina bifida, as ... Histone Deacetylase Inhibitors Increase Human Arylamine N-Acetyltransferase-1 Expression in Human Tumor Cells. Scott Paterson, ... Histone Deacetylase Inhibitors Increase Human Arylamine N-Acetyltransferase-1 Expression in Human Tumor Cells. Scott Paterson, ...
1290 that was significantly down-regulated in luminal A tumors and its potential target arylamine N-acetyltransferase 1 (NAT1 ... We also found 4 potential target genes (FOXA1, arylamine N-acetyltransferase 1 (NAT1), BCL2 and MAPT) of miR-1290 [6]. ... Arylamine N-acetyltransferases (NATs) are present in many species. NATs are cytosolic conjugating enzymes which transfer an ... Wakefield L, Robinson J, Long H, Ibbitt JC, Cooke S, Hurst HC, Sim E: Arylamine N-acetyltransferase 1 expression in breast ...
Levels of N-acetyltransferase activity differed significantly between the strains for many arylamine substrates, with highest ... However, for some other arylamine substrates, levels of N-acetyltransferase activity did not differ significantly between the ... Acetylator phenotype-dependent and -independent expression of arylamine N-acetyltransferase isozymes in rapid and slow ... Acetylator phenotype-dependent and -independent expression of arylamine N-acetyltransferase isozymes in rapid and slow ...
Arylamine N-acetyltransferases (EC (NATs) catalyse the biotransformation of many primary arylamines, hydrazines and ... Abbreviations used: Ac-CoA, acetyl-CoA; NAT, arylamine N-acetyltransferase; StNAT, Salmonella typhimurium NAT; r.m.s.d., root- ... Homology modelling and structural analysis of human arylamine N-acetyltransferase NAT1: evidence for the conservation of a ... Homology modelling and structural analysis of human arylamine N-acetyltransferase NAT1: evidence for the conservation of a ...
Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several ... Participates in the detoxification of a plethora of hydrazine and arylamine drugs. ... EC=, Arylamide acetylase 1, N-acetyltransferase type 1, Monomorphic arylamine N-acetyltransferase. ... NAT1, Recombinant, Human, aa1-290, His-tag (Arylamine N-acetyltransferase 1, AAC1, MNAT, NAT-1, NATI ...
The human arylamine N-acetyltransferase 1 (NAT1) is critical in determining the duration of action and pharmacokinetics of ... Effects of nucleotide variation on the structure and function of human arylamine n-acetyltransferase 1. ...
... catalyse acetylation reactions which can result in either detoxification or activation of arylamine carcinogens. The human NAT ... Arylamine N-acetyltransferases (NATs) catalyse acetylation reactions which can result in either detoxification or activation of ... Chromosome mapping of the genes for murine arylamine N-acetyltransferases (NATs), enzymes involved in the metabolism of ... Chromosome mapping of the genes for murine arylamine N-acetyltransferases (NATs), enzymes involved in the metabolism of ...
Probing the Mechanism of Hamster Arylamine N -Acetyltransferase 2 Acetylation by Active Site Modification, Site-Directed ...
Arylamine N-acetyltransferase is a protein involved in the metabolism of many different molecules that enter the body. The ... Arylamine N-acetyltransferase, birth defects, cancer, carcinogens, DNA, drug effects, gene, gene variants, genomics, isoniazid ... Arylamine N-acetyltransferases: a pharmacogenomic approach to drug metabolism and endogenous function. Biochemical Society ... Regulation of the activity of the human drug metabolizing enzyme arylamine N-acetyltransferase 1: role of genetic and non ...
Mapping AAC1, AAC2 and AACP, the genes for arylamine N-acetyltransferases, carcinogen metabolising enzymes on human chromosome ... Matas, N, Thygesen, P, Stacey, M, Risch, A and Sim, Edith (1997) Mapping AAC1, AAC2 and AACP, the genes for arylamine N- ... acetyltransferases, carcinogen metabolising enzymes on human chromosome 8p22, a region frequently deleted in tumours. ...
Arylamine N-acetyltransferase 2 polymorphisms and the risk of endometriosis Authors Barra, Fabio. Affiliation. University of ... Citation: Fabio Barra , Arylamine N-acetyltransferase 2 polymorphisms and the risk of endometriosis, Avicenna J. Med. ...
Guo, Z., Vath, G. M., Wagner, C. R., & Hanna, P. E. (2003). Arylamine N-Acetyltransferases: Covalent Modification and ... Guo, Z, Vath, GM, Wagner, CR & Hanna, PE 2003, Arylamine N-Acetyltransferases: Covalent Modification and Inactivation of ... Guo, Zhijun ; Vath, Gregory M. ; Wagner, Carston R ; Hanna, Patrick E. / Arylamine N-Acetyltransferases : Covalent Modification ... T1 - Arylamine N-Acetyltransferases. T2 - Covalent Modification and Inactivation of Hamster NAT1 by Bromoacetamido Derivatives ...
Brooke, E. W. (2003). Protein-ligand interactions of arylamine N-acetyltransferase from Mycobacterium smegmatis [PhD thesis]. ... Brooke, Edward W. Protein-Ligand Interactions of Arylamine N-Acetyltransferase from Mycobacterium Smegmatis. University of ... "Protein-Ligand Interactions of Arylamine N-Acetyltransferase from Mycobacterium Smegmatis." PhD thesis, University of Oxford. ... Recombinant arylamine N-acetyltransferase (NAT) of Mycobacterium tuberculosis N-acetylates INH using the cofactor Acetyl ...
Arylamine N-acetyltransferase 1 (NAT1) genotypes in a Lebanese population. Dhaini, Hassan R.; Levy, Gerald N. ...
  • A second distinct arylamine N-acetyltransferase isozyme, arylamine N-acetyltransferase type 2, is encoded at the multi-allelic NAT2 locus. (
  • There was no correlation between erythrocyte arylamine N-acetyltransferase-1 activity and NAT2 alleles present in either the cystic fibrosis or control groups. (
  • The increased clearance of sulphamethoxazole in cystic fibrosis patients appears unlikely to be due to erythrocyte arylamine N-acetyltransferase type 1 activity or to inheritance of alleles at either the NAT1 or NAT2 loci. (
  • Ferguson RJ, Doll MA, Rustan TD, Gray K, Hein DW: Cloning, expression, and functional characterization of two mutant (NAT2(191) and NAT2(341/803)) and wild-type human polymorphic N-acetyltransferase (NAT2) alleles. (
  • The xenobiotic metabolizing enzyme, mouse arylamine N -acetyltransferase type 2 ( Nat2 ), is expressed during embryogenesis from the blastocyst stage and in the developing neural tube and eye. (
  • 2000) Chromosome mapping of the genes for murine arylamine N -acetyltransferases (NATs), enzymes involved in the metabolism of carcinogens: identification of a novel upstream noncoding exon for murine Nat2. (
  • Furthermore, two N -acetyltransferase isozymes ( NATs ), NAT1 and NAT2 , are polymorphic and catalyze both N -acetylation and O -acetylation of aromatic and heterocyclic amine carcinogens. (
  • CYP1A1, CYP1B1, CYP2D6, and CYP2E1 ) and N- acetyltransferase ( NAT1 and NAT2 ) enzymes involved in the biotransformation of the carcinogenic constituents of tobacco have been shown to be the risk factors involved in HNSCC [ 20 - 23 ]. (
  • Arylamine N-acetyltransferase (NAT2) catalyses the N-acetylation of primary arylamine and hydrazine drugs and chemicals. (
  • Data show that the apparent Km of the slow variant NAT2 7B for the arylamine sulphamethazine was 10-fold lower than all the other allotypes. (
  • Background -Arylamine N -acetyltransferases in humans (NAT1 and NAT2) catalyse the acetylation of arylamines including food derived heterocyclic arylamine carcinogens. (
  • There are two closely related genes on chromosome 8 that encode the two human arylamine N -acetyltransferases-NAT1 and NAT2. (
  • Humans possess two functional N -acetyltransferase genes, NAT1 and NAT2 , as well as a nonfunctional pseudogene, NATP . (
  • The relative affinities of arylamine carcinogens such as 4-aminobiphenyl, N -hydroxy-4-aminobiphenyl, and 2-aminofluorene for N - and O -acetylation via recombinant rat Nat3 were comparable with recombinant rat Nat1 and higher than for recombinant rat Nat2. (
  • Rat Nat2 and human NAT1 amino acid sequences both contain Phe125, Arg127, Tyr129, which is predictive of their similar arylamine substrate selectivities. (
  • Conversely, the human NAT2 protein contains Ser125, Ser127, Ser129, and the rat Nat1 protein contains Tyr125, Ser127, Tyr129, which is predictive of a weaker correlation between rat Nat1 and human NAT2 arylamine substrate selectivities. (
  • The genes NAT1 and NAT2 provide instructions for making the two main arylamine N-acetyltransferases, called NAT1 and NAT2. (
  • The mouse has three arylamine N -acetyltransferase genes, (MOUSE)Nat1 , (MOUSE)Nat2 and (MOUSE)Nat3 . (
  • To determine whether the (MOUSE)NAT1 and (HUMAN)NAT2 enzymes are functionally equivalent, we expressed and purified (MOUSE)NAT1*1 and analysed its substrate specificity using a panel of arylamines and hydrazines. (
  • All three exhibited diminished activity towards "(MOUSE)NAT2-specific" arylamines but were more active against hydrazines than (MOUSE)NAT1*1. (
  • From arylamine N-acetyltransferase to folate-dependent acetyl CoA hydrolase: impact of folic acid on the activity of (HUMAN)NAT1 and its homologue (MOUSE)NAT2. (
  • As part of a project on environmental disasters in minority populations, this study aimed to evaluate differences in the sequence of N-acetyltransferase 2 ( NAT2 ) as a metabolic susceptibility gene in yet unexplored ethnicities. (
  • Arylamine N -acetyltransferase 2 (NAT2) catalyzes the addition of an acetyl group from acetyl-CoA to a terminal nitrogen on substrates ( 1 ). (
  • N -Acetyltransferases 1 and 2 (NAT1 and NAT2), both being highly polymorphic, are involved in the metabolism of aromatic and heterocyclic aromatic amines present in cigarette smoke and red meat cooked by high-temperature cooking techniques. (
  • The phase II metabolizing enzymes N -acetyltransferases 1 and 2 (NAT1 and NAT2), both being expressed in colorectal tissue ( 5 , 6 ), catalyze N- and O-acetylation of several xenobiotics, such as heterocyclic aromatic amines and aromatic amines, which may entail detoxification or activation of the substrate ( 7 ). (
  • A second polymorphic arylamine N-acetyltransferase gene (NAT1), is located near this gene (NAT2). (
  • NAT2 (N-Acetyltransferase 2) is a Protein Coding gene. (
  • NAT2 acetylates arylamine and hydrazine drugs and carcinogens, but predicted acetylator NAT2 phenotypes were not associated with insulin sensitivity. (
  • This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome and is orthologous to the mouse and rat Nat2 genes. (
  • rs1041983 , also known as C282T, is a SNP in the NAT2 gene, potentially encoding a variant detoxifying protein known as an N-acetyltransferase, but which NAT2 variant depends on which other NAT2 SNPs were also inherited. (
  • Genetic variation in N-acetyltransferase 1 (NAT1) and 2 (NAT2) and risk of non-Hodgkin lymphoma. (
  • rs1799931 is a SNP in the NAT2 gene, potentially encoding a variant detoxifying protein known as an N-acetyltransferase, but which NAT2 variant depends on which other NAT2 SNPs were also inherited. (
  • The NAT2 functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. (
  • The concentration of isoniazid in human serum declines due to metabolism by arylamine N -acetyltransferase-2 (NAT2). (
  • Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens. (
  • The arylamine substrates include environmental carcinogens found in the rubber and dye industry (see Sim et al 2 for review) and cigarette smoke. (
  • A number of human epidemiological investigations suggest a relationship between acetylator phenotype and the incidence and/or severity of tumors caused by exposure to arylamine carcinogens. (
  • Arylamine N-acetyltransferases (NATs) catalyse acetylation reactions which can result in either detoxification or activation of arylamine carcinogens. (
  • Human arylamine N-acetyltransferase 1 (NAT1) is a polymorphic ubiquitous phase II xenobiotic metabolizing enzyme that catalyzes the biotransformation of primary aromatic amine or hydrazine drugs and carcinogens. (
  • This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. (
  • Carbon black nanoparticles impair acetylation of aromatic amine carcinogens through inactivation of arylamine N-acetyltransferase enzymes. (
  • In order to describe the genetic predisposition to this disorder, NAT genes were analyzed with special interest since they codify for N-acetyltransferases, the enzymes responsible for the biotransformation of arylamines, hydrazine drugs and a great number of toxins and carcinogens present in diet, cigarette smoke and the environment. (
  • Grant DM, Blum M, Demierre A, Meyer UA: Nucleotide sequence of an intronless gene for a human arylamine N-acetyltransferase related to polymorphic drug acetylation. (
  • N-Acetylation is subject to polymorphism, and humans can be categorized as either fast or slow acetylators according to their ability to N-acetylate certain arylamine substrates in vivo. (
  • Arylamine N-acetyltransferases (NAT) are xenobiotic-metabolizing enzymes responsible for N-acetylation of many arylamines. (
  • EC catalyze both the N -acetylation and O -acetylation of arylamines and N -hydroxyarylamines. (
  • EC catalyze acetyl group transfer from acetyl-coenzyme A, or another acetyl donor, to the exocyclic amine of arylamines ( N -acetylation) or the hydroxyl oxygen of N -hydroxylated arylamines ( O -acetylation) ( Hein, 1988 ). (
  • N -Acetyltransferases can bioactivate ( O -acetylation) or deactivate ( N -acetylation) arylamine procarcinogens such as 4-aminobiphenyl, a component of cigarette smoke ( Patrianakos and Hoffman, 1979 ). (
  • Acetylator genotype-dependent N-acetylation for a number of arylamines also was observed in liver, colon, kidney and urinary bladder cytosols derived from the congenic hamster lines, including arylamines highly carcinogenic to hamster colon and urinary bladders. (
  • Although mouse, hamster, and rabbit models of the human N-acetylation polymorphism have been identified and characterized, many investigations of arylamine toxicity and carcinogenicity are carried out in the rat, particularly the Fischer 344 (F-344) inbred rat. (
  • We partially characterized a new rat model of the N-acetylation polymorphism by determining expression of arylamine N-acetyltransferase activities in liver cytosols derived from adult male inbred F-344, WKY, and their F1 hybrid rat strains. (
  • The identification of acetylator phenotype-dependent and -independent hepatic N-acetyltransferase isozymes in the inbred rat mimics the biochemical basis for acetylator phenotype-dependent and -independent expressions of N-acetylation in humans and other mammalian species. (
  • Acetyl Coenzyme A-dependent N-, O- and N,O-acetylation of aromatic amines and hydrazines by arylamine N-acetyltransferases is well characterised. (
  • Arylamine N-acetyltransferases (NAT) are XME responsible for the acetylation of many arylamine and heterocyclic amines. (
  • This heterogeneity in N-acetyltransferase enzyme activation is called acetylation polymorphism and is one of the most common hereditary variations that affect xenobiotic metabolism. (
  • Arylamine N -acetyltransferases (EC (NATs) catalyse the biotransformation of many primary arylamines, hydrazines and their N-hydroxylated metabolites, thereby playing an important role in both the detoxification and metabolic activation of numerous xenobiotics. (
  • Enzymes involved in Phase II include the N-acetyltransferases (NATs), Glutathione S-Transferases (GSTs), UDP Glucuronosyltransferases, epoxide hydrolases and methyltransferases. (
  • Ebisawa T, Deguchi T: Structure and restriction fragment length polymorphism of genes for human liver arylamine N-acetyltransferases. (
  • In this study, we identified and characterized a third rat N -acetyltransferase gene ( Nat3 ) consisting of a single open reading frame of 870 base pairs encoding a 290-amino acid protein, analogous to the previously identified human and rat N -acetyltransferase genes. (
  • Deciphering the ancient and complex evolutionary history of human arylamine N-acetyltransferase genes. (
  • Se consideran de especial interés los genes NAT que codifican para las N-acetiltransferasas, enzimas responsables de la biotransformación de arilaminas, fármacos de hidrazina, y de un gran número de toxinas y carcinógenos presentes en la dieta, el humo de cigarro y el medio ambiente. (
  • In enzymology, an arylamine N-acetyltransferase (EC is an enzyme that catalyzes the chemical reaction acetyl-CoA + an arylamine ⇌ {\displaystyle \rightleftharpoons } CoA + an N-acetylarylamine Thus, the two substrates of this enzyme are acetyl-CoA and arylamine, whereas its two products are CoA and N-acetylarylamine. (
  • The systematic name of this enzyme class is acetyl-CoA:arylamine N-acetyltransferase. (
  • Atmane N, Dairou J, Paul A, Dupret JM, Rodrigues-Lima F (2003) Redox regulation of the human xenobiotic metabolizing enzyme arylamine N -acetyltransferase 1 (NAT1). (
  • A naphthoquinone inhibitor of human arylamine N-acetyltransferase 1 (hNAT1), a potential cancer biomarker and therapeutic target, has been reported which undergoes a distinctive concomitant color change from red to blue upon binding to the enzyme. (
  • N-acetyltransferase (NAT) is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to arylamines, arylhydroxylamines and arylhydrazines. (
  • The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. (
  • The structure of arylamine N-acetyltransferase from Mycobacterium smegmatis--an enzyme which inactivates the anti-tubercular drug, isoniazid. (
  • no acetyl Coenzyme A hydrolysis was found when murine arylamine N-acetyltransferase Type 1 or recombinant bacterial arylamine N-acetyltransferases were incubated with folate. (
  • These data, together with the characterisation of a naphthoquinone inhibitor of folate-dependent acetyl Coenzyme A hydrolysis by human arylamine N-acetyltransferase Type 1/murine arylamine N-acetyltransferase Type 2, open up a range of future avenues of exploration, both for elucidating the developmental role of these enzymes and for improving chemotherapeutic approaches to pathological conditions including estrogen receptor-positive breast cancer. (
  • Design, synthesis and structure-activity relationships of 3,5-diaryl-1H-pyrazoles as inhibitors of arylamine N-acetyltransferase. (
  • The human arylamine N -acetyltransferases first attracted attention because of their role in drug metabolism. (
  • Arylamine N -acetyltransferase-1 (NAT1) has been associated with disorders involving folate metabolism, such as spina bifida, as well as numerous human cancers. (
  • Arylamine N-acetyltransferase is a protein involved in the metabolism of many different molecules that enter the body. (
  • The evidence presented in this paper adds to our growing understanding of the endogenous roles of human arylamine N-acetyltransferase Type 1 and its mouse homologue and expands the catalytic repertoire of these enzymes, demonstrating that they are by no means just xenobiotic metabolising enzymes but probably also play an important role in cellular metabolism. (
  • N-acetyltransferases are cytosolic enzymes found in the liver and many tissues of most mammalian species, except the dog and fox, which cannot acetylate xenobiotics.Acetyl groups are important in the conjugation of metabolites from the liver, to allow excretion of the byproducts (phase II metabolism). (
  • This study is the first to report a third arylamine N -acetyltransferase isozyme with significant functional capacity. (
  • The levels of N-acetyltransferase activity of one isozyme differed significantly between strains analogous to the pattern observed in crude cytosol. (
  • In contrast, the levels of N-acetyltransferase activity of the second isozyme did not differ between the strains. (
  • Dairou J, Malecaze F, Dupret JM, Rodrigues-Lima F (2005) The xenobiotic-metabolizing enzymes arylamine N -acetyltransferases in human lens epithelial cells: inactivation by cellular oxidants and UVB-induced oxidative stress. (
  • [ 1 ] are drug metabolising enzymes which catalyse the conjugation of an acetyl group from acetyl Coenzyme A (AcCoA) to arylamines, hydrazines and N- hydroxyarylamines. (
  • Here, we describe experiments demonstrating that human arylamine N-acetyltransferase Type 1 and its murine homologue (Type 2) can also catalyse the direct hydrolysis of acetyl Coenzyme A in the presence of folate. (
  • Furthermore, in silico docking of folate within the active site of human arylamine N-acetyltransferase Type 1 suggests that folate may bind at the enzyme's active site, and facilitate acetyl Coenzyme A hydrolysis. (
  • They have wide specificity for aromatic amines, particularly serotonin, and can also catalyze acetyl transfer between arylamines without CoA. (
  • Sheep tissue acetyl coenzyme A-dependent arylamine N-acetyltransferases. (
  • Arylamine N -acetyltransferases metabolise a range of hydrazines and arylamines (see Weber and Hein 1 for review). (
  • All individuals from the cystic fibrosis and control groups were investigated for certain allelic variants of the arylamine N-acetyltransferase type 1 gene (NAT1). (
  • Notable examples include nerve damage among individuals homozygous for some variants of the N-acetyltransferase 2 gene ("slow acetylators") given isoniazid as an antituberculosis therapy, hemolytic anemia among glucose 6-phosphate dehydrogenase-deficient patients given aminoquinoline antimalarial drugs, and varied rates of biotransformation of debrisoquine, an antihypertensive drug, due to genetic variation at the CYP2D6 locus. (
  • Ohsako S, Deguchi T: Cloning and expression of cDNAs for polymorphic and monomorphic arylamine N-acetyltransferases from human liver. (
  • Polymorphic and monomorphic expression of arylamine carcinogen N-acetyltransferase isozymes in tumor target organ cytosols of Syrian hamsters congenic at the polymorphic acetyltransferase locus. (
  • We report the expression of acetylator genotype-dependent (polymorphic) and acetylator genotype-independent (monomorphic) N-acetyltransferase isozymes in hepatic cytosols. (
  • Vatsis KP, Martell KJ, Weber WW: Diverse point mutations in the human gene for polymorphic N-acetyltransferase. (
  • Abe M, Deguchi T, Suzuki T: The structure and characteristics of a fourth allele of polymorphic N-acetyltransferase gene found in the Japanese population. (
  • Structure/function evaluations of single nucleotide polymorphisms in human N-acetyltransferase 2. (
  • Since single-nucleotide polymorphisms of the N -acetyltransferase-2 gene lead to two different clearances of isoniazid from serum in patients, we simulated the isoniazid concentration-time profiles encountered in both slow and fast acetylators. (
  • The molecular design flexibility of polybenzoxazines has been demonstrated such as in a synthesis of a series of benzoxazine resins with varied arylamine groups [6]. (
  • Genetic polymorphisms of arylamine N-acetyltransferases 1 and 2 and the likelihood of developing pediatric acute lymphoblastic leukemia. (
  • The purpose of the present study was to assess the utility of this congenic hamster model for investigations into the relationship between acetylator genotype and arylamine carcinogenesis. (
  • It is concluded that the congenic hamster model will be useful in studies to delineate the role of acetylator genotype in the incidence or severity of arylamine tumors. (
  • Acetylator phenotype-dependent and -independent expression of arylamine N-acetyltransferase isozymes in rapid and slow acetylator inbred rat liver. (
  • The slow acetylator phenotype is caused by decreased or absent arylamine N-acetyltransferase in human liver. (
  • Deguchi T: Sequences and expression of alleles of polymorphic arylamine N-acetyltransferase of human liver. (
  • Further insight into N -acetyltransferase function, expression, and regulation may predict individual incidences of pharmaceutical drug toxicities or individual tissue-specific cancer susceptibilities associated with environmental and/or occupational arylamine procarcinogen exposures. (
  • Berberine inhibited arylamine N-acetyltransferase activity and gene expression and DNA adduct formation in human malignant astrocytoma (G9T/VGH) and brain glioblastoma multiforms (GBM 8401) cells. (
  • Grant DM, Lottspeich F, Meyer UA: Evidence for two closely related isozymes of arylamine N-acetyltransferase in human liver. (
  • Effects of (-)-menthol on arylamine N-acetyltransferase activity in human liver tumor cells. (
  • Sulphamethoxazole, a substrate of human arylamine N-acetyltransferase, is used in the treatment of cystic fibrosis patients, who metabolise the drug rapidly. (
  • Pharmacogenetics, Regulation and Structural Properties of the Drugmetabolizing Enzymes Arylamine N-acetyltransferases. (
  • Metabolic activation of N-hydroxy arylamines and N-hydroxy heterocyclic amines by human sulfotransferase(s). (
  • Structure-activity relationships and colorimetric properties of specific probes for the putative cancer biomarker human arylamine N-acetyltransferase 1. (
  • Although there is a variation in erythrocyte arylamine N-acetyltransferase type 1 activity within each group, no difference was found when the two groups were compared. (
  • Association of the diplotype configuration at the N-acetyltransferase 2 gene with adverse events with co-trimoxazole in Japanese patients with systemic lupus erythematosus. (
  • The human arylamine N-acetyltransferase 1 (NAT1) is critical in determining the duration of action and pharmacokinetics of amine-containing drugs such as para-aminosalicylic acid and para-aminobenzoyl glutamate used in clinical therapy of tuberculosis (TB), as well as influencing the balance between detoxification and metabolic activation of these drugs. (
  • Gene Ontology (GO) annotations related to this gene include acetyltransferase activity and arylamine N-acetyltransferase activity . (
  • In a previous study, we found that microRNA (miR)-1290 that was significantly down-regulated in luminal A tumors and its potential target arylamine N-acetyltransferase 1 (NAT1) . (