An acetyltransferase with specificity towards the amine group of aromatic alkylamines (arylalkylamines) such as SEROTONIN. This enzyme is also referred to as serotonin acetylase despite the fact that serotonin acetylation can also occur through the action of broad specificity acetyltransferases such as ARYLAMINE N-ACETYLTRANSFERASE.
A light-sensitive neuroendocrine organ attached to the roof of the THIRD VENTRICLE of the brain. The pineal gland secretes MELATONIN, other BIOGENIC AMINES and NEUROPEPTIDES.
An enzyme that catalyzes the transfer of acetyl groups from ACETYL-COA to arylamines. It can also catalyze acetyl transfer between arylamines without COENZYME A and has a wide specificity for aromatic amines, including SEROTONIN. However, arylamine N-acetyltransferase should not be confused with the enzyme ARYLALKYLAMINE N-ACETYLTRANSFERASE which is also referred to as SEROTONIN ACETYLTRANSFERASE.
A biogenic amine that is found in animals and plants. In mammals, melatonin is produced by the PINEAL GLAND. Its secretion increases in darkness and decreases during exposure to light. Melatonin is implicated in the regulation of SLEEP, mood, and REPRODUCTION. Melatonin is also an effective antioxidant.
An enzyme that catalyzes the transfer of a methyl group from S-adenosylmethionine to N-acetylserotonin to form N-acetyl-5-methoxytryptamine (MELATONIN).
Decarboxylated monoamine derivatives of TRYPTOPHAN.
Enzymes catalyzing the transfer of an acetyl group, usually from acetyl coenzyme A, to another compound. EC 2.3.1.
The regular recurrence, in cycles of about 24 hours, of biological processes or activities, such as sensitivity to drugs and stimuli, hormone secretion, sleeping, and feeding.
Enzymes that catalyze acyl group transfer from ACETYL-CoA to HISTONES forming CoA and acetyl-histones.
An enzyme that catalyzes the formation of acetylcholine from acetyl-CoA and choline. EC 2.3.1.6.
An enzyme that catalyzes the acetylation of chloramphenicol to yield chloramphenicol 3-acetate. Since chloramphenicol 3-acetate does not bind to bacterial ribosomes and is not an inhibitor of peptidyltransferase, the enzyme is responsible for the naturally occurring chloramphenicol resistance in bacteria. The enzyme, for which variants are known, is found in both gram-negative and gram-positive bacteria. EC 2.3.1.28.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
The ten-layered nervous tissue membrane of the eye. It is continuous with the OPTIC NERVE and receives images of external objects and transmits visual impulses to the brain. Its outer surface is in contact with the CHOROID and the inner surface with the VITREOUS BODY. The outer-most layer is pigmented, whereas the inner nine layers are transparent.
Any of the ruminant mammals with curved horns in the genus Ovis, family Bovidae. They possess lachrymal grooves and interdigital glands, which are absent in GOATS.
Formation of an acetyl derivative. (Stedman, 25th ed)
A family of histone acetyltransferases that is structurally-related to CREB-BINDING PROTEIN and to E1A-ASSOCIATED P300 PROTEIN. They function as transcriptional coactivators by bridging between DNA-binding TRANSCRIPTION FACTORS and the basal transcription machinery. They also modify transcription factors and CHROMATIN through ACETYLATION.
An enzyme that catalyzes the formation of O-acetylcarnitine from acetyl-CoA plus carnitine. EC 2.3.1.7.
The rate dynamics in chemical or physical systems.

Substrate specificity and inhibition studies of human serotonin N-acetyltransferase. (1/63)

Arylalkylamine N-acetyltransferase (AANAT) catalyzes the reaction of serotonin with acetyl-CoA to form N-acetylserotonin and plays a major role in the regulation of the melatonin circadian rhythm in vertebrates. In the present study, the human cloned enzyme has been expressed in bacteria, purified, cleaved, and characterized. The specificity of the human enzyme toward substrates (natural as well as synthetic arylethylamines) and cosubstrates (essentially acyl homologs of acetyl-CoA) has been investigated. Peptide combinatorial libraries of tri-, tetra-, and pentapeptides with various amino acid compositions were also screened as potential sources of inhibitors. We report the findings of several peptides with low micromolar inhibitory potency. For activity measurement as well as for specificity studies, an original and rapid method of analysis was developed. The assay was based on the separation and detection of N-[(3)H]acetylarylethylamine formed from various arylethylamines and tritiated acetyl-CoA, by means of high performance liquid chromatography with radiochemical detection. The assay proved to be robust and flexible, could accommodate the use of numerous synthetic substrates, and was successfully used throughout this study. We also screened a large number of pharmacological bioamines among which only one, tranylcypromine, behaved as a substrate. The synthesis and survey of simple arylethylamines also showed that AANAT has a large recognition pattern, including compounds as different as phenyl-, naphthyl-, benzothienyl-, or benzofuranyl-ethylamine derivatives. An extensive enzymatic study allowed us to pinpoint the amino acid residue of the pentapeptide inhibitor, S 34461, which interacts with the cosubstrate-binding site area, in agreement with an in silico study based on the available coordinates of the hAANAT crystal.  (+info)

cAmp regulation of arylalkylamine N-acetyltransferase (AANAT, EC 2.3.1.87): a new cell line (1E7) provides evidence of intracellular AANAT activation. (2/63)

Arylalkylamine N-acetyltransferase (serotonin N-acetyltransferase, AANAT, EC ) is the penultimate enzyme in melatonin synthesis. As described here, a cell line (1E7) expressing human AANAT (hAANAT) has been developed to study the human enzyme. 1E7 hAANAT is detectable in immunoblots as a 23-kDa band and is immunocytochemically visualized in the cytoplasm. The specific concentration of hAANAT in homogenates is comparable to that of the night rat pineal gland. Kinetics of AANAT extracted from 1E7 cells are the same as those of bacterially expressed hAANAT; both preparations of hAANAT are equally sensitive to the inhibitor CoA-S-N-acetyltryptamine. Studies of cAMP regulation indicate that treatment with forskolin, dibutyryl cAMP, isobutylmethylxanthine, or isoproterenol activate cellular hAANAT within intact 1E7 cells approximately 8-fold without markedly increasing the abundance of AANAT protein or the activity of AANAT in broken cell preparations; and, that forskolin, isobutylmethylxanthine and isoproterenol elevate cyclic AMP production. These observations extend our understanding of cAMP regulation of AANAT activity, because it is currently thought that this only involves changes in the steady-state levels of AANAT protein. This previously unrecognized switching mechanism could function physiologically to control melatonin production without changing AANAT protein levels.  (+info)

Role of a pineal cAMP-operated arylalkylamine N-acetyltransferase/14-3-3-binding switch in melatonin synthesis. (3/63)

The daily rhythm in melatonin levels is controlled by cAMP through actions on the penultimate enzyme in melatonin synthesis, arylalkylamine N-acetyltransferase (AANAT; serotonin N-acetyltransferase, EC ). Results presented here describe a regulatory/binding sequence in AANAT that encodes a cAMP-operated binding switch through which cAMP-regulated protein kinase-catalyzed phosphorylation [RRHTLPAN --> RRHpTLPAN] promotes formation of a complex with 14-3-3 proteins. Formation of this AANAT/14-3-3 complex enhances melatonin production by shielding AANAT from dephosphorylation and/or proteolysis and by decreasing the K(m) for 5-hydroxytryptamine (serotonin). Similar switches could play a role in cAMP signal transduction in other biological systems.  (+info)

Retinal ganglion cells are autonomous circadian oscillators synthesizing N-acetylserotonin during the day. (4/63)

Retinal ganglion cells send visual and circadian information to the brain regarding the environmental light-dark cycles. We investigated the capability of retinal ganglion cells of synthesizing melatonin, a highly reliable circadian marker that regulates retinal physiology, as well as the capacity of these cells to function as autonomous circadian oscillators. Chick retinal ganglion cells presented higher levels of melatonin assessed by radioimmunoassay during both the subjective day in constant darkness and the light phase of a light-dark cycle. Similar changes were observed in mRNA levels and activity of arylalkylamine N-acetyltransferase, a key enzyme in melatonin biosynthesis, with the highest levels of both parameters during the subjective day. These daily variations were preceded by the elevation of cyclic-AMP content, the second messenger involved in the regulation of melatonin biosynthesis. Moreover, cultures of immunopurified retinal ganglion cells at embryonic day 8 synchronized by medium exchange synthesized a [3H]melatonin-like indole from [3H]tryptophan. This [3H]indole was rapidly released to the culture medium and exhibited a daily variation, with levels peaking 8 h after synchronization, which declined a few hours later. Cultures of embryonic retinal ganglion cells also showed self-sustained daily rhythms in arylalkylamine N-acetyltransferase mRNA expression during at least three cycles with a period near 24 h. These rhythms were also observed after the application of glutamate. The results demonstrate that chick retinal ganglion cells may function as autonomous circadian oscillators synthesizing a melatonin-like indole during the day.  (+info)

Cellular stability of serotonin N-acetyltransferase conferred by phosphonodifluoromethylene alanine (Pfa) substitution for Ser-205. (5/63)

Large changes in the activity of serotonin N-acetyltransferase (arylalkylamine N-acetyltransferase, AANAT) in the pineal gland control the rhythmic production of the time-keeping hormone melatonin. The activity of AANAT reflects changes in the amount and activation state of the AANAT protein, both of which increase at night. The molecular basis of this regulation is now becoming known, and recent data indicate that this involves phosphorylation-dependent binding to the 14-3-3 protein at two sites, one of which, Ser-205, is located several residues from the C terminus. In this study, we determined whether substitution of this residue with a non-hydrolyzable the phosphoserine/phosphothreonine mimetic would promote binding to the 14-3-3 protein and enhance cellular stability. To accomplish this, a C-terminal AANAT peptide containing the phosphonodifluoromethylene alanine at Ser-205 was synthesized and fused to bacterially expressed AANAT(30-199) using expressed protein ligation. The resulting semisynthetic protein has enhanced affinity for the expressed 14-3-3 protein and exhibits greater cellular stability in microinjection experiments, as compared with the unmodified AANAT. Enhanced 14-3-3 binding was also observed using humanized ovine AANAT, which has a different C-terminal sequence (Gly-Cys) than the ovine enzyme (Asp-Arg), indicating that that characteristic is not unique to the ovine enzyme. These studies provide the first evidence that substitution of Ser-205 with the stable phosphomimetic amino acid phosphonodifluoromethylene alanine enhances binding to 14-3-3 and the cellular stability of AANAT and are consistent with the view that Ser-205 phosphorylation plays a critical role in the regulation of AANAT activity and melatonin production.  (+info)

Melatonin synthesis: 14-3-3-dependent activation and inhibition of arylalkylamine N-acetyltransferase mediated by phosphoserine-205. (6/63)

The nocturnal increase in circulating melatonin in vertebrates is regulated by the activity of arylalkylamine N-acetyltransferase (AANAT), the penultimate enzyme in the melatonin pathway (serotonin --> N-acetylserotonin --> melatonin). Large changes in activity are linked to cyclic AMP-dependent protein kinase-mediated phosphorylation of AANAT T31. Phosphorylation of T31 promotes binding of AANAT to the dimeric 14-3-3 protein, which activates AANAT by increasing arylalkylamine affinity. In the current study, a putative second AANAT cyclic AMP-dependent protein kinase phosphorylation site, S205, was found to be approximately 55% phosphorylated at night, when T31 is approximately 40% phosphorylated. These findings indicate that ovine AANAT is dual-phosphorylated. Moreover, light exposure at night decreases T31 and S205 phosphorylation, consistent with a regulatory role of both sites. AANAT peptides containing either T31 or S205 associate with 14-3-3zeta in a phosphorylation-dependent manner; binding through phosphorylated (p)T31 is stronger than that through pS205, consistent with the location of only pT31 in a mode I binding motif, one of two recognized high-affinity 14-3-3-binding motifs AANAT protein binds to 14-3-3zeta through pT31 or pS205. Two-site binding lowers the Km for arylalkylamine substrate to approximately 30 microM. In contrast, single-site pS205 binding increases the Km to approximately 1,200 microM. Accordingly, the switch from dual to single pS205 binding of AANAT to 14-3-3 changes the Km for substrates by approximately 40-fold. pS205 seems to be part of a previously unrecognized 14-3-3-binding motif-pS/pT (X1-2)-COOH, referred to here as mode III.  (+info)

Homeobox-clock protein interaction in zebrafish. A shared mechanism for pineal-specific and circadian gene expression. (7/63)

In non-mammalian vertebrates, the pineal gland is photoreceptive and contains an intrinsic circadian oscillator that drives rhythmic production and secretion of melatonin. These features require an accurate spatiotemporal expression of an array of specific genes in the pineal gland. Among these is the arylalkylamine N-acetyltransferase, a key enzyme in the melatonin production pathway. In zebrafish, pineal specificity of zfaanat2 is determined by a region designated the pineal-restrictive downstream module (PRDM), which contains three photoreceptor conserved elements (PCEs) and an E-box, elements that are generally associated with photoreceptor-specific and rhythmic expression, respectively. Here, by using in vivo and in vitro approaches, it was found that the PCEs and E-box of the PRDM mediate a synergistic effect of the photoreceptor-specific homeobox OTX5 and rhythmically expressed clock protein heterodimer, BMAL/CLOCK, on zfaanat2 expression. Furthermore, the distance between the PCEs and the E-box was found to be critical for PRDM function, suggesting a possible physical feature of this synergistic interaction. OTX5-BMAL/CLOCK may act through this mechanism to simultaneously control pineal-specific and rhythmic expression of zfaanat2 and possibly also other pineal and retinal genes.  (+info)

Rhythmic serotonin N-acetyltransferase mRNA degradation is essential for the maintenance of its circadian oscillation. (8/63)

Serotonin N-acetyltransferase (arylalkylamine N-acetyltransferase [AANAT]) is the key enzyme in melatonin synthesis regulated by circadian rhythm. To date, our understanding of the oscillatory mechanism of melatonin has been limited to autoregulatory transcriptional and posttranslational regulations of AANAT mRNA. In this study, we identify three proteins from pineal glands that associate with cis-acting elements within species-specific AANAT 3' untranslated regions to mediate mRNA degradation. These proteins include heterogeneous nuclear ribonucleoprotein R (hnRNP R), hnRNP Q, and hnRNP L. Their RNA-destabilizing function was determined by RNA interference and overexpression approaches. Expression patterns of these factors in pineal glands display robust circadian rhythm. The enhanced levels detected after midnight correlate with an abrupt decline in AANAT mRNA level. A mathematical model for the AANAT mRNA profile and its experimental evidence with rat pinealocytes indicates that rhythmic AANAT mRNA degradation mediated by hnRNP R, hnRNP Q, and hnRNP L is a key process in the regulation of its circadian oscillation.  (+info)

Aralkylamine N-acetyltransferase (AANAT) (EC 2.3.1.87), also known as arylalkylamine N-acetyltransferase or serotonin N-acetyltransferase (SNAT), is an enzyme that is involved in the day/night rhythmic production of melatonin, by modification of serotonin. It is in humans encoded by the ~2.5 kb AANAT gene containing four exons, located on chromosome 17q25. The gene is translated into a 23 kDa large enzyme. It is well conserved through evolution and the human form of the protein is 80% identical to sheep and rat AANAT. It is an acetyl-CoA-dependent enzyme of the GCN5-related family of N-acetyltransferases (GNATs). It may contribute to multifactorial genetic diseases such as altered behavior in sleep/wake cycle and research is on-going with the aim of developing drugs that regulate AANAT function. The systematic name of this enzyme class is acetyl-CoA:2-arylethylamine N-acetyltransferase. Other names in common use include: AANAT Arylalkylamine N-acetyltransferase Melatonin rhythm enzyme Serotonin ...
Haque, R., Chong, Nelson W., Ali, F., Chaurasia, S.S., Sengupta, T., Chun, E., Howell, J.C., Klein, D.C. and Iuvone, P.M. 2011. Melatonin synthesis in retina: cAMP-dependent transcriptional regulation of chicken arylalkylamine N-acetyltransferase by a CRE-like sequence and a TTATT repeat motif in the proximal promoter. Journal of Neurochemistry. 119 (1), pp. 6-17. doi:10.1111/j.1471-4159.2011.07397.x Cardiac-specific RNAi knockdown of Abra disrupts heart function and alters lifespan in Drosophila melanogaster ...
Haque, R., Chong, Nelson W., Ali, F., Chaurasia, S.S., Sengupta, T., Chun, E., Howell, J.C., Klein, D.C. and Iuvone, P.M. 2011. Melatonin synthesis in retina: cAMP-dependent transcriptional regulation of chicken arylalkylamine N-acetyltransferase by a CRE-like sequence and a TTATT repeat motif in the proximal promoter. Journal of Neurochemistry. 119 (1), pp. 6-17. https://doi.org/10.1111/j.1471-4159.2011.07397.x Cardiac-specific RNAi knockdown of Abra disrupts heart function and alters lifespan in Drosophila melanogaster ...
Serotonin N-acetyltransferase complex. Molecular model of a complex formed between the serotonin N-acetyltransferase enzyme (AANAT, light blue, light red) and the zeta isoform structure of a 14-3-3 protein (yellow, green). AANAT is the penultimate enzyme involved in the conversion of serotonin to melatonin in the cells of the pineal gland in the brain. Melatonin modulates the function of the circadian clock, influencing activity and sleep. AANAT is rapidly inactivated when animals are exposed to light at night and therefore controls the rhythm of melatonin production. - Stock Image C035/8649
NAS může hrát roli v antidepresivních účincích selektivních inhibitorů zpětného vychytávání serotoninu (SSRI) a inhibitorů monoaminooxidázy (MAOI). [3] SSRI fluoxetin a MAO-A inhibitor klorgylin zvyšuje AANAT nepřímo prostřednictvím serotonergních mechanismů, a tím zvedá hladinu NAS po chronickém podávání, a to koreluje s nástupem jeho antidepresivních účinků. [3] [15] Kromě toho expozice světla inhibuje syntézu NAS a snižuje antidepresivní účinky MAOI. [3] Navíc AANAT u knockout myšíi vykazuje signifikantně větší dobu její nehybnosti oproti kontrolním myším u modelů deprese na zvířatech. [3] Tato data podporují potenciální úlohu NAS v regulaci nálady a terapeutických přínosů vyvolaných antidepresivem. Přes současně neidentifikovaný mechanismus může být NAS příčinou ortostatické hypotenze pozorované při klinické léčbě IMAO. [15] [16] Snižuje krevní tlak u hlodavců a pinealektomie ( epifýza je hlavním místem ...
Monoklonale und polyklonale AANAT Antikörper für viele Methoden. Ausgesuchte Qualitäts-Hersteller für AANAT Antikörper. Hier bestellen.
Abstract Melatonin is the time-keeping molecule of vertebrates. The daily and annual variations of its rhythmic production allow synchronizing metabolism, physiological functions and behaviour to the environment changes. In fish, melatonin is produced by the photoreceptors of the pineal organ and retina as well as by other retinal cell types in the inner nuclear and ganglion cell layers. In most species, the melatonin rhythm displays a high-at-night profile, resulting from the circadian control of the arylalkylamine N-acetyltranferase (AANAT) activity. AANAT is the penultimate enzyme in the melatonin biosynthesis pathway. This review summarizes our current knowledge on the molecular and cellular mecha- nisms controlling the rhythmic production of melatonin, as well as on the targets and modes of action of the hormone in fish, with special emphasis on neuroendocrine functions.. ...
TY - JOUR. T1 - Melatonin synthesis impairment as a new deleterious outcome of diabetes-derived hyperglycemia. AU - Amaral, Fernanda G.. AU - Turati, Ariane O.. AU - Barone, Mark. AU - Scialfa, Julieta H.. AU - Do Carmo Buonfiglio, Daniella. AU - Peres, Rafael. AU - Peliciari-Garcia, Rodrigo A.. AU - Afeche, Solange C.. AU - Lima, Larissa. AU - Scavone, Cristoforo. AU - Bordin, Silvana. AU - Reiter, Russel J.. AU - Menna-Barreto, Luiz. AU - Cipolla-Neto, José. PY - 2014/8. Y1 - 2014/8. N2 - Melatonin is a neurohormone that works as a nighttime signal for circadian integrity and health maintenance. It is crucial for energy metabolism regulation, and the diabetes effects on its synthesis are unresolved. Using diverse techniques that included pineal microdialysis and ultrahigh-performance liquid chromatography, the present data show a clear acute and sustained melatonin synthesis reduction in diabetic rats as a result of pineal metabolism impairment that is unrelated to cell death. Hyperglycemia ...
A multinational study of the relationships between nighttime urinary melatonin production, age, gender, body size, and latitude. ...
The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the function of the circadian clock that influences activity and sleep. This enzyme is regulated by cAMP-dependent phosphorylation that promotes its interaction with 14-3-3 proteins and thus protects the enzyme against proteasomal degradation. This gene may contribute to numerous genetic diseases such as delayed sleep phase syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009 ...
N-acetyltransferase 1 (arylamine N-acetyltransferase) is a protein that in humans is encoded by the NAT1 gene. This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat NAT2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]. GRCh38: Ensembl release 89: ENSG00000171428 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000051147 - Ensembl, May 2017 Human PubMed Reference:. Mouse PubMed Reference:. Entrez Gene: N-acetyltransferase 1 (arylamine N-acetyltransferase). Retrieved 2012-01-27. Gubin AN, Njoroge JM, Bouffard GG, Miller JL (July 1999). Gene expression in proliferating human erythroid cells. Genomics. 59 ...
A recent Japanese study, published by the British Journal of Cancer in September this year, has found that women who get six or less hours sleep a night are much more likely to develop breast cancer than the rest of the population. The study involved 23,995 Japanese women aged between 40 and 79 who were [...]
Purpose Retinal pigment epithelium (RPE) dysfunction underlies the retinal degenerative process in age-related macular degeneration (AMD), and thus RPE cell replacement provides an ideal treatment target. RPE monolayer in pets of all age group organizations, and frequently included internalized photoreceptor external sections. No pathology was noticed. Findings OpRegen RPE cells made it, rescued visible function, maintained pole and cone photoreceptors long lasting in the RCS rat. Therefore, these data support the make use of of OpRegen RPE cells for the treatment of human being RPE cell disorders including AMD. Translational Relevance Our book xeno-free RPE cells reduce issues of pet produced pollutants while offering a encouraging potential therapy to the unhealthy retina. = 242) had been utilized for this research. All pets had been given a regular lab chow and managed on a 12-hour dark/light routine. All pets had been supervised daily for general wellness and ophthalmic condition. Pets had ...
Background Ovarian carcinoma may be the leading reason behind cancer death world-wide among gynecological malignancies, and nearly all cases are related to chemoresistance and recurrence. examples (p?=?0.024). We determined six miRNAs, including miR-23b, miR-27a, miR-27b, miR-346, miR-424, and miR-503, overexpressed in ALDH1 (+) cells, plus CKAP2 they had been considerably upregulated in chemoresistant ovarian tumor cells (1.4?~?3.5-fold) and tumor samples (2.8?~?5.5-fold) weighed against chemosensitive group. Upregulation of ALDH1 (p?=?0.019) and miR-503 (p?=?0.033) correlated with high clinical stage, and upregulation of miR-27a was related to distant metastasis (p?=?0.046) in individuals with ovarian tumor. Conclusion Our results indicate that ALDH1 can be a good marker for enriching ovarian CSCs, and high manifestation of ALDH1 and its own related miRNAs, miR-23b particularly, miR-27b, miR-424, and miR-503, are implicated in chemoresistance and tumor development in ovarian tumor ...
Compare N-acetyltransferase 1 (arylamine N-acetyltransferase) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
Shop Histidine N-acetyltransferase ELISA Kit, Recombinant Protein and Histidine N-acetyltransferase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
A new spray-based supplement to help rebalance the melatonin production and induce healthy sleep, an instant solution to get a better nights rest. Mint smell
Increase the level of melatonin production in your organism and stop your hair loss, slow down the aging processes and improve your immune system with this affirmations mp3
In recent times, an increasing number of different haplotypes of the arylamine N-acetyltransferase 2 gene are reported. Since most of the various alleles are defined by linkages of commonly known hereditary point mutations, some confusion may occur when the mutation pattern revealed by genotyping sh
Compare N-acetyltransferase 8 (putative) Biomolecules from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
Вивчення біохімічної активності ферменту N-ацетилтрансферази, продукції гена NAT2 у дітей з екологічно несприятливих регіонів (ЕНР) є надзвичайно в...
Melatonin is a natural hormone nutrient that is synthesized from the amino acid tryptophan by the pineal gland in the back of the brain. In the body, melatonin appears to regulate sleep/wake cycles, support normal immune function, and protect cells from free radical damage.. Most of the research on melatonin has focused on its role in maintaining normal sleep/wake rhythms. The perception of daylight in the eyes is a signal for the pineal gland to inhibit melatonin synthesis and release. At night or in the dark, the bodys melatonin production rises. The rise in plasma melatonin is thought to be responsible for bringing on sleep. Nocturnal melatonin production is highest in children and begins to decline from adolescence or until it is virtually absent in the elderly.. Melatonin is considered a potent antioxidant that enters all body cells to help prevent free radical damage. In the brain, melatonin is perhaps the most important physiological antioxidant. Due to its lipid and watersoluble ...
Sexual maturation in females occurred earlier in the high-fluoride animals (Luke 1997); males had increases in melatonin production relative to body weight between 11.5 and 16 weeks (when a decrease normally would occur), and testicular weight at 16 weeks (but not at 9 or 28 weeks) was significantly lower in high-fluoride than in low-fluoride animals. The circadian rhythm of melatonin production was altered in the high-fluoride animals at 11.5 weeks but not at 16 weeks. In high-fluoride females at 11.5 weeks, the nocturnal peak (relative to body weight) occurred earlier than in the low-fluoride animals; also, the peak value was lower (but not significantly lower) in the high-fluoride animals. In males, a substantial reduction (P , 0.00001) in the nocturnal peak (relative to body weight) was observed in the high-fluoride animals.. Although no studies are available that specifically address the effect of fluoride exposure on pineal function or melatonin production in humans, two studies have ...
CONCLUSIONS: It appears likely that changes in pineal melatonin production cannot be correlated directly with the effects of pinealectomy on the crypts, although melatonin production was not measured in this case. The role of loss of the non-adrenergic innervation of the pineal in the effect of pinealectomy needs to be examined. There is also other experimental evidence that melatonin-free extracts of the pineal, containing as yet unidentified substances, can influence mitotic activity in some tissues, so the possible role of these substances in the effects of pinealectomy should also be considered. Furthermore, the superior cervical ganglion itself has an extra-pineal role. Changes in pineal sympathetic innervation are not significant in the hyperproliferative effects of pinealectomy on the intestinal crypts..... Read abstract Full text PDF ...
I hear the words give them melatonin quite often as a solution to help with your baby or toddlers sleep. It actually scares me to hear this because I dont agree in just giving supplements because. Many people seem to think that if it is something that our bodies already produce naturally then that make it ok. But of that is the case, I tend to lean towards the WHY isnt our body not producing enough or WHY do I need more?. Melatonin is a naturally occurring hormone produced by a gland in our brains that helps regulate the sleep cycle. Normally, melatonin levels begin rising in the mid to late evening and remain high throughout the night. The increase in melatonin production is what facilitates sleep. Levels tend to drop in the nearly morning hours as the brighter light and sunshine contribute to melatonin production.. If your child is having issues sleeping, it is best to consult a Certified Sleep Specialist or your medical doctor. It is better and SAFER to decipher the culprit of the ...
Melatonin is a hormone that is produced by the pineal gland in the brain and production of melatonin follows the circadian cycle. When there is less light, receptors in the optic nerve send a message to the brain to notify it of chances in the circadian cycle. The brain then sends a message to the pineal gland to produce more melatonin in order to make us sleepy. The reverse works when there is more light and melatonin production slows down, resulting in us being more alert. Melatonin production naturally slows down with age, which is one of the reasons why many people struggle to sleep for long periods of time.. Some people who have trouble sleeping find that their bodies are producing low levels of melatonin. Although a naturally occurring substance in some food items, including bananas, tomatoes, barley and oats, many people opt to take melatonin supplements to help them combat sleep disorders such as jet lag and insomnia. Although it doesnt make you fall asleep, it promotes it by ensuring ...
Entrainment of circadian clocks to environmental cues such as photoperiod ensures that daily biological rhythms stay in synchronization with the Earths rotation. The vertebrate pineal organ has a conserved role in circadian regulation as the primary source of the nocturnal hormone melatonin. In lower vertebrates, the pineal has an endogenous circadian clock as well as photoreceptive cells that regulate this clock. The zebrafish opsin protein Exo-rhodopsin (Exorh) is expressed in pineal photoreceptors and is a candidate to mediate the effects of environmental light on pineal rhythms and melatonin synthesis. We demonstrate that Exorh has an important role in regulating gene transcription within the pineal. In developing embryos that lack Exorh, expression of the exorh gene itself and of the melatonin synthesis gene serotonin N-acetyl transferase 2 (aanat2) are significantly reduced. This suggests that the Exorh protein at the cell membrane is part of a signaling pathway that positively regulates ...
Rabbit polyclonal Serotonin N-acetyltransferase (phospho T29) antibody validated for WB and tested in Rat. Immunogen corresponding to synthetic peptide
Rabbit polyclonal Serotonin N-acetyltransferase antibody (ab3506) validated for WB and tested in Rat. Immunogen corresponding to synthetic
Nicholls, J, Skene, DJ and Hourani, SMO (1997) Use of a newly developed technique to isolate rat pinealocytes and study the effects of adenosine agonists on melatonin production ...
The pineal gland is a bit of cone shaped gland which is hidden away deep in the human brain. Although its a small gland, it plays a really crucial role in The aging and melatonin production process
Dr. Mercolas Comments:. Its well known that lack of sleep interferes with metabolism and hormone production in a way that is similar to the effects of aging. One way that this may occur could be related to the action of melatonin, the sleep hormone secreted by your brain. Normally, your brain produces melatonin in a daily rhythm that peaks at night, around 9 or 10 p.m. This makes you sleepy, and it is these regularly occurring secretions that help regulate your sleep cycle. If youre not getting enough sleep, theres a good chance your melatonin production is not up to par either, and this could have far-reaching impacts on your health, even accelerating the aging process of your brain.. The Powerful Antioxidant Effects of Melatonin In a new study, artificially aged mice treated with melatonin had reduced oxidative stress and markers of cerebral aging and neurodegeneration, indicating the melatonin offered both neuroprotective and anti-aging effects. Melatonin actually has antioxidant ...
In January of 2013, all dairy heifers were artificially inseminated with sex-sorted semen at the Joe Bearden Dairy Research Center. Prior to day 170 of gestation, heifers (n=20) were trained to acquire their feed using the Calan feeding system (American Calan, Northwood, NH). On day 190 of gestation, heifers were blocked by their body weight and randomly assigned to one of two dietary treatments consisting of 1) 20 mg of dietary melatonin per day (MEL) or 2) no dietary melatonin supplementation (control; CON). At 0800 hours, the MEL heifers received 0.7 kg of grain top dressed with 2 mL of 10 mg per mL melatonin in ethanol. The CON heifers received 0.7 kg of grain top dressed with 2 mL of ethanol alone. The melatonin was supplemented in the morning hours in order to compensate for the bodies natural spike in melatonin production following the dark hours. After all heifers consumed their grain, they were provided 17.5 kg of a total mixed ration. Blood samples were collected via venipuncture of ...
We know the part of your brain where Circadian Rhythms live. Its in your supraschiasmatic nucleus (SCN). Thats in the hypothalamus. The hypothalamus seems to be fairly important to your health in that it regulates stuff like, body temperature, fluids/electrolytes, hunger, and hormone production. Im not saying you couldnt get healthy without help from the hypothalamus, but if you were to fry the damn thing by screwing up your Circadian Rhythms hard and often - you might struggle a bit. The other thing we know is your SCN is connected to the retina of your eye. If it is dark, the SCN tells your body to secrete melatonin and make you peacefully sleepy. If its light, the SCN inhibits melatonin production. Hint: if you are having trouble sleeping please ponder on the darkness thing you just learned. In the winter (assuming you live far from the equator), your SCN has developed a strange way of adapting to the longer periods of darkness. It produces melatonin in 2 stages. The first stage ...
Women who overeat late in the night may suffer from a syndrome where their melatonin production is too low and out of order. This causes an increased production of the stress hormone cortisol and a hormone called ghrelin that stimulates hunger.
In summary:. It begins in the gut. Alterations within the gut flora are occurring in large part through the consumption of RoundUp residue in genetically modified food, not to mention sugar/HFCS processed food and overly prescribed antibiotics. This gut flora alteration is commonly characterized by an overgrowth of pathogenic bacteria which break down the lining of the gut. Furthermore, the gut flora alterations then compromise the ability for the body to make the raw ingredients for melatonin production, namely tryptophan and serotonin. The lining of the gut is maintained, in part, by melatonin(R). As the microbes and their waste products seep into the blood stream the immune system within the periphery of the body releases inflammatory molecules which begin to promote proinflammatory activity in the nervous system. This proinflammatory activity state is called, microglial activation. The microglial cells being the primary immune cells of the nervous system are prone to shifting from a ...
An A-star for Joanna Bales excellent impartial report on Wireless netwoks in schools (times 20th November). Sadly, though, E-minus for your so-called Health Editors facile and heavily-loaded comment. Informed parents have every reason to be concerned about WiFi in schools. Ms Davies was right to liken it to having a mobile phone mast in the classroom, the technologies are remarkably similar. Peer-reviewed replicated research shows reduction in melatonin production by those exposed to periodic amplitude modulated (pulsed) radiation of this sort. Melatonin is a sleep regulator and anti-cancer scavenger. Guess what? - Statistically significant increases in cancers around mast installations according to several independent studies, and sleep problems experienced by many living close to masts. Other research shows this type of radiation allows transfer of toxins from the bloodstream into brain cells. This would lead to significant increases in headaches, nausea, dizziness and disorientation around ...
Accepted name: phenylalanine N-acetyltransferase. Reaction: acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine. Other name(s): acetyl-CoA-L-phenylalanine α-N-acetyltransferase. Systematic name: acetyl-CoA:L-phenylalanine N-acetyltransferase. Comments: Also acts, more slowly, on L-histidine and L-alanine.. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, CAS registry number: 9075-16-5. References: 1. Leuzinger, W., Baker, A.L. and Cauvin, E. Acetylcholinesterase. II. Crystallization, absorption spectra, isoionic point. Proc. Natl. Acad. Sci. USA 59 (1968) 620-623. [PMID: 5238989]. ...
CP002160.PE153 Location/Qualifiers FT CDS 242742..243257 FT /codon_start=1 FT /transl_table=11 FT /locus_tag=Clocel_0156 FT /product=GCN5-related N-acetyltransferase FT /note=PFAM: GCN5-related N-acetyltransferase; KEGG: FT hor:Hore_00330 GCN5-related N-acetyltransferase FT /db_xref=EnsemblGenomes-Gn:Clocel_0156 FT /db_xref=EnsemblGenomes-Tr:ADL49944 FT /db_xref=GOA:D9SNS3 FT /db_xref=InterPro:IPR000182 FT /db_xref=InterPro:IPR016181 FT /db_xref=UniProtKB/TrEMBL:D9SNS3 FT /inference=protein motif:PFAM:PF00583 FT /protein_id=ADL49944.1 FT /translation=MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI FT MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG FT KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD FT LQMVCDVD MIKFQLLTKE NMAENALDNY DRLQNVRRVY RKIDSEYMLV EDVGIMDWSF ERKQAVAKAL 60 ISDDYITFGA IREDEIVGFA SIEKQLQGKY IVLDMMQVSR KYRGKGMGRT LFQLVKEKAK 120 EMGAKQLYIS ACASEETIEF YKSMGCKITD NPIKKIAEDE PFDLQMVCDV D 171 ...
Probable N-acetyltransferase 8B encoded by NAT8B is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. NAT8B is localized on ...
Science & Technology, Life Sciences & Biomedicine, Neurosciences, Neurosciences & Neurology, NEUROSCIENCES, chicken, pineal gland, retina, circadian rhythm, light, melatonin, serotonin N-acetyltransferase, MELATONIN SYNTHESIS, PERCEIVED LIGHT, JAPANESE-QUAIL, CLOCK, SYSTEM, SUPPRESSION, RECEPTORS, CELLS ...
TY - JOUR. T1 - The in vitro activation of cyclic AMP production by either forskolin or isoproterenol in the syrian hamster pineal during the day is not accompanied by an increase in melatonin production. AU - Santana, Celsa. AU - Guerrero, Juan M.. AU - Reiter, Russel J. AU - Troiani, Maureen E.. PY - 1988/12/30. Y1 - 1988/12/30. N2 - The role of cyclic AMP in the regulation of melatonin production was investigated in cultured Syrian hamster pineal glands. Forskolin markedly increased cyclic AMP production in pineal glands collected either late in the light period or in the dark period. The effect of forskolin was synergistically enhanced by 3-isobutylmethylxanthine, a phosphodiesterase inhibitor; however, increase in cyclic AMP after isoproterenol was only apparent in the presence of 3-isobutylmethylxanthine. Since β-adrenergic agonists are able to stimulate melatonin production late in the dark period only, these data suggest that, in the hamster pineal gland, there may be intracellular ...
Increased pineal calcifications and decreased pineal melatonin biosynthesis, both age related, support the notion of a pineal bio-organic timing mechanism. Decreased calcium ion availability is the si
Retina and anterior neural fold homeobox (Rax) gene encodes a transcription factor essential for vertebrate eye development. Recent microarray studies indicate that Rax is expressed in the adult rat pineal gland and retina. The present study reveals that Rax expression levels in the rat change significantly during retinal development with a peak occurring at embryonic day (E) 18, whereas Rax expression in the pineal is relatively delayed and not detectable until E20. In both tissues, Rax is expressed throughout postnatal development into adulthood. In the mature rat pineal gland, the abundance of Rax transcripts increases 2-fold during the light period with a peak occurring at dusk. These findings are consistent with the evidence that Rax is of functional importance in eye development and suggest a role of Rax in the developing pineal gland. In addition, it would appear possible that Rax contributes to phenotype maintenance in the mature retina and pineal gland and may facilitate 24-h changes in ...
Inherent in all living organisms, natures circadian rhythm springs us into activity in the daytime and then into rest and restoration at night. And this circadian rhythm is attuned to the presence and absence of the sun, principally blue light.. Melatonin is critical to regulating the bodys circadian rhythm. When the sun goes down and it becomes dark, our eyes sense the absence of light and send a signal to the brain, which instructs the pineal gland to produce melatonin and put us to sleep.. Now in modern times, the incandescent light began humankinds earliest assault on natures circadian rhythm. This has only worsened with the advent of television, computers, tablets, cell phones, gaming stations and whatever else produces light to interfere with our circadian rhythm. When the lights stay on, melatonin production is slowed or stopped.. Exposure to sunlight - at least 10 to 15 minutes a day is recommended - is also crucial to the production of vitamin D, which is found in very few foods but ...
The body s natural melatonin is responsible for setting its internal clock that governs the timing of neuroendocrine functions and other physiological processes.Melatonin production is known to decline with the aging process .Melatonin is effective for helping to promote natural, restful sleep in both younger.Melatonin supplementation has helped reduce the discomfort associated with changing time zone in controlled trials .
Melatonin is a hormone secreted by the pineal gland that aids biorhythm regulation.* Biorhythm is disrupted by stress, crossing time zones and changing work shifts.* Melatonin production also declines with age.* Vitamin B6 aids melatonin metabolism.* Keep out of the reach of children.
Tested to Block 99.9% of Harmful Blue Rays and UV Rays emitting from the Sun and Artificial Light Sources Sleep Better: Wear Before Bed and Block Artificial Light from Suppressing Melatonin Production Safe and Stylish: Wraparound Lens Design For Maximum Coverage and Safety Meets ANSI Z87.1-2003 and CSA Z94.3 standards
Some cancer risk factors are well established and well known, like smoking. Others arent well known at all. Here are 10 things that are linked to cancer, some of which may surprise you:. 1. Shift work. For all those employees working vampire hours, its discouraging to hear that shift work has joined the list of items considered probably carcinogenic to humans, according to the International Agency for Research on Cancer (IARC). Studies show that women working the graveyard shift, like flight attendants and nurses, have a greater risk of developing breast cancer. Researchers are investigating how disruption of the circadian system, the bodys natural sleep-wake cycle, can affect melatonin production and possibly cause tumors to develop.. 2. High-temperature cooking. If you like your steak grilled to a crisp, you might be putting yourself at risk for something more than just burnt taste buds. Studies cite a connection between high-temperature cooking (like grilling or frying) and colorectal ...
Upgraded Nano Magnesium Supports Better Sleep.* Insulin Sensitivity* Muscle Recovery* Cognitive Function* Protein Absorption and Energy* Higher Melatonin Production For Deep Sleep* The best absorbing magnesium supplement available with maximum bioavailability and measurable absorption.*
N-Acetyltransferase phenotype and risk in urinary bladder cancer: approaches in molecular epidemiology. Preliminary results in Sweden and Denmark: A variable bu
The primary function of the pineal gland is to secrete melatonin, which plays a role in regulating sleep cycles and in sexual development. The pineal gland also helps to regulate endocrine functions...
Im searching for places that carry one or two special enzymes of the melatonin biosynthetic pathway, (NAT) N-acetyltransferase or (HIOMT) hydroxylindole-O-methyltransferase. Please anyone with any information on where I can buy, borrow from someone in-house stock please contact me. Dr. Klosen any ideas on where I can get the above enzyme(s). Any help or info is greatly appreciated. regards Maria Mejia Smith-Kettlewell Eye Res. Inst. S.F.CA ...
This enzyme belongs to the family of transferases, specifically those acyltransferases transferring groups other than aminoacyl groups. This enzyme participates in lysine
The pineal gland is an important gland for connecting us to other dimensions, such as the dream and spiritual plane, because it produces melatonin and DMT.
... (AANAT) (EC 2.3.1.87), also known as arylalkylamine N-acetyltransferase or serotonin N- ... Voisin P, Namboodiri MA, Klein DC (1984). "Arylamine N-acetyltransferase and arylalkylamine N-acetyltransferase in the ... AANAT Arylalkylamine N-acetyltransferase Melatonin rhythm enzyme Serotonin acetylase Serotonin acetyltransferase Serotonin N- ... "Entrez Gene: arylalkylamine N-acetyltransferase". Coon SL, Mazuruk K, Bernard M, Roseboom PH, Klein DC, Rodriguez IR (May 1996 ...
... the arylalkylamine N-acetyltransferase (AANAT). On exposure to (day)light, noradrenergic stimulation stops and the protein is ... It has been proposed that histidine residue His122 of serotonin N-acetyl transferase is the catalytic residue that deprotonates ... the structure of serotonin N-acetyltransferase at 2.5 A resolution suggests a catalytic mechanism". Molecular Cell. 3 (1): 23- ... but is also converted into N-acetylserotonin by serotonin N-acetyltransferase with acetyl-CoA. Hydroxyindole O- ...
... arylalkylamine N-acetyltransferase). The expression of the AANAT gene is controlled by the transcription factor pCREB, and this ...
... photic suppression of arylalkylamine-N-acetyltransferase transcript, and acute suppression of locomotor activity by light." ...
... arylalkylamine n-acetyltransferase MeSH D08.811.913.050.313 - arylamine N-acetyltransferase MeSH D08.811.913.050.331 - atp ... acetyl-CoA C-acetyltransferase MeSH D08.811.913.050.134.105 - amino-acid n-acetyltransferase MeSH D08.811.913.050.134.150 - ... phosphate acetyltransferase MeSH D08.811.913.050.134.850 - serine O-acetyltransferase MeSH D08.811.913.050.170 - acyl-carrier ... acetyltransferases MeSH D08.811.913.050.134.029 - acyl-carrier protein s-acetyltransferase MeSH D08.811.913.050.134.060 - ...
The 2014 Ju-Jitsu World Championship were the 12th edition of the Ju-Jitsu World Championships, and were held in Paris, France from November 28 to November 30, 2014. 28.11.2014 - Men's and Women's Fighting System, Men's and Women's Jiu-Jitsu (ne-waza), Men's Duo System - Classic 29.11.2014 - Men's and Women's Fighting System, Men's and Women's Jiu-Jitsu (ne-waza), Women's Duo System - Classic 30.11.2014 - Men's Jiu-Jitsu (ne-waza), Mixed Duo System - Classic, Team event Vincent MATCZAK (2014-09-30). "4TH INVITAION TO WORLD CHAMPIONSHIP 2014" (PDF). Retrieved 2019-11-28.[dead link] Online results Official results (PDF) Mixed team event results (PDF) (All articles with dead external links, Articles with dead external links from April 2022, Ju-Jitsu World Championships, 2014 in French sport ...
Bolley L. "Bo" Johnson (born November 15, 1951) is an American politician from the state of Florida. A member of the Democratic Party, Johnson was a member of the Florida House of Representatives, and served as the Speaker of the Florida House of Representatives. Johnson is from Milton, Florida. His father and grandfather served as county commissioners for Santa Rosa County, Florida. Johnson graduated from Milton High School, and became the first member of his family to attend college. He received his bachelor's degree from Florida State University. Johnson volunteered for Mallory Horne when Horne served as the president of the Florida Senate. At the age of 22, Johnson met Lawton Chiles, then a member of the United States Senate, who hired him as a legislative aide in 1973. Johnson was elected to the Florida House of Representatives, representing the 4th district from November 7, 1978 to November 3, 1992. He also served the 1st district from November 3, 1992 to November 8, 1994. He became the ...
... may refer to: Don't Say No (Billy Squier album), a 1981 album by American rock singer Billy Squier, and its title track Don't Say No (Seohyun EP), a 2016 extended play by South Korean pop singer Seohyun, and its title track "Don't Say No" (Tom Tom Club song), from the 1988 album Boom Boom Chi Boom Boom "Don't Say No", by Robbie Williams from the 2005 album Intensive Care "Don't Say No Tonight", a 1985 single by Eugene Wilde This disambiguation page lists articles associated with the title Don't Say No. If an internal link led you here, you may wish to change the link to point directly to the intended article. (Disambiguation pages with short descriptions, Short description is different from Wikidata, All article disambiguation pages, All disambiguation pages, Disambiguation pages ...
The Dewoitine 37 was the first of a family of 1930s French-built monoplane fighter aircraft. The D.37 was a single-seat aircraft of conventional configuration. Its fixed landing gear used a tailskid. The open cockpit was located slightly aft of the parasol wing. The radial engine allowed for a comparatively wide fuselage and cockpit. Design of this machine was by SAF-Avions Dewoitine but owing to over work at that companies plant at the time, manufacture of the D.37/01 was transferred to Lioré et Olivier. They were high-wing monoplanes of all-metal construction with valve head blisters on their engine cowlings. The first prototype flew in October 1931. Flight testing resulted in the need for multiple revisions in both engine and airframe, so it was February 1934 before the second prototype flew. Its performance prompted the French government to order for 28 for the Armée de l'Air and Aéronavale. The Lithuanian government ordered 14 that remained in service with their Air Force until 1936, ...
The Noor-ul-Ain (Persian: نور العين, lit. 'the light of the eye') is one of the largest pink diamonds in the world, and the centre piece of the tiara of the same name. The diamond is believed to have been recovered from the mines of Golconda, Hyderabad in India. It was first in possession with the nizam Abul Hasan Qutb Shah, later it was given as a peace offering to the Mughal emperor Aurangazeb when he defeated him in a siege. It was brought into the Iranian Imperial collection after the Persian king Nader Shah Afshar looted Delhi in the 18th century.[citation needed] The Noor-ul-Ain is believed to have once formed part of an even larger gem called the Great Table diamond. That larger diamond is thought to have been cut in two, with one section becoming the Noor-ul-Ain and the other the Daria-i-Noor diamond. Both of these pieces are currently part of the Iranian Crown Jewels. The Noor-ul-Ain is the principal diamond mounted in a tiara of the same name made for Iranian Empress Farah ...
The Benoist Land Tractor Type XII was one of the first enclosed cockpit, tractor configuration aircraft built. Benoist used "Model XII" to several aircraft that shared the same basic engine and wing design, but differed in fuselage and control surfaces. The Type XII was a tractor-engined conversion of the model XII headless pusher aircraft that resembled the Curtiss pusher aircraft. Demonstration pilots used Benoist aircraft to demonstrate the first parachute jumps, and the tractor configuration was considered much more suitable for the task. The first example named the "Military Plane" had a small box frame covered fuselage that left the occupants mostly exposed to the wind. The later model XII "Cross Country Plane" had a full fuselage that occupants sat inside of. The first tractor biplane used a wooden fuselage with a small seat on top. The wings were covered with a Goodyear rubberized cloth. The first model XII was built in the spring of 1912. On 1 March 1912, Albert Berry used a headless ...
... (also known as Yalmotx in Qʼanjobʼal) is a town, with a population of 17,166 (2018 census), and a municipality in the Guatemalan department of Huehuetenango. It is situated at 1450 metres above sea level. It covers a terrain of 1,174 km². The annual festival is April 29-May 4. Barillas has a tropical rainforest climate (Af) with heavy to very heavy rainfall year-round and extremely heavy rainfall from June to August. Citypopulation.de Population of departments and municipalities in Guatemala Citypopulation.de Population of cities & towns in Guatemala "Climate: Barillas". Climate-Data.org. Retrieved July 26, 2020. Muni in Spanish Website of Santa Cruz Barillas Coordinates: 15°48′05″N 91°18′45″W / 15.8014°N 91.3125°W / 15.8014; -91.3125 v t e (Articles with short description, Short description is different from Wikidata, Pages using infobox settlement with no coordinates, Articles containing Q'anjob'al-language text, Coordinates on Wikidata, ...
Maria Margaret La Primaudaye Pollen (10 April 1838 - c. 1919), known as Minnie, was a decorative arts collector. As Mrs John Hungerford Pollen, she became known during the early-twentieth century as an authority on the history of textiles, publishing Seven Centuries of Lace in 1908. Maria Margaret La Primaudaye was born into a Huguenot family on 10 April 1838, the third child of the Revd Charles John La Primaudaye, a descendant of Pierre de La Primaudaye. She was educated in Italy. Her family converted to Catholicism in 1851, and it was in Rome that her father met another recent English convert, John Hungerford Pollen, previously an Anglican priest and a decorative artist. She became engaged to Pollen, who was then seventeen years her senior, in the summer of 1854, and was married in the church of Woodchester monastery, near Stroud, Gloucester, on 18 September 1855. The Pollens initially settled in Dublin, where John Hungerford Pollen had been offered the professorship of fine arts at the ...
Ronald Robert Fogleman (born January 27, 1942) is a retired United States Air Force general who served as the 15th Chief of Staff of the Air Force from 1994 to 1997 and as Commanding General of the United States Transportation Command from 1992 to 1994. A 1963 graduate from the United States Air Force Academy, he holds a master's degree in military history and political science from Duke University. A command pilot and a parachutist, he amassed more than 6,800 flying hours in fighter, transport, tanker and rotary wing aircraft. He flew 315 combat missions and logged 806 hours of combat flying in fighter aircraft. Eighty of his missions during the Vietnam War were as a "Misty FAC" in the F-100F Super Sabre at Phù Cát Air Base, South Vietnam between 25 December 1968 and 23 April 1969. Fogleman was shot down in Vietnam in 1968, while piloting an F-100. He was rescued by clinging to an AH-1 Cobra attack helicopter that landed at the crash site. In early assignments he instructed student pilots, ...
Peachtree Street" is a 1950 song co-written and recorded by Frank Sinatra in a duet with Rosemary Clooney. The song was released as a Columbia Records single. Frank Sinatra co-wrote the song with Leni Mason and Jimmy Saunders. Mason composed the music while Sinatra and Saunders wrote the lyrics. The song was arranged by George Siravo The song was released as an A side Columbia 10" 78 single, Catalog Number 38853, Matrix Number CO-43100-1 and as a 7" 33, 1-669. The B side was the re-issued "This Is the Night." Neither of the songs charted. The subject of the song is a stroll down the street in Atlanta, Georgia of the same name. Sinatra originally intended Dinah Shore to sing the duet with him. When Shore declined, Clooney was asked. The song was recorded on April 8, 1950. The song features spoken asides by Sinatra and Clooney. Rosemary Clooney asks: "Say, Frank, you wanna take a walk?" Frank Sinatra replies: "Sure, sweetie, just pick a street." He noted how there were no peach trees on the ...
... is a painting by American illustrator Norman Rockwell that depicts a Boy Scout in full uniform standing in front of a waving American flag. It was originally created by Rockwell in 1942 for the 1944 Brown & Bigelow Boy Scout Calendar. The model, Bob Hamilton, won a contest to be in the painting and personally delivered a print to the Vice President of the United States at the time, Henry A. Wallace. The painting was created to encourage Scouts to participate in the war effort during World War II. The name of the painting, We, Too, Have a Job to Do, comes from a slogan that the Boy Scouts of America used in 1942 to rally scouts to support the troops by collecting metal and planting victory gardens. The model, Bob Hamilton, won a contest with his local council in Albany, New York, to be depicted in the painting. He traveled to Rockwell's studio in Arlington, Vermont, to model for Rockwell. Since Hamilton was a scout, the uniform shown in the painting was his, unlike some ...
At least 33[failed verification] people were killed by a fuel tanker explosion in Tleil, Akkar District, Lebanon on 15 August 2021. The disaster was reportedly exacerbated by the ongoing Lebanese liquidity crisis; in which the Lebanese pound has plummeted and fuel has been in short supply. The survivors were evacuated by the Lebanese Red Cross. An investigation is underway. The fuel tanker had been confiscated by the Lebanese Armed Forces from black marketeers, the fuel was then distributed/taken by the locals. The son of the man whose land the fuel tanker was located on, was later arrested, accused of deliberately causing the explosion. Agencies (2021-08-15). "At least 20 killed and 79 injured in fuel tank explosion in Lebanon". the Guardian. Retrieved 2021-08-15. "Lebanon fuel explosion kills 22 and injures dozens more". The Independent. 2021-08-15. Archived from the original on 2021-08-15. Retrieved 2021-08-15. "Lebanon: At least 20 dead and dozens injured after fuel tank explodes as ...
The Straubing Tigers are a professional men's ice hockey team, based in Straubing, Germany, that competes in the Deutsche Eishockey Liga. Straubing plays its home games at the Eisstadion am Pulverturm, which has a capacity of 5,800 spectators. Promoted to the DEL in 2006, and operating with one of the league's smallest budgets, the team could finish no better than twelfth before the 2011-12 DEL season, when it reached the semi-finals of the playoffs. Their greatest success so far is the qualification for the season 2020-21 of the Champions Hockey League. In 1941, the then 14-year-old Max Pielmaier and his friends Max Pellkofer and Harry Poiger founded the first hockey team in Straubing. The first official game took place on the first of February 1942 in Hof and was lost by a score of 0:1. In the following year there were several games against other Bavarian teams. The game against Landshut on 31 January. 1943 was the last game during the second World War, because the young players also had to ...
Leina is a village in Saaremaa Parish, Saare County in western Estonia. Before the administrative reform in 2017, the village was in Pihtla Parish. "Lisa. Asustusüksuste nimistu" (PDF). haldusreform.fin.ee (in Estonian). Rahandusministeerium. Retrieved 5 December 2017. "Saaremaa külad endiste valdade piires". www.saaremaa.ee (in Estonian). Archived from the original on 3 December 2017. Retrieved 5 December 2017. Coordinates: 58°17′10″N 22°46′26″E / 58.28611°N 22.77389°E / 58.28611; 22.77389 v t e (CS1 Estonian-language sources (et), Articles with short description, Short description is different from Wikidata, Pages using infobox settlement with no map, Pages using infobox settlement with no coordinates, Saaremaa Parish, Coordinates on Wikidata, Villages in Saare County, All stub articles, Saare County geography stubs ...
A sestiere (plural: sestieri) is a subdivision of certain Italian towns and cities. The word is from sesto ('sixth'), so it is thus used only for towns divided into six districts. The best-known example is the sestieri of Venice, but Ascoli Piceno, Genoa, Milan and Rapallo, for example, were also divided into sestieri. The medieval Lordship of Negroponte, on the island of Euboea, was also at times divided into six districts, each with a separate ruler, through the arbitration of Venice, which were known as sestieri. The island of Crete, a Venetian colony (the "Kingdom of Candia") from the Fourth Crusade, was also divided into six parts, named after the sestieri of Venice herself, while the capital Candia retained the status of a comune of Venice. The island of Burano north of Venice is also subdivided into sestieri. A variation of the word is occasionally found: the comune of Leonessa, for example, is divided into sesti or sixths. Other Italian towns with fewer than six official districts are ...
The Island Image is a Chesapeake Bay log canoe, built in 1885 at Elliot's Island, Maryland, by Herman Jones and Isaac Moore. She is 29'-8½" long with a beam of 5-10¼", and has a straight, raking stem and a sharp stern. It is privately owned, and races under No. 17. She one of the last 22 surviving traditional Chesapeake Bay racing log canoes that carry on a tradition of racing on the Eastern Shore of Maryland that has existed since the 1840s. She is located at Chestertown, Kent County, Maryland. She was listed on the National Register of Historic Places in 1985. "National Register Information System". National Register of Historic Places. National Park Service. April 15, 2008. "Maryland Historical Trust". ISLAND IMAGE (log canoe). Maryland Historical Trust. 2008-06-14. "Island Image #17 , CBLCSA". Island Image. Chesapeake Bay Log Sailing Canoe Association. 2010-07-24. Archived from the original on 2011-07-08. Retrieved 2010-07-29. ISLAND IMAGE (log canoe), Kent County, including photo in 1984, ...
... (Persian: دهستان بردخون) is a rural district (dehestan) in the Bord Khun District of Deyr County, Bushehr Province, Iran. At the 2006 census, its population was 1,115, in 234 families. The rural district has 14 villages. "Census of the Islamic Republic of Iran, 1385 (2006)" (Excel). Statistical Center of Iran. Archived from the original on 2011-11-11. Coordinates: 27°58′N 51°32′E / 27.967°N 51.533°E / 27.967; 51.533 v t e (Articles with short description, Short description matches Wikidata, Pages using infobox settlement with no map, Pages using infobox settlement with no coordinates, Articles containing Persian-language text, Coordinates on Wikidata, Rural Districts of Bushehr Province, Deyr County, All stub articles, Deyr County geography stubs ...
... is a disease of camels caused by the camelpox virus (CMPV) of the family Poxviridae, subfamily Chordopoxvirinae, and the genus Orthopoxvirus. It causes skin lesions and a generalized infection. Approximately 25% of young camels that become infected will die from the disease, while infection in older camels is generally more mild. Although rare, the infection may spread to the hands of those that work closely with camels. The camelpox virus that causes camelpox is an orthopoxvirus that is very closely related to the variola virus that causes smallpox. It is a large, brick-shaped, enveloped virus that ranges in size from 265-295 nm. The viral genetic material is contained in a linear double-stranded DNA consisting of 202,182 tightly packed base pairs. The DNA is encased in the viral core. Two lateral bodies are found outside the viral core, and are believed to hold the enzymes required for viral reproduction. The camelpox virus most often affects members of family Camelidae. However, ...
... s (/ˈfɛzənt/ FEH-zənt) are birds of several genera within the family Phasianidae in the order Galliformes. Although they can be found all over the world in introduced (and captive) populations, the pheasant genera native range is restricted to Eurasia. The classification "pheasant" is paraphyletic, as birds referred to as pheasants are included within both the subfamilies Phasianinae and Pavoninae, and in many cases are more closely related to smaller phasianids, grouse, and turkey (formerly classified in Perdicinae, Tetraoninae, and Meleagridinae) than to other pheasants. Pheasants are characterised by strong sexual dimorphism, males being highly decorated with bright colours and adornments such as wattles. Males are usually larger than females and have longer tails. Males play no part in rearing the young. A pheasants call or cry can be recognised due to the fact it sounds like a rusty sink or valve being turned. Pheasants eat mostly seeds, grains, roots, and berries, while in the ...
Paul S. Mischel (born July 13, 1962) is an American physician-scientist whose laboratory has made pioneering discoveries in the pathogenesis of human cancer. He is currently a Professor and Vice Chair of Research for the Department of Pathology and Institute Scholar of ChEM-H, Stanford University. Mischel was elected into the American Society for Clinical Investigation (ASCI), serving as ASCI president in 2010/11. He was inducted into the Association of American Physicians, and was elected as a fellow of the American Association for the Advancement of Science. Mischel was born on July 13, 1962. After losing his father to cancer, he became committed to a career in cancer research. He attended the University of Pennsylvania and received his M.D. from Cornell University Medical College in 1991, graduating Alpha Omega Alpha. Mischel completed residency training in Anatomic Pathology and Neuropathology at UCLA, followed by post-doctoral research training with Louis Reichardt at HHMI-UCSF. Mischel ...
... is a moth of the family Sphingidae. It is known from highland forest in central Kenya and also in Zimbabwe. The length of the forewings is about 24 mm for males and 26 mm for females. It is similar to Temnora griseata griseata but the upperside of the head has a dark brown median longitudinal crest, the forewing apex and tornus are more acute and the outer margin is more deeply excavated below the apex. The forewing upperside ground colour is dark brown and the pattern of transverse lines is more contrasted. Temnora subapicalis subapicalis Temnora subapicalis hayesi Darge, 1975 (Rwanda) "CATE Creating a Taxonomic eScience - Sphingidae". Cate-sphingidae.org. Retrieved 2011-10-25.[permanent dead link] Carcasson, R. H. (1967). "Revised Catalogue of the African Sphingidae (Lepidoptera) with Descriptions of the East African species". Journal of the East Africa Natural History Society and National Museum. 26 (3): 1-173 - via Biodiversity Heritage Library. v t e (All articles with ...
... is a name under which singer-songwriter Dan Michaelson records and performs. They have previously stated that they are inspired by Leonard Cohen, Johnny Cash, Etta James and Dusty Springfield. Following the release of Blindspot in 2013 and Sudden Fiction in 2011, the band released Distance in August 2014. Memory was released in May 2016. Albums Singles Simpson, Dave (5 May 2016). "Dan Michaelson and the Coastguards: Memory review - magical, melancholy songs". Theguardian.com. Retrieved 21 October 2020. Dan Michaelson and The Coastguards official site Dan Michaelson and The Coastguards myspace page The state51 Conspiracy official site Official YouTube (Use dmy dates from June 2020, Use British English from June 2016, Articles needing additional references from October 2016, All articles needing additional references, Articles with hCards, Pages using infobox musical artist with associated acts, Articles with ISNI identifiers, Articles with MusicBrainz ...
The Edmonton Drillers were a North American Soccer League team that played both outdoors and indoors from 1979 to 1982, at the peak of the league's success. The team was brought to Edmonton by local entrepreneur and Edmonton Oilers owner Peter Pocklington, after witnessing the strong support for Brian Rice's Edmonton Black Gold team in 1978. Previous to playing in Edmonton, the team was known as the Oakland Stompers, Hartford Bicentennials and Connecticut Bicentennials. Joe Petrone was the Drillers general manager for their entire existence. The Drillers were coached in 1979 and 1980 by Hans Kraay, who brought a number of players with him from the Netherlands. After Kraay, Timo Liekoski took over as coach in 1981, while Patrone would serve as the team's final caretaker coach until the team folded at the end of the 1982 season. During the outdoor season, the Drillers played their home games at Commonwealth Stadium, but dwindling crowds during the final year saw the team move to much older and ...
... is a compilation album featuring songs from various artists in all genres of popular music. The songs were picked from among some of the most popular during the autumn of 2006 in Australia. The album was released on 26 March 2006. Mariah Carey - "Don't Forget About Us" (3:54) Chris Brown - "Run It!" (3:14) Gwen Stefani - "Luxurious" (4:26) TV Rock - "Flaunt It" (3:29) Rogue Traders - "Watching You" (3:29) Lee Harding - "Wasabi" (3:00) The Black Eyed Peas - "My Humps" (4:12) The Pussycat Dolls - "Stickwitu" (3:29) Sugababes - "Push the Button" (3:38) Kelly Clarkson - "Walk Away" (3:08) Rihanna - "If It's Lovin' that You Want" (3:28) Daddy Yankee - "Gasolina" (3:15) Nickelback - "Far Away" (3:59) Bernard Fanning - "Wish You Well" (2:31) Pete Murray - "Class A" (3:05) Shannon Noll - "Lift" (3:57) Lindsay Lohan - "Confessions of a Broken Heart (Daughter to Father)" (3:43) Kate DeAraugo - "Maybe Tonight" (3:38) Backstreet Boys - "I Still..." (3:49) Meck featuring Leo ...
Kızılpınar Atatürk is a neighborhood in Çerkezköy district of Tekirdağ Province, Turkey. At 41°16′N 27°58′E / 41.267°N 27.967°E / 41.267; 27.967 it is almost merged to Çerkezköy. Distance to Tekirdağ is about 55 kilometres (34 mi). The population of Kızılpınar Atatürk is 22,966 "Turkstat". Turkish Statistical Institute. Retrieved 4 February 2021. "Turkstat". Turkish Statistical Institute. Retrieved 4 February 2021. Tekirdağ Governor's Official Website Metropolitan Municipality of Tekirdağ District municipality's Official Website v t e (Pages with non-numeric formatnum arguments, Articles with short description, Short description matches Wikidata, Articles needing additional references from March 2020, All articles needing additional references, Coordinates on Wikidata, AC with 0 elements, Populated places in Tekirdağ Province, Towns in Turkey, Çerkezköy District, Things named after Mustafa Kemal Atatürk, All stub articles, Marmara Region geography stubs ...
... arylalkylamine N-acetyltransferase (AANAT) is known to have recognizable ancient homologs in bacteria and fungi, but not in ... Evolution of arylalkylamine N-acetyltransferase: emergence and divergence Steven L Coon et al. Mol Cell Endocrinol. 2006. . ... Evolution of arylalkylamine N-acetyltransferase: emergence and divergence Steven L Coon 1 , David C Klein ... Evolutionary Genomics Reveals Multiple Functions of Arylalkylamine N-Acetyltransferase in Fish. Huang Y, Li J, Bian C, Li R, ...
Arylalkylamine N-acetyltransferase (AANAT) catalyzes the transfer of an acetyl group from acetyl coenzyme A (AcCoA) to ... Molecular evolution of multiple arylalkylamine N-acetyltransferase (AANAT) in fish Bina Zilberman-Peled et al. Mar Drugs. 2011. ... Molecular evolution of multiple arylalkylamine N-acetyltransferase (AANAT) in fish Bina Zilberman-Peled 1 , Sharron Bransburg- ... Subfunctionalization of arylalkylamine N-acetyltransferases in the sea bass Dicentrarchus labrax: two-ones for one two. Paulin ...
Order Human Arylalkylamine N-acetyltransferase AA-NAT ELISA Kit 01012358114 at Gentaur Arylalkylamine N-acetyltransferase,AA- ...
Arylalkylamine-N-acetyltransferase. Cachexia. Melatonin. Pineal gland.. TNF-a. Walker 256 tumor. ...
Voisin, P., Namboodiri, M.A.A. and Klein, D.C. (1984) Arylamine N-acetyltransferase and arylalkylamine N-acetyltransferase in ... Fleming, J.V., Barrett, P., Coon, S.L., Klein, D.C. and Morgan, P. J. (1999) Ovine arylalkylamine N-acetyltransferase (AANAT) ... Coon, S.L., Begay, V., Deurloo, D., Falcon, J. and Klein, D.C. (1999) Two arylalkylamine N-acetyltransferase genes mediate ... W. S., and Klein, D.C. (2002) Melatonin synthesis enzymes in Macaca mulatta: Focus on arylalkylamine N-acetyltransferase (EC ...
The rat arylalkylamine N-acetyltransferase E-box: differential use in a master vs. a slave oscillator.. Chen W, Baler R.. Brain ...
arylalkylamine N-acetyltransferase [EC:2.3.1.87]. K00681 gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4. ...
Arylalkylamine N-acetyltransferase 1 gene (TcAANAT1) is required for cuticle morphology and pigmentation of the adult red flour ...
Virtual Screening and Molecular Docking for Arylalkylamine-N-Acetyltransferase (aaNAT) Inhibitors, a Key Enzyme of Aedes ( ...
... arylalkylamine N-acetyltransferase) in the pineal gland.[15] Cortisol peak should occur in the morning in response to ...
Arylalkylamine N-acetyltransferase: "the Timezyme".. Journal of Biological Chemistry 282:4233-4237 ... MicroRNAs in the pineal gland: miR-483 regulates melatonin synthesis by targeting arylalkylamine N-acetyltransferase.. Journal ... UV-A light regulation of arylalkylamine N-acetyltransferase activity in the chick pineal gland: role of cAMP and proteasomal ... arylalkylamine N-acetyltransferase), which is essential for the synthesis of melatonin from serotonin (Klein, 2006; Klein, 2007 ...
AA-NAT is an acronym for arylalkylamine N-acetyltransferase. AAP is an acronym for American Academy of Pediatrics. AAPFcmk is ...
... strigiform and caprimulgiform dark-activity is supported by phylogenetic analysis using the arylalkylamine N-acetyltransferase ...
ARYLALKYLAMINE-N-ACETYLTRANSFERASE was indexed under ARYLAMINE N-ACETYLTRANSFERASE 1986-2004; for SEROTONIN ACETYLTRANSFERASE ... Arylalkylamine N-Acetyltransferase Preferred Term Term UI T174817. LexicalTag NON. ThesaurusID NLM (2005). ... Arylalkylamine N-Acetyltransferase Preferred Concept UI. M0144812. Registry Number. EC 2.3.1.87. Scope Note. An ... Acetyltransferases [D08.811.913.050.134] * Acetyl-CoA C-Acetyltransferase [D08.811.913.050.134.025] * Acyl-Carrier Protein S- ...
mRNA level of arylalkylamine-N-acetyltransferase (AANAT2), a key enzyme of melatonin synthesis, is reduced in hcrtr-/- pineal ...
E4.555.110.115 Arylalkylamine N-Acetyltransferase D8.811.913.50.294 D8.811.913.50.134.127 Arylamine N-Acetyltransferase D8.811. ...
ARYLALKYLAMINE-N-ACETYLTRANSFERASE was indexed under ARYLAMINE N-ACETYLTRANSFERASE 1986-2004; for SEROTONIN ACETYLTRANSFERASE ... Arylalkylamine N-Acetyltransferase Preferred Term Term UI T174817. LexicalTag NON. ThesaurusID NLM (2005). ... Arylalkylamine N-Acetyltransferase Preferred Concept UI. M0144812. Registry Number. EC 2.3.1.87. Scope Note. An ... Acetyltransferases [D08.811.913.050.134] * Acetyl-CoA C-Acetyltransferase [D08.811.913.050.134.025] * Acyl-Carrier Protein S- ...
Arylalkylamine N-acetyltransferase: "the Timezyme". J Biol Chem. 2007;282(7):4233-7. ... Kleins research has focused on the enzyme responsible for serotonin acetylation, arylalkylamine N-acetyltransferase (AANAT), ...
arylalkylamine N-acetyltransferase. 0.021. Trib3. tribbles homolog 3 (Drosophila). 0.021. Fermt3. fermitin family homolog 3 ( ...
Arylalkylamine N-acetyltransferase (AANAT) genotype as a personal trait in melatonin synthesis. Journal of toxicology and ...
Serotonin is converted to N-acetylserotonin by Arylalkylamine N-acetyltransferase (AA-NAT) which is then catalyzed by N- ...
... acetylthymidine acetyltransferase acetyl transferase acetyl-transferase acetyltransferases acetyl transferases acetyl- ... arylacetyl-transferase arylacylhydroxamic arylalkanoic arylalkyl arylalkyl acylamidase arylalkyl acylamidases arylalkylamine ... alcohol abuse alcohol acetyltransferase alcohol acetyltransferase I alcohol acetyltransferase II alcohol acetyltransferases ... acetylchondrosine acetylchondrosines acetylCoA acetyl CoA acetyl-CoA acetyl CoA acetyltransferase acetyl-CoA acetyltransferase ...
Resequencing and association analysis of arylalkylamine N-acetyltransferase (AANAT) gene and its contribution to major ...
Ligand for melatonin rhythm enzyme arylalkylamine-N-acetyltransferase (AANAT). References:. E. M. Khalil and P. A. Cole, J. Am ...
Receptor Nuclear Translocator N0000168165 Arylalkylamine N-Acetyltransferase N0000168154 Arylamine N-Acetyltransferase ... Amino Acyl-tRNA Synthetases N0000007838 Amino Alcohols N0000008208 Amino Sugars N0000168141 Amino-Acid N-Acetyltransferase ... Acetrizoic Acid N0000170827 Acetyl Coenzyme A N0000179292 acetyl sulfisoxazole N0000168145 Acetyl-CoA C-Acetyltransferase ... Protein N0000170825 Acyl Coenzyme A N0000178793 Acyl-Butyrolactones N0000168143 Acyl-Carrier Protein S-Acetyltransferase ...
Cloning of an arylalkylamine N-acetyltransferase (aaNAT1) from Drosophila melanogaster expressed in the nervous system and the ... Isolation and characterization of an arylalkylamine N-acetyltransferase from. Drosophila melanogaster. FEBS Lett 375:148-50 ... Purification, cloning, and characterization of a second arylalkylamine N-acetyltransferase from drosophila melanogaster. DNA ... Polymorphisms of N-acetyltransferase genes. Xenobiotica 22:1073-81. *Graf T, Broly F, Hoffmann F, Probst M, Meyer UA, Howald H ...
Evidence that Proline Focuses Movement of the Floppy Loop of Arylalkylamine N-Acetyltransferase J. Pavlicek, S. L. Coon, S. ...
Arylalkylamine N-Acetyltransferase. *arylamidase. *arylamine. *arylamine acetyltransferase. *arylamine N-acetyltransferase. * ...
  • 2004. Convergent evolution of strigiform and caprimulgiform dark-activity is supported by phylogenetic analysis using the arylalkylamine N-acetyltransferase (Aanat) gene. (tolweb.org)
  • Profiles of melatonin circulation in carp [ 20 ] exhibit precise diurnal rhythms with a peak during the dark-phase and nadir during the photo-phase and primarily such rhythms are from pineal Arylalkylamine N-Acetyltransferase (AANAT) [ 7 ]. (rroij.com)
  • Arylalkylamine N-acetyltransferase (AANAT) genotype as a personal trait in melatonin synthesis. (cdc.gov)
  • Activation of PKA then leads to the activation of an enzyme called arylalkylamine N-acetyltransferase (AANAT). (nootropicsdepot.com)
  • An action spectrum was obtained for the suppression of arylalkylamine N-acetyltransferase (NAT) activity in the two-spotted spider mite Tetranychus urticae by irradiating the mite with monochromatic lights of various wavelengths using the Okazaki Large Spectrograph at the National Institute for Basic Biology, Okazaki, Japan. (soken.ac.jp)
  • 5-HTP is converted to serotonin by the aromatic amino acid decarboxylase, and serotonin is subsequently converted into N-acetylserotonin (NAS) by the enzyme arylalkylamine N-acetyltransferase. (hindawi.com)
  • An acetyltransferase with specificity towards the amine group of aromatic alkylamines (arylalkylamines) such as SEROTONIN . (bvsalud.org)
  • This enzyme is also referred to as serotonin acetylase despite the fact that serotonin acetylation can also occur through the action of broad specificity acetyltransferases such as ARYLAMINE N-ACETYLTRANSFERASE. (bvsalud.org)
  • Morrissey, JJ & Lovenberg, W 1978, ' Protein synthesis in pineal gland during serotonin-N-acetyltransferase induction ', Archives of Biochemistry and Biophysics , vol. 191, no. 1, pp. 1-7. (wustl.edu)
  • Protein synthesis in the cultured rat pineal gland was monitored during the course of N-acetyltransferase induction by (l-isoproterenol or dibutyryl cyclic AMP. (wustl.edu)
  • The detection of melatonin-synthesizing enzymes, N-acetyltransferase [ 14 ] and hydroxyindole -O-methyltransferase [ 15 ] in GIT and retina confirmed extra-pineal melatonin synthesis. (rroij.com)
  • Nα-acetyltransferase (Nat) performs this modification and transfers an acetyl group from acetyl-coenzyme A (acetyl-CoA) to an α-amino group from the first residue of the protein substrate. (nature.com)
  • This enzyme is also referred to as serotonin acetylase despite the fact that serotonin acetylation can also occur through the action of broad specificity acetyltransferases such as ARYLAMINE N-ACETYLTRANSFERASE . (nih.gov)
  • 22908386 "MicroRNAs in the pineal gland: miR-483 regulates melatonin synthesis by targeting arylalkylamine N-acetyltransferase" Clokie SJ, Lau P, Kim HH, Coon SL, Klein DC J Biol Chem. (mirbase.org)
  • The protein encoded by this gene belongs to the acetyltransferase superfamily. (nih.gov)