AnatomyOrganismsChemicals and DrugsAnalytical, Diagnostic and Therapeutic Techniques and EquipmentPhenomena and ProcessesDisciplines and OccupationsTechnology, Industry, AgricultureInformation ScienceHealth Care
ArabinoseAraC Transcription FactorXyloseMonosaccharidesPentosesXylansGalactansActinomycetalesGenes, araCPolysaccharidesCarbohydratesGalactoseGlycoside HydrolasesCarbohydrate MetabolismRNA, Ribosomal, 16SCell WallFermentationDNA, RibosomalMolecular Sequence DataBase CompositionMicromonosporaceaeDNA, BacterialEscherichia coliGene Expression Regulation, BacterialRhamnoseSoil MicrobiologyEscherichia coli ProteinsPhylogenyOperonXylosidasesGordonia BacteriumBacterial Typing TechniquesSequence Analysis, DNAMethylgalactosidesLigninBacterial ProteinsTranscription Initiation, GeneticMedicago sativaAldose-Ketose IsomerasesDiaminopimelic AcidRoot Nodules, PlantArtificial Gene FusionEndo-1,4-beta XylanasesClostridium acetobutylicumPectinsGlucoseVitamin K 2RiboseFatty AcidsUronic AcidsXylitolGenes, rRNACulture Media
Arabinose
AraC Transcription Factor
A transcription factor found in BACTERIA that positively and negatively regulates the expression of proteins required for the uptake and catabolism of L-ARABINOSE.
Xylose
Monosaccharides
Simple sugars, carbohydrates which cannot be decomposed by hydrolysis. They are colorless crystalline substances with a sweet taste and have the same general formula CnH2nOn. (From Dorland, 28th ed)
Pentoses
A class of carbohydrates that contains five carbon atoms.
Xylans
Polysaccharides consisting of xylose units.
Galactans
Polysaccharides composed of repeating galactose units. They can consist of branched or unbranched chains in any linkages.
Actinomycetales
An order of gram-positive, primarily aerobic BACTERIA that tend to form branching filaments.
Genes, araC
Regulatory genes which encode a cyclic AMP receptor protein required for L-arabinose utilization in E. coli. It is an example of positive control or regulation of gene expression in the bacterial operon.
Polysaccharides
Carbohydrates
The largest class of organic compounds, including STARCH; GLYCOGEN; CELLULOSE; POLYSACCHARIDES; and simple MONOSACCHARIDES. Carbohydrates are composed of carbon, hydrogen, and oxygen in a ratio of Cn(H2O)n.
Galactose
An aldohexose that occurs naturally in the D-form in lactose, cerebrosides, gangliosides, and mucoproteins. Deficiency of galactosyl-1-phosphate uridyltransferase (GALACTOSE-1-PHOSPHATE URIDYL-TRANSFERASE DEFICIENCY DISEASE) causes an error in galactose metabolism called GALACTOSEMIA, resulting in elevations of galactose in the blood.
Glycoside Hydrolases
Carbohydrate Metabolism
Cellular processes in biosynthesis (anabolism) and degradation (catabolism) of CARBOHYDRATES.
RNA, Ribosomal, 16S
Constituent of 30S subunit prokaryotic ribosomes containing 1600 nucleotides and 21 proteins. 16S rRNA is involved in initiation of polypeptide synthesis.
Cell Wall
The outermost layer of a cell in most PLANTS; BACTERIA; FUNGI; and ALGAE. The cell wall is usually a rigid structure that lies external to the CELL MEMBRANE, and provides a protective barrier against physical or chemical agents.
Fermentation
Anaerobic degradation of GLUCOSE or other organic nutrients to gain energy in the form of ATP. End products vary depending on organisms, substrates, and enzymatic pathways. Common fermentation products include ETHANOL and LACTIC ACID.
DNA, Ribosomal
DNA sequences encoding RIBOSOMAL RNA and the segments of DNA separating the individual ribosomal RNA genes, referred to as RIBOSOMAL SPACER DNA.
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Base Composition
The relative amounts of the PURINES and PYRIMIDINES in a nucleic acid.
Micromonosporaceae
A family of gram-positive, saprophytic bacteria occurring in soil and aquatic environments.
DNA, Bacterial
Deoxyribonucleic acid that makes up the genetic material of bacteria.
Escherichia coli
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria (GRAM-NEGATIVE FACULTATIVELY ANAEROBIC RODS) commonly found in the lower part of the intestine of warm-blooded animals. It is usually nonpathogenic, but some strains are known to produce DIARRHEA and pyogenic infections. Pathogenic strains (virotypes) are classified by their specific pathogenic mechanisms such as toxins (ENTEROTOXIGENIC ESCHERICHIA COLI), etc.
Gene Expression Regulation, Bacterial
Any of the processes by which cytoplasmic or intercellular factors influence the differential control of gene action in bacteria.
Rhamnose
A methylpentose whose L- isomer is found naturally in many plant glycosides and some gram-negative bacterial lipopolysaccharides.
Soil Microbiology
The presence of bacteria, viruses, and fungi in the soil. This term is not restricted to pathogenic organisms.
Escherichia coli Proteins
Proteins obtained from ESCHERICHIA COLI.
Phylogeny
The relationships of groups of organisms as reflected by their genetic makeup.
Operon
In bacteria, a group of metabolically related genes, with a common promoter, whose transcription into a single polycistronic MESSENGER RNA is under the control of an OPERATOR REGION.
Xylosidases
A group of enzymes that catalyze the hydrolysis of alpha- or beta-xylosidic linkages. EC 3.2.1.8 catalyzes the endo-hydrolysis of 1,4-beta-D-xylosidic linkages; EC 3.2.1.32 catalyzes the endo-hydrolysis of 1,3-beta-D-xylosidic linkages; EC 3.2.1.37 catalyzes the exo-hydrolysis of 1,4-beta-D-linkages from the non-reducing termini of xylans; and EC 3.2.1.72 catalyzes the exo-hydrolysis of 1,3-beta-D-linkages from the non-reducing termini of xylans. Other xylosidases have been identified that catalyze the hydrolysis of alpha-xylosidic bonds.
Gordonia Bacterium
A genus of gram-positive BACTERIA in the family Gordoniaceae, isolated from soil and from sputa of patients with chest disorders. It is also used for biotransformation of natural products.
Bacterial Typing Techniques
Procedures for identifying types and strains of bacteria. The most frequently employed typing systems are BACTERIOPHAGE TYPING and SEROTYPING as well as bacteriocin typing and biotyping.
Sequence Analysis, DNA
A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
Methylgalactosides
Lignin
The most abundant natural aromatic organic polymer found in all vascular plants. Lignin together with cellulose and hemicellulose are the major cell wall components of the fibers of all wood and grass species. Lignin is composed of coniferyl, p-coumaryl, and sinapyl alcohols in varying ratios in different plant species. (From Merck Index, 11th ed)
Bacterial Proteins
Proteins found in any species of bacterium.
Transcription Initiation, Genetic
The process that starts the transcription of an RNA molecule. It includes the assembly of the initiation complex and establishment of the start site.
Medicago sativa
A plant species of the family FABACEAE widely cultivated for ANIMAL FEED.
Aldose-Ketose Isomerases
Enzymes that catalyze the interconversion of aldose and ketose compounds.
Diaminopimelic Acid
Root Nodules, Plant
Knobbed structures formed from and attached to plant roots, especially of LEGUMES, which result from symbiotic infection by nitrogen fixing bacteria such as RHIZOBIUM or FRANKIA. Root nodules are structures related to MYCORRHIZAE formed by symbiotic associations with fungi.
Artificial Gene Fusion
The in vitro fusion of GENES by RECOMBINANT DNA techniques to analyze protein behavior or GENE EXPRESSION REGULATION, or to merge protein functions for specific medical or industrial uses.
Endo-1,4-beta Xylanases
Enzymes which catalyze the endohydrolysis of 1,4-beta-D-xylosidic linkages in XYLANS.
Clostridium acetobutylicum
A species of gram-positive bacteria in the family Clostridiaceae, used for the industrial production of SOLVENTS.
Pectins
High molecular weight polysaccharides present in the cell walls of all plants. Pectins cement cell walls together. They are used as emulsifiers and stabilizers in the food industry. They have been tried for a variety of therapeutic uses including as antidiarrheals, where they are now generally considered ineffective, and in the treatment of hypercholesterolemia.
Glucose
A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement.
Vitamin K 2
A group of substances similar to VITAMIN K 1 which contains a ring of 2-methyl-1,4-naphthoquinione and an isoprenoid side chain of varying number of isoprene units. In vitamin K 2, each isoprene unit contains a double bond. They are produced by bacteria including the normal intestinal flora.
Ribose
A pentose active in biological systems usually in its D-form.
Fatty Acids
Organic, monobasic acids derived from hydrocarbons by the equivalent of oxidation of a methyl group to an alcohol, aldehyde, and then acid. Fatty acids are saturated and unsaturated (FATTY ACIDS, UNSATURATED). (Grant & Hackh's Chemical Dictionary, 5th ed)
Uronic Acids
Acids derived from monosaccharides by the oxidation of the terminal (-CH2OH) group farthest removed from the carbonyl group to a (-COOH) group. (From Stedmans, 26th ed)
Xylitol
A five-carbon sugar alcohol derived from XYLOSE by reduction of the carbonyl group. It is as sweet as sucrose and used as a noncariogenic sweetener.
Genes, rRNA
Genes, found in both prokaryotes and eukaryotes, which are transcribed to produce the RNA which is incorporated into RIBOSOMES. Prokaryotic rRNA genes are usually found in OPERONS dispersed throughout the GENOME, whereas eukaryotic rRNA genes are clustered, multicistronic transcriptional units.
Culture Media
Any liquid or solid preparation made specifically for the growth, storage, or transport of microorganisms or other types of cells. The variety of media that exist allow for the culturing of specific microorganisms and cell types, such as differential media, selective media, test media, and defined media. Solid media consist of liquid media that have been solidified with an agent such as AGAR or GELATIN.

The Salmonella typhi melittin resistance gene pqaB affects intracellular growth in PMA-differentiated U937 cells, polymyxin B resistance and lipopolysaccharide. (1/706)

Salmonella typhi is the causative agent of typhoid fever in humans. A cell-culture based assay involving the human monocyte macrophage cell line U937 has been developed to examine S. typhi invasion and survival. An S. typhi PhoP- (null) mutant was shown to be restricted in net growth in phorbol myristate acetate (PMA) differentiated U937 (PMA-U937) cells, and an S. typhi PhoPc (constitutive) mutant showed a defect in invasion. Neither of the phoP/Q mutants were growth impaired in HeLa cells, however the PhoPc mutant was impaired in invasion. As opposed to what was found for S. typhi, Salmonella typhimurium wild-type, PhoP- and PhoPc mutants grew equally well in PMA-U937 cells, indicating that the PhoP(-)-mediated net growth restriction in the PMA-U937 cells was S. typhi specific. An S. typhi mutation, pqaB::MudJ, recently shown to be a PhoP-activated locus, was shown to have a net growth defect in PMA-U937 cells. Sequencing of the S. typhipqaB gene revealed it had 98% identity to the fifth gene in a S. typhimurium PmrA/B regulated operon necessary for 4-aminoarabinose lipid A modification and polymyxin B resistance. The pqaB locus was regulated by PmrA/B (whose activity is modulated by PhoP-PhoQ) and the pqaB transposon mutant was sensitive to polymyxin B. The lipopolysaccharides (LPS) of S. typhi and S. typhimurium wild-type, PhoP- and PhoPc mutants, were compared by SDS-PAGE and silver staining. Differences in the LPS profile between the two Salmonella species were observed, and shown to be affected differently by the PhoPc mutation. Additionally, the pqaB::MudJ mutation affected S. typhi LPS. The effects on LPS may have ramifications for the difference between S. typhi and S. typhimurium infection of hosts.  (+info)

Effect of 9-beta-D-arabinofuranosyladenine 5'-monophosphate and 9-beta-D-arabinofuranosylhypoxanthine 5'-monophosphate on experimental herpes simplex keratitis. (2/706)

Treatment of established experimental keratitis caused by herpes simplex virus with 9-beta-d-arabinofuranosyladenine 5'-monophosphate (Ara-AMP) or 9-beta-d-arabinofuranosylhypoxanthine 5'-monophosphate (Ara-HxMP) showed that the Ara-AMP, in a concentration of 2 or 20%, had a significant effect on the keratitis but that 0.4% Ara-HxMP showed only minimal activity. Ara-AMP was also effective in the treatment of idoxuridine-resistant keratitis. No local toxicity with a high concentration (20%) of Ara-AMP was seen, but the duration of therapy was brief.  (+info)

Transcriptional activation of ydeA, which encodes a member of the major facilitator superfamily, interferes with arabinose accumulation and induction of the Escherichia coli arabinose PBAD promoter. (3/706)

Induction of genes expressed from the arabinose PBAD promoter is very rapid and maximal at low arabinose concentrations. We describe here two mutations that interfere with the expression of genes cloned under arabinose control. Both mutations map to the ydeA promoter and stimulate ydeA transcription; overexpression of YdeA from a multicopy plasmid confers the same phenotype. One mutation is a large deletion that creates a more efficient -35 region (ATCACA changed to TTCACA), whereas the other affects the initiation site (TTTT changed to TGTT). The ydeA gene is expressed at extremely low levels in exponentially growing wild-type cells and is not induced by arabinose. Disruption of ydeA has no detectable effect on cell growth. Thus, ydeA appears to be nonessential under usual laboratory growth conditions. The ydeA gene encodes a membrane protein with 12 putative transmembrane segments. YdeA belongs to the largest family of bacterial secondary active transporters, the major facilitator superfamily, which includes antibiotic resistance exporters, Lac permease, and the nonessential AraJ protein. Intracellular accumulation of arabinose is strongly decreased in mutant strains overexpressing YdeA, suggesting that YdeA facilitates arabinose export. Consistent with this interpretation, very high arabinose concentrations can compensate for the negative effect of ydeA transcriptional activation. Our studies (i) indicate that YdeA, when transcriptionally activated, contributes to the control of the arabinose regulon and (ii) demonstrate a new way to modulate the kinetics of induction of cloned genes.  (+info)

Phylogenetic analysis of Ara+ and Ara- Burkholderia pseudomallei isolates and development of a multiplex PCR procedure for rapid discrimination between the two biotypes. (4/706)

A Burkholderia pseudomallei-like organism has recently been identified among some soil isolates of B. pseudomallei in an area with endemic melioidosis. This organism is almost identical to B. pseudomallei in terms of morphological and biochemical profiles, except that it differs in ability to assimilate L-arabinose. These Ara+ isolates are also less virulent than the Ara- isolates in animal models. In addition, clinical isolates of B. pseudomallei available to date are almost exclusively Ara-. These features suggested that these two organisms may belong to distinctive species. In this study, the 16S rRNA-encoding genes from five clinical (four Ara- and one Ara+) and nine soil isolates (five Ara- and four Ara+) of B. pseudomallei were sequenced. The nucleotide sequences and phylogenetic analysis indicated that the 16S rRNA-encoding gene of the Ara+ biotype was similar to but distinctively different from that of the Ara- soil isolates, which were identical to the classical clinical isolates of B. pseudomallei. The nucleotide sequence differences in the 16S rRNA-encoding gene appeared to be specific for the Ara+ or Ara- biotypes. The differences were, however, not sufficient for classification into a new species within the genus Burkholderia. A simple and rapid multiplex PCR procedure was developed to discriminate between Ara- and Ara+ B. pseudomallei isolates. This new method could also be incorporated into our previously reported nested PCR system for detecting B. pseudomallei in clinical specimens.  (+info)

Substrate sequestration by a proteolytically inactive Lon mutant. (5/706)

Lon protein of Escherichia coli is an ATP-dependent protease responsible for the rapid turnover of both abnormal and naturally unstable proteins, including SulA, a cell division inhibitor made after DNA damage, and RcsA, a positive regulator of transcription. Lon is a multimer of identical 94-kDa subunits, each containing a consensus ATPase motif and a serine active site. We found that overexpressing Lon, which is mutated for the serine active site (LonS679A) and is therefore devoid of proteolytic activity, unexpectedly led to complementation of the UV sensitivity and capsule overproduction of a lon deletion mutant. SulA was not degraded by LonS679A, but rather was completely protected by the Lon mutant from degradation by other cellular proteases. We interpret these results to mean that the mutant LonS679A binds but does not degrade Lon substrates, resulting in sequestration of the substrate proteins and interference with their activities, resulting in apparent complementation. Lon that carried a mutation in the consensus ATPase site, either with or without the active site serine, was no longer able to complement a Deltalon mutant. These in vivo results suggest that the pathway of degradation by Lon couples ATP-dependent unfolding with movement of the substrate into protected chambers within Lon, where it is held until degradation proceeds. In the absence of degradation the substrate remains sequestered. Comparison of our results with those from a number of other systems suggest that proteins related to the regulatory portions of energy-dependent proteases act as energy-dependent sequestration proteins.  (+info)

Mapping an interface of SecY (PrlA) and SecE (PrlG) by using synthetic phenotypes and in vivo cross-linking. (6/706)

SecY and SecE are integral cytoplasmic membrane proteins that form an essential part of the protein translocation machinery in Escherichia coli. Sites of direct contact between these two proteins have been suggested by the allele-specific synthetic phenotypes exhibited by pairwise combinations of prlA and prlG signal sequence suppressor mutations in these genes. We have introduced cysteine residues within the first periplasmic loop of SecY and the second periplasmic loop of SecE, at a specific pair of positions identified by this genetic interaction. The expression of the cysteine mutant pair results in a dominant lethal phenotype that requires the presence of DsbA, which catalyzes the formation of disulfide bonds. A reducible SecY-SecE complex is also observed, demonstrating that these amino acids must be sufficiently proximal to form a disulfide bond. The use of cysteine-scanning mutagenesis enabled a second contact site to be discovered. Together, these two points of contact allow the modeling of a limited region of quaternary structure, establishing the first characterized site of interaction between these two proteins. This study proves that actual points of protein-protein contact can be identified by using synthetic phenotypes.  (+info)

Specific chromosome alterations in fluconazole-resistant mutants of Candida albicans. (7/706)

The exposure of Candida albicans to fluconazole resulted in the nondisjunction of two specific chromosomes in 17 drug-resistant mutants, each obtained by an independent mutational event. The chromosomal changes occurred at high frequencies and were related to the duration of the drug exposure. The loss of one homologue of chromosome 4 occurred after incubation on a fluconazole medium for 7 days. A second change, the gain of one copy of chromosome 3, was observed after exposure for 35 or 40 days. We found that the mRNA levels of ERG11, CDR1, CDR2, and MDR1, the candidate fluconazole resistance genes, remained either the same or were diminished. The lack of overexpression of putative drug pumps or the drug target indicated that some other mechanism(s) may be operating. The fluconazole resistance phenotype, electrophoretic karyotypes, and transcript levels of mutants were stable after growth for 112 generations in the absence of fluconazole. This is the first report to demonstrate that resistance to fluconazole can be dependent on chromosomal nondisjunction. Furthermore, we suggest that a low-level resistance to fluconazole arising during the early stages of clinical treatment may occur by this mechanism. These results support our earlier hypothesis that changes in C. albicans chromosome number is a common means to control a resource of potentially beneficial genes that are related to important cellular functions.  (+info)

Escherichia coli gene ydeA encodes a major facilitator pump which exports L-arabinose and isopropyl-beta-D-thiogalactopyranoside. (8/706)

Inactivation of the Escherichia coli gene ydeA, which encodes a member of the major facilitator superfamily, decreased the efflux of L-arabinose, thereby affecting the expression of AraC-regulated genes. In addition, overexpression of ydeA decreased the expression of genes regulated by isopropyl-beta-D-thiogalactopyranoside.  (+info)

Improving L-arabinose utilization of pentose fermenting Saccharomyces cerevisiae cells by heterologous expression of L...Improving L-arabinose utilization of pentose fermenting Saccharomyces cerevisiae cells by heterologous expression of L...
Hydrolysates of plant biomass used for the production of lignocellulosic biofuels typically contain sugar mixtures consisting mainly of D-glucose and D-xylose, and minor amounts of L-arabinose. The yeast Saccharomyces cerevisiae is the preferred microorganism for the fermentative production of ethanol but is not able to ferment pentose sugars. Although D-xylose and L-arabinose fermenting S. cerevisiae strains have been constructed recently, pentose uptake is still a limiting step in mixed sugar fermentations. Here we described the cloning and characterization of two sugar transporters, AraT from the yeast Scheffersomyces stipitis and Stp2 from the plant Arabidopsis thaliana, which mediate the uptake of L-arabinose but not of D-glucose into S. cerevisiae cells. A yeast strain lacking all of its endogenous hexose transporter genes and expressing a bacterial L-arabinose utilization pathway could no longer take up and grow with L-arabinose as the only carbon source. Expression of the heterologous
https://biotechnologyforbiofuels.biomedcentral.com/articles/10.1186/1754-6834-4-38/tables/1
Effect of C-Terminal Protein Tags on Pentitol and l-Arabinose Transport by Ambrosiozyma monospora Lat1 and Lat2 Transporters in...Effect of C-Terminal Protein Tags on Pentitol and l-Arabinose Transport by Ambrosiozyma monospora Lat1 and Lat2 Transporters in...
TY - JOUR. T1 - Effect of C-Terminal Protein Tags on Pentitol and l-Arabinose Transport by Ambrosiozyma monospora Lat1 and Lat2 Transporters in Saccharomyces cerevisiae. AU - Londesborough, John. AU - Richard, Peter. AU - Valkonen, Mari. AU - Viljanen, Kaarina. PY - 2014. Y1 - 2014. N2 - Functional expression in heterologous hosts is often less successful for integral membrane proteins than for soluble proteins. Here, two Ambrosiozyma monospora transporters were successfully expressed in Saccharomyces cerevisiae as tagged proteins. Growth of A. monospora on l-arabinose instead of glucose caused transport activities of l-arabinose, l-arabitol, and ribitol, measured using l-[1-3H]arabinose, l-[14C]arabitol, and [14C]ribitol of demonstrated purity. A. monospora LAT1 and LAT2 genes were cloned earlier by using their ability to improve the growth of genetically engineered Saccharomyces cerevisiae on l-arabinose. However, the l-arabinose and pentitol transport activities of S. cerevisiae carrying LAT1 ...
https://cris.vtt.fi/en/publications/effect-of-c-terminal-protein-tags-on-pentitol-and-l-arabinose-tra
Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. | Journal of...Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. | Journal of...
We have constructed a series of plasmid vectors (pBAD vectors) containing the PBAD promoter of the araBAD (arabinose) operon and the gene encoding the positive and negative regulator of this promoter, araC. Using the phoA gene and phoA fusions to monitor expression in these vectors, we show that the ratio of induction/repression can be 1,200-fold, compared with 50-fold for PTAC-based vectors. phoA expression can be modulated over a wide range of inducer (arabinose) concentrations and reduced to extremely low levels by the presence of glucose, which represses expression. Also, the kinetics of induction and repression are very rapid and significantly affected by the ara allele in the host strain. Thus, the use of this system which can be efficiently and rapidly turned on and off allows the study of important aspects of bacterial physiology in a very simple manner and without changes of temperature. We have exploited the tight regulation of the PBAD promoter to study the phenotypes of null ...
https://jb.asm.org/content/177/14/4121?ijkey=e05ab084d50e4ad0af49a87c8f4a0970bc7d8f3d&keytype2=tf_ipsecsha
Palatul Cenad din Arad, palate Arad, Sky TripPalatul Cenad din Arad, palate Arad, Sky Trip
Palatul Cenad din Arad si alte palate din Arad. Palatul Cenad din Arad este prezentat de Sky Trip prin obiective istorice din Arad, cu ghid turisic romanesc aflati despre Palatul Cenad din Arad
http://www.skytrip.ro/palatul-cenad-din-arad-din-judetul-arad-ob-179.html
EP 1095153 A1 20010502 - BIOLOGICAL TAGATOSE PRODUCTION BY RECOMBINANT ESCHERICHIA COLIEP 1095153 A1 20010502 - BIOLOGICAL TAGATOSE PRODUCTION BY RECOMBINANT ESCHERICHIA COLI
292123913 - EP 1095153 A1 2001-05-02 - BIOLOGICAL TAGATOSE PRODUCTION BY RECOMBINANT ESCHERICHIA COLI - [origin: WO0068397A1] This invention relates to a recombinant i Escherichia coli /i and a process for producing D-tagatose. In detail, it includes the construction of recombinant i E.coli /i harboring L-arabinose isomerase, whole-cell conversion of D-galactose into D-tagatose by recombinant i E.coli /i expressing L-arabinose isomerase, enzymatic production of D-tagatose by the extract of recombinant i E.coli /i expressing L-arabinose isomerase, and bioconversion by immobilized L-arabinose isomerase.[origin: WO0068397A1] This invention relates to a recombinant i Escherichia coli /i and a process for producing D-tagatose. In detail, it includes the construction of recombinant i E.coli /i harboring L-arabinose isomerase, whole-cell conversion of D-galactose into D-tagatose by recombinant i E.coli /i expressing L-arabinose isomerase, enzymatic production of D-tagatose by the extract of
https://data.epo.org/gpi/EP1095153A1-BIOLOGICAL-TAGATOSE-PRODUCTION-BY-RECOMBINANT-ESCHERICHIA-COLI
China Supply Sweeteners Food Grade D (-) -Arabinose Arabinose - China Arabinose, Food AdditiveChina Supply Sweeteners Food Grade D (-) -Arabinose Arabinose - China Arabinose, Food Additive
China Supply Sweeteners Food Grade D (-) -Arabinose Arabinose, Find details about China Arabinose, Food Additive from China Supply Sweeteners Food Grade D (-) -Arabinose Arabinose - Wuhan Dahua Weiye Pharmaceutical Chemical Co., Ltd.
http://whdhwy.en.made-in-china.com/product/fXaQjPUvCwWh/China-China-Supply-Sweeteners-Food-Grade-D-Arabinose-Arabinose.html
araC - Arabinose operon regulatory protein - Escherichia coli (strain K12) - araC gene & proteinaraC - Arabinose operon regulatory protein - Escherichia coli (strain K12) - araC gene & protein
Transcription factor that regulates the expression of several genes involved in the transport and metabolism of L-arabinose (PubMed:4362626, PubMed:328165, PubMed:6251457, PubMed:2962192, PubMed:6319708, PubMed:2231717, PubMed:1447222). Functions both as a positive and a negative regulator (PubMed:328165, PubMed:6251457). In the presence of arabinose, activates the expression of the araBAD, araE, araFGH and araJ promoters (PubMed:4362626, PubMed:328165, PubMed:6251457, PubMed:2962192, PubMed:6319708, PubMed:2231717, PubMed:1447222). In the absence of arabinose, negatively regulates the araBAD operon (PubMed:6251457). Represses its own transcription (PubMed:328165). Acts by binding directly to DNA (PubMed:4943786, PubMed:6251457, PubMed:2962192, PubMed:2531226, PubMed:1447222).
https://www.uniprot.org/uniprot/P0A9E0
Co-utilization of L-arabinose and D-xylose by laboratory and industrial Saccharomyces cerevisiae strains | Microbial Cell...Co-utilization of L-arabinose and D-xylose by laboratory and industrial Saccharomyces cerevisiae strains | Microbial Cell...
D-Xylose or L-arabinose-consuming S. cerevisiae strains have previously been independently developed by introduction of heterologous enzymes necessary for the assimilation of either of the sugars [6, 7, 10-12]. However, co-fermentation of the two pentose sugars by S. cerevisiae has not, to the best of our knowledge, previously been reported. We have introduced both the arabinose and the xylose pathways in S. cerevisiae strains to investigate the effects and possible limitations of the combined metabolism of the two pentoses. Xylose utilization was enabled by overexpression of the P. stipitis genes coding for XR and XDH as well as the endogenous XK through chromosomal integration. Arabinose assimilation was enabled through heterologous expression of the bacterial arabinose pathway consisting of L-arabinose isomerase (AraA), L-ribulokinase (AraB) and L-ribulose-5-P-4-epimerase (AraD) genes.. The combination of xylose and arabinose pathways was first tested in a laboratory strain. However, ...
https://microbialcellfactories.biomedcentral.com/articles/10.1186/1475-2859-5-18
ʿArad | Israel | Britannica.comʿArad | Israel | Britannica.com
ʿArad: ʿArad, town, southern Israel, in the northeast Negev, named for the biblical Arad, the ruins of which are visible at Tel ʿArad, about 5 12 miles (9 km) east-northeast. The
https://www.britannica.com/place/Arad-Israel
Characterization of an L-arabinose isomerase from Bacillus coagulans NL01 and its application for D-tagatose production |...Characterization of an L-arabinose isomerase from Bacillus coagulans NL01 and its application for D-tagatose production |...
Background L-arabinose isomerase (AI) is a crucial catalyst for the biotransformation of D-galactose to D-tagatose. In previous reports, AIs from thermophilic bacterial strains had been wildly...
https://rd.springer.com/article/10.1186/s12896-016-0286-5
Team:Calgary/Parts/Characterization - 2010.igem.orgTeam:Calgary/Parts/Characterization - 2010.igem.org
Figure 2 and 3 indicate the RFP output normalized with growth ratio (OD) at different levels of arabinose. Figure 1 shows that CpxR-I13507 is activated at the highest level when MalE31, the periplasmic misfolder, is expressed. This occurs around 0.2% arabinose concentration. Similar trends are observed in the case of MalE which is a periplasmic folder. MalE and MalE31 activate the system at different levels. MalE31 has similar trends to MalE but has a higher level of RFP expression. These results prove that MalE and MalE31 can both activate the CpxR system however, MalE31, which misfolds, activates it more rapidly and at a lower level of arabinose concentration compared to MalE. If the line of best fit is studied, it is seen that MalE has very minimal level of Cpx activation. Whereas, malE31 has a linear regression which flattens out as the system reaches its upper threshold of detection. Biologically, this could mean that the MalE31 is activated at levels that saturate the cellular chaperones ...
http://2010.igem.org/wiki/index.php?title=Team:Calgary/Parts/Characterization&printable=yes
Production and Utilization of L-Arabinose in ChinaProduction and Utilization of L-Arabinose in China
L-arabinose is a newly developed low-caloric monosaccharide, which has many biomedical and health effects, especially intestinal sucrase inhibition effect. L-arabinose is mainly produced by chemical or enzymatic hydrolysis of hemicellulose. The taste of L-arabinose is quite similar to that of sucrose, with approximately 50% of the sweetness. As a functional additive, L-arabinose can be used in medical and pharmaceutical applications for the treatment of diseases such as diabetes, chronic constipation, mineral absorption disorder and secondary bile acid formation disorder. However, L-arabinose has not been widely used in functional foods due to high price and lack of publicity and guidance. A comprehensive review of L-arabinose physicochemical properties, production, applications field, market statue and development direction is presented in this paper.
https://scirp.org/journal/paperinformation.aspx?paperid=86537
Hotel in ARAD - ibis Styles AradHotel in ARAD - ibis Styles Arad
Ibis Styles Arad hotel makes you experience the best of modern living at the best value. All inclusive package, with breakfast and WIFI. Business and Transit, our hotel has 72 rooms Family, Double, Twin and Triple rooms including 2 rooms for guests with s
https://www.accorhotels.com/gb/hotel-A0K3-ibis-styles-arad/index.shtml
EC 2.7.1.16EC 2.7.1.16
Accepted name: ribulokinase Reaction: ATP + L(or D)-ribulose = ADP + L(or D)-ribulose 5-phosphate Other name(s): ribulokinase (phosphorylating); L-ribulokinase Systematic name: ATP:L(or D)-ribulose 5-phosphotransferase Comments: Ribitol and L-arabinitol can also act as acceptors. Links to other databases: BRENDA, EXPASY, KEGG, Metacyc, PDB, CAS registry number: 9030-57-3. References: 1. Burma, D.P. and Horecker, B.L. Pentose fermentation by Lactobacillus plantarum. III. Ribulokinase. J. Biol. Chem. 231 (1958) 1039-1051. 2. Lee, N. and Bendet, I. Crystalline L-ribulokinase from Escherichia coli. J. Biol. Chem. 242 (1967) 2043-2050. [PMID: 5336963] 3. Simpson, F.J., Wolin, M.J. and Wood, W.A. Degradation of L-arabinose by Aerobacter aerogenes. I. A pathway involving phosphorylated intermediates. J. Biol. Chem. 230 (1958) 457-472. ...
http://www.sbcs.qmul.ac.uk/iubmb/enzyme/EC2/7/1/16.html
Reconstitution of Sec‐dependent membrane protein insertion: nascent FtsQ interacts with YidC in a SecYEG‐dependent manner |...Reconstitution of Sec‐dependent membrane protein insertion: nascent FtsQ interacts with YidC in a SecYEG‐dependent manner |...
YidC is a polytopic inner membrane protein with a molecular mass of 60 kDa. To facilitate its purification, a histidine tag was introduced at the C‐terminus of YidC, and the gene was placed under control of the lac promoter yielding the expression vector pEH1hisYidC. To determine whether His‐tagged YidC is functional in vivo, pEH1hisYidC was transformed to the YidC depletion strain JS7131 (Samuelson et al., 2000). In this strain, the chromosomal yidC gene is disrupted and an intact yidC gene under control of the araBAD promoter has been introduced. JS7131 is not viable on Luria-Bertani (LB) agar plates containing 0.2% glucose, since under these conditions expression of yidC from the araBAD promoter is tightly repressed. Transformation with pEH1hisYidC restored growth of JS7131 in the presence of glucose (Figure 1A), indicating that plasmid‐encoded, His‐tagged YidC is functional. For overproduction, pEH1hisYidC was transformed to strain E. coli SF100 (Baneyx and Georgiou, 1990). YidC ...
http://embor.embopress.org/content/2/6/519
L-Arabinose | The Ingredient HouseL-Arabinose | The Ingredient House
L Arabinose is a monosaccharide containing 5 carbon atoms. L-Arabinose is a white crystalline powder with a sweetness about 50% of that of sugar. ...
http://theingredienthouse.com/product/l-arabinose/
Team:UC Davis/Modeling - 2013.igem.orgTeam:UC Davis/Modeling - 2013.igem.org
The subsequent equations model the probability of active complex for each element in our circuit. PBAD represents the probability that the pBAD promoter will be unbound by araC and thus active. PTET represents the probability that the pTET promoter will be unbound by tetR and thus active. PRiboswitch expresses the probability that the riboswitch is bound by theophylline, and thus active. For simplicity, it has been modeled here as an activator-controlled promoter. PTale Binding Site, which may be abbreviated to PTBS expresses the probability that the TALe binding site is unbound by the TAL repressor, and thus active ...
http://2013.igem.org/wiki/index.php?title=Team:UC_Davis/Modeling&oldid=235206
Team:Tec-Monterrey/Geneticframe - 2010.igem.orgTeam:Tec-Monterrey/Geneticframe - 2010.igem.org
In theory, this genetic construction is able to detect different concentrations of a compound provided that you have three different promoters that are sensitive to different concentrations of the substance. Based on the amount of compound detected, the bacteria will produce one of three reporter proteins. For our project, we decided to use the same sensors and reporter proteins that the University of British Columbia team used in their 2009 iGEM project. Therefore we began with 3 promoters: pBAD wild type, pBAD weak and pBAD strong; each promoter was able to detect arabinose at different concentrations. Our reporter proteins were GFP, YFP, and RFP (Cherry). We arranged the constructions so that GFP is produced when the cells were induced with low concentrations of arabinose, YFP is produced when induced with medium concentrations and RFP (Cherry) is produced when there is a high concentration. The mechanism that enables this behavior will be explained in two parts, the first part involves the ...
http://2010.igem.org/wiki/index.php?title=Team:Tec-Monterrey/Geneticframe&direction=next&oldid=205374
Contact us - Refined D-xylose and L-arabinose Manufacturer Healtang Biotech Co.,Ltd.Contact us - Refined D-xylose and L-arabinose Manufacturer Healtang Biotech Co.,Ltd.
Healtang Biotech Co.,Ltd is one of the biggest companies in manufacturering L-arabinose and D-xylose in China, our products are extracted from Corn Cob via Fermentation method.
http://www2.healtang.com/En/About.asp?ID=4
KEGG SSDB Paralog Search Result: ara:Arad 4687KEGG SSDB Paralog Search Result: ara:Arad 4687
T00850 (acav,adh,amin,apom,arn,arx,asoc,ato,bacs,balt,bara,barw,bcae,bko,camg,cmb,def,fln,frm,gli,gtm,lagl,les,lzy,mbov,mee,ntp,ntt,parb,part,pcx,pht,ppoa,ptu,rhu,sbj,sgv,slau,smal,sphd,sscu,sya,tpaf,trl : calculation not yet completed ...
http://www.kegg.jp/ssdb-bin/ssdb_paralog?org_gene=ara:Arad_4687
KEGG SSDB Paralog Search Result: ara:Arad 1718KEGG SSDB Paralog Search Result: ara:Arad 1718
T00850 (aof,chro,cmax,cmos,dzi,eml,fpd,goc,hae,jre,kpd,lpg,lrn,mhos,mste,msyr,nob,oeu,oor,paro,pkb,pprf,psor,pvs,pzh,salj,slim,spir,tmar : calculation not yet completed ...
http://www.kegg.jp/ssdb-bin/ssdb_paralog?org_gene=ara:Arad_1718
Water Value: Changing Our Perception - Arad GroupWater Value: Changing Our Perception - Arad Group
Water is critical to our survival & quality of life yet it costs close to nothing. This paradoxical perception must change for sustainable water management.
https://arad.co.il/blog/water-value-changing-perception/
L-Arabinose | KAZ Shop | KAZ InternationalL-Arabinose | KAZ Shop | KAZ International
KAZ L-Arabinose is a natural sugar blocker. It has GRAS (Generally Recognized as Safe) status, and blocks sugar absorption to the body.
http://kaz-international.com/store/04.html
Endy:Screening plasmid/v1.0 - OpenWetWareEndy:Screening plasmid/v1.0 - OpenWetWare
Design of Screening Plasmid 1.0: We are using the Pbad arabinose-inducible induction system [1] as a tunable input. GFP is a measure of input and RFP is a measure of output. A Biobricks cloning site enables easy insertion of any Biobricks part. RNase E sites create independence between the mRNA stability of the device being screened and the mRNA stability of the fluorescent proteins. In particular, we suspect mRFP1 contains internal RNaseE cut sites and have added a hairpin 5 of the coding region to slow degradation by RNase E. [2 ...
https://openwetware.org/wiki/Endy:Screening_plasmid/v1.0
Arabinose - Carbohydrates - LIFE SCIENCES - ProductsArabinose - Carbohydrates - LIFE SCIENCES - Products
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser. ...
https://www.iris-biotech.de/de/products/life-sciences/carbohydrates/arabinose.html
XLDNA V2 Electrocompetent cells | China-Mainland | Sigma-AldrichXLDNA V2 Electrocompetent cells | China-Mainland | Sigma-Aldrich
Transformants are grown in TB medium. Stable inserts of 10-40 kb can be grown overnight with shaking at 37 °C in the presence of 1X Arabinose Induction Solution. DNA minipreps can be performed by standard methods.. For BACs and unstable smaller inserts, it may be necessary to grow the cultures without induction to an OD600 of 0.2-0.3. To reach this OD, it is convenient to grow the cultures overnight at 37 °C without shaking. The following morning, dilute the cultures 2-10 fold, and grow at 37 °C with shaking at 225 rpm for 30 minutes. For each ml of culture, add 1 μl of 1000 X Arabinose Induction Solution. Continue growth for 2-3 hours at 37 °C with shaking at 225 rpm.. Prepare DNA minipreps according to standard protocols.. ...
https://www.sigmaaldrich.com/china-mainland/zh/technical-documents/protocols/biology/xldna-v2-electrocompetent-cells.html
Heterocyclische Verbindungen aus Zuckern, XI. Ringschlußreaktion von D‐Penicillamin mit 2,3,4,5‐Tetra‐O‐acetyl‐aldehyde‐L...Heterocyclische Verbindungen aus Zuckern, XI. Ringschlußreaktion von D‐Penicillamin mit 2,3,4,5‐Tetra‐O‐acetyl‐aldehyde‐L...
TY - JOUR. T1 - Heterocyclische Verbindungen aus Zuckern, XI. Ringschlußreaktion von D‐Penicillamin mit 2,3,4,5‐Tetra‐O‐acetyl‐aldehyde‐L‐arabinose; 13C‐NMR‐Spektren von 2‐Poly‐acetoxyalkylthiazolidin‐4‐carbonsäurederivaten. AU - Bognár, Rezső. AU - Györgydeák, Z.. AU - Szilágyi, László. AU - Sándor, Péter. AU - Radics, Lajos. PY - 1979. Y1 - 1979. N2 - Die Kondensation von D‐Penicillamin (1) mit 2,3,4,5‐Tetra‐O‐acetyl‐aldehydo‐L‐arabinose (2) er‐gibt 5,5‐Dimethyl‐2(S)‐ und 5,5‐Dimethyl‐2(R)‐(L‐arabino‐1,2,3,4 ‐tetraacetoxybutyl)thiazolidine‐4(S)‐carbonsäure (3 bzw. 4), deren Strukturen auf chemischem Wege und durch 1H‐NMR‐Spektroskopie bewiesen werden. Die 13C‐NMR‐Spektren der Methylester (5 bzw. 6) von 3 und 4, der N‐Acetylderivate (11 bzw. 13) von 5 und 6 sowie bereits beschriebener 2‐Polyacetoxyalkyl‐thiazolidin‐4‐carbonsäuren werden mitgeteilt.. AB - Die Kondensation von D‐Penicillamin (1) ...
https://hungary.pure.elsevier.com/en/publications/heterocyclische-verbindungen-aus-zuckern-xi-ringschlu%C3%9Freaktion-vo
Mutation - bisC9::Mu ctsMutation - bisC9::Mu cts
F-, [araD139]B/r, Δ(argF-lac)169, λ-, bioA24, zbh-428::Tn10, flhD5301, Δ(fruK-yeiR)725(fruA25), relA1, rpsL150(strR), bisC9::Mu cts, deoC1 ...
https://cgsc2.biology.yale.edu/Mutation.php?ID=12224
scientist working at the laboratory. Screen image of molecule ma | Almanya Lezzet Duraklarıscientist working at the laboratory. Screen image of molecule ma | Almanya Lezzet Durakları
Aradğınız Lezzetlere İlişkin Her Şey Burada www.lezzetduraklari.de lezzetduraklari.de Bir SAFİR BİLGİSAYAR markasıdır. ...
https://lezzetduraklari.de/scientist-working-at-the-laboratory-screen-image-of-molecule-ma
FOOD POISONINGFOOD POISONING
Sağlık haberleri,sağlık bilgileri ve en son çıkan tedavi yöntemleri.Sağlığınız için aradığınız her şey burada.Türkiyenin bir numaralı sağlık blogu
http://saglikligun.blogspot.com/2008/08/food-poisoning.html
Actors Touring CompanyActors Touring Company
Directing Amsterdam is a bit like working out the rules of a game, says Xia. Even deciding which actor says a particular line changes the meaning and how that line will be received is different if it comes from the mouth of a young Black man or a Jewish woman. Its a play that has taken me outside of my comfort zone as a director, but it is a piece of theatre that in every moment is fully and exhilaratingly alive.. Amsterdam is on tour across the UK from February - May 2020, for more detail click here. Photo of Maya Arad Yasur by: Liron Weissman. ...
https://www.atctheatre.com/blog/getting-to-the-heart-of-what-it-feels-like-to-be-an-outsider
Eating Right and Keeping FitEating Right and Keeping Fit
Sağlık haberleri,sağlık bilgileri ve en son çıkan tedavi yöntemleri.Sağlığınız için aradığınız her şey burada.Türkiyenin bir numaralı sağlık blogu
http://saglikligun.blogspot.com/2008/09/eating-right-and-keeping-fit.html
Publications | ROSTLAB.ORGPublications | ROSTLAB.ORG
Petrou VI, Herrera CM, Schultz KM, Clarke OB, Vendome J, Tomasek D, Banerjee S, Rajashankar KR, Dufrisne MBelcher, Kloss B, et al. Structures of aminoarabinose transferase ArnT suggest a molecular basis for lipid A glycosylation. Science. 2016 ;351(6273):608-12. ...
https://rostlab.org/research/publications?page=2&%3Bamp%3Bf%5Bauthor%5D=1409&%3Bf%5Bauthor%5D=1559&f%5Bauthor%5D=2009
Publications | ROSTLAB.ORGPublications | ROSTLAB.ORG
Petrou VI, Herrera CM, Schultz KM, Clarke OB, Vendome J, Tomasek D, Banerjee S, Rajashankar KR, Dufrisne MBelcher, Kloss B, et al. Structures of aminoarabinose transferase ArnT suggest a molecular basis for lipid A glycosylation. Science. 2016 ;351(6273):608-12. ...
https://rostlab.org/research/publications?page=2&%3Bamp%3Bf%5Bauthor%5D=1409&%3Bf%5Bauthor%5D=1778&f%5Bauthor%5D=2014
Biology-OnlineBiology-Online
Sherson S, Gy I, Medd J, Schmidt R, Dean C, Kreis M, Lecharny A, Cobbett C: The arabinose kinase, ARA1, gene of Arabidopsis is a novel member of the galactose kinase gene family. ...
https://www.biology-online.org/articles/sugar_recognition_human_galactokinase/references.html
Programming and Development - Livetiles Ltd, iSentric Ltd, Freelancer Ltd, ABN Newswire (@ABN Newswire)Programming and Development - Livetiles Ltd, iSentric Ltd, Freelancer Ltd, ABN Newswire (@ABN Newswire)
Distribution of company announcements to the professional platforms, finance portals and syndication of important corporate news to a wide variety of news aggregators and financial news systems.
http://abnnewswire.net/topics/en/54/Programming-and-Development.html
YPB Group Ltd (ASX:YPB) E-Commerce Capabilities Strengthened with New CFO - ABN Newswire (@ABN Newswire)YPB Group Ltd (ASX:YPB) E-Commerce Capabilities Strengthened with New CFO - ABN Newswire (@ABN Newswire)
Brand Protection and Consumer Connection company YPB (ASX:YPB) is pleased to announce the appointment of Adrian Tan as Group Chief Financial Officer.
http://www.abnnewswire.net/press/en/91231/
Biologically active extract from dendrobium plant, use thereof and process for preparing the same - Patent applicationBiologically active extract from dendrobium plant, use thereof and process for preparing the same - Patent application
TABLE-US-00002 TABLE 2 The possible unnatural functional group compositions for R1 and R2. Compound R1 (or R2) R2 (or R1) 1 β-Ribose β-Ribose 2 β-Ribose α-Arabinose 3 β-Ribose β-Arabinose 4 β-Ribose β-Xylose 5 β-Ribose β-Lyxose 6 β-Ribose β-Allose 7 β-Ribose β-Altrose 8 β-Ribose β-Mannose 9 β-Ribose β-Gulose 10 β-Ribose β-Idose 11 β-Ribose β-Talose 12 β-Ribose β-Tagatose 13 β-Ribose β-Fructose 14 β-Ribose β-Glucose 15 β-Ribose β-Galactose 16 β-Ribose α-Rhamnose 17 β-Ribose c-6-Deoxy-xylo-hexos-4-ulosyl 18 α-Arabinose β-Ribose 19 α-Arabinose β-Lyxose 20 α-Arabinose β-Allose 21 α-Arabinose β-Altrose 22 α-Arabinose β-Mannose 23 α-Arabinose β-Gulose 24 α-Arabinose β-Idose 25 α-Arabinose β-Talose 26 α-Arabinose β-Tagatose 27 α-Arabinose β-Fructose 28 β-Arabinose β-Ribose 29 β-Arabinose β-Lyxose 30 β-Arabinose β-Allose 31 β-Arabinose β-Altrose 32 β-Arabinose β-Mannose 33 β-Arabinose β-Gulose 34 β-Arabinose β-Idose 35 β-Arabinose ...
http://www.patentsencyclopedia.com/app/20090005324
THE BINDING OF SUGARS TO THE L-ARABINOSE-BINDING PROTEIN FROM ESCHERICHIA COLITHE BINDING OF SUGARS TO THE L-ARABINOSE-BINDING PROTEIN FROM ESCHERICHIA COLI
The sugar-binding site of the L-arabinose binding protein, an essential component of the high-affinity L-arabinose uptake system in Escherichia coli, is located deep in a cleft formed by the two domains of the protein. The site was unambiguously identified with the electron-rich substrate analog 6-bromo-6-deoxy-D-galactose in a difference Fourier analysis. The observation that the original structure might have been solved with bound L-arabinose necessitated the synthesis of the heavy-atom analog, its structure consistent with the sugar-binding specificity of the protein. Difference Fourier maps showed a peak which was partially coincident with the extraneous density found in the native map. This extraneous density was previously attributed to a bound L-arabinose molecule, and its presence accounts for early failures of difference Fourier analyses of crystals soaked in or co-crystallized with L-arabinose to locate the binding site. The location of a C6 substituent by difference Fourier ...
https://scholarship.rice.edu/handle/1911/15571
A novel L-arabinose-responsive regulator found in the rice-blast fungus Pyricularia oryzae (Magnaporthe oryzae) - omicXA novel L-arabinose-responsive regulator found in the rice-blast fungus Pyricularia oryzae (Magnaporthe oryzae) - omicX
In this study we identified the L-arabinose-responsive regulator of Pyricularia oryzae that regulates L-arabinose release and catabolism. Previously we identified the Zn2Cys6 transcription factor (TF) AraR that has this role in the Trichocomaceae family (Eurotiales), but is absent in other fungi. Candidate Zn2Cys6 TF genes were selected according to their transcript profiles on L-arabinose. Deletion mutants of these genes were screened for their growth phenotype on L-arabinose. One mutant, named Δara1, was further analyzed. Our analysis demonstrated that Ara1 from P. oryzae is the functional homolog of AraR from A. niger, while sequence analysis did not reveal significant homology between them.
https://omictools.com/e736031e03d7fd7fe1bdf52c97729137-dataset
Engineering of Pentose Transport in Saccharomyces cerevisiae for Biotechnological Applications - Research database - University...Engineering of Pentose Transport in Saccharomyces cerevisiae for Biotechnological Applications - Research database - University...
Lignocellulosic biomass yields after hydrolysis, besides the hexose D-glucose, D-xylose, and L-arabinose as main pentose sugars. In second generation bioethanol production utilizing the yeast Saccharomyces cerevisiae, it is critical that all three sugars are co-consumed to obtain an economically feasible and robust process. Since S. cerevisiae is unable to metabolize pentose sugars, metabolic pathway engineering has been employed to introduce the respective pathways for D-xylose and L-arabinose metabolism. However, S. cerevisiae lacks specific pentose transporters, and these sugars enter the cell with low affinity via glucose transporters of the Hxt family. Therefore, in the presence of D-glucose, utilization of D-xylose and L-arabinose is poor as the Hxt transporters prefer D-glucose. To solve this problem, heterologous expression of pentose transporters has been attempted but often with limited success due to poor expression and stability, and/or low turnover. A more successful approach is the ...
https://www.rug.nl/research/portal/publications/engineering-of-pentose-transport-in-saccharomyces-cerevisiae-for-biotechnological-applications
Expression of Mycobacterium tuberculosis Rv1991c using an arabinose-inducible promoter demonstrates its role as a toxin. -...Expression of Mycobacterium tuberculosis Rv1991c using an arabinose-inducible promoter demonstrates its role as a toxin. -...
Conditional gene expression systems are useful tools for studying the role of essential or toxic gene products in bacterial systems. There is a paucity of such systems available for use in the mycobacteria. The utility of the Escherichia coli arabinose-inducible system was looked into, since it is tightly controlled in response to the presence of arabinose and glucose. It was demonstrated that the P(BAD) promoter can be used to express heterologous genes in Mycobacterium smegmatis. Expression of a lacZ reporter gene demonstrated that promoter activity was inducible in response to the presence of glucose, but only on solid medium. This system was utilized to study the functional consequences of expressing one member of a putative toxin-antitoxin pair (Rv1991c). Rv1991c has homology with a number of bacterial toxins, including ChpK, MazF and PemK. A potential antitoxin gene has been identified, adjacent to Rv1991c in the genome, which was coexpressed with the toxin. Expression of the toxin alone inhibited
https://www.semanticscholar.org/paper/Expression-of-Mycobacterium-tuberculosis-Rv1991c-u-Carroll-Brown/03e22c92c7a53bd7f05e3842be3767dac1df524b
W.5484] Where to Buy Dr Oz Forskolin in Arad Romania?W.5484] Where to Buy Dr Oz Forskolin in Arad Romania?
2020.01.27 - [W.5484] Where to Buy Dr Oz Forskolin in Arad Romania?. Buy Dr Oz Forskolin Supplement in Arad Romania. Dr Oz recommends taking a Forskolin Supplement to Burn Belly Fat. A Forskolin Supplement activates your body heater and helps burn the belly body fat away.
https://clamdrain.info/where-to-buy-dr-oz-forskolin-in-arad-romania.html
D-FucoseD-Fucose
D-Fucose,6-Deoxy-D-galactose,D-galactomethylose,rhodeose,Pentaacetate,D-Fucose Pentaacetate,Oxime,D-Fucose Oxime,Phenylhydrazone,D-Fucose Phenylhydrazone,Phenylosazone,D-Fucose Phenylosazone
http://www.druglead.com/cds/d-fucose.html
Probable arabinose 5-phosphate isomerase elisa and antibodyProbable arabinose 5-phosphate isomerase elisa and antibody
Shop Probable arabinose 5-phosphate isomerase ELISA Kit, Recombinant Protein and Probable arabinose 5-phosphate isomerase Antibody at MyBioSource. Custom ELISA Kit, Recombinant Protein and Antibody are available.
https://www.mybiosource.com/protein_family.php?root=probable-arabinose-5-phosphate-isomerase
Characterization of a monoclonal antibody that recognizes an arabinosylated (1--|6)-beta-D-galactan epitope in plant complex...Characterization of a monoclonal antibody that recognizes an arabinosylated (1--|6)-beta-D-galactan epitope in plant complex...
Monoclonal antibody CCRC-M7 is representative of a group of antibodies with similar binding specificity that were generated using the plant cell-wall pectic polysaccharide, rhamnogalacturonan I, as immunogen. The epitope recognized by CCRC-M7 is present in several plant polysaccharides and membrane …
https://pubmed.ncbi.nlm.nih.gov/8529225/?dopt=Abstract
Date Latino Men In Arad, Romania - Chat To Guys OnlineDate Latino Men In Arad, Romania - Chat To Guys Online
FREE to Join & Browse - 1000s of Latino men in Arad, Romania - Interracial Dating, Relationships & Marriage with guys & males Online
https://www.interracialdatingcentral.com/members/Romania/Arad/Men/Latino/1
Best Western Central Hotel | Hotels in AradBest Western Central Hotel | Hotels in Arad
Best Western Central Hotel is a 3 Star star hotel in Arad - perfect for a short break in Romania. Book online for the lowest price.
https://www.bestwestern.co.uk/hotels/best-western-central-hotel-77547
GTOP nfar0:BAD55034.1GTOP nfar0:BAD55034.1
GT:ID BAD55034.1 GT:GENE BAD55034.1 GT:PRODUCT putative arabinosyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 194138..197380 GB:FROM 194138 GB:TO 197380 GB:DIRECTION + GB:PRODUCT putative arabinosyltransferase GB:PROTEIN_ID BAD55034.1 LENGTH 1080 SQ:AASEQ ...
http://spock.genes.nig.ac.jp/~genome/cgi-bin/mas.pl.cgi?org=nfar0&gene=BAD55034.1
Team:UNAM Genomics Mexico/Parts - 2012.igem.orgTeam:UNAM Genomics Mexico/Parts - 2012.igem.org
The characterization of this construction was made on an E.coli strain in a semi quantitative attempt. In that way, we expected that only araC was repressing the promoter because the xylR binding sites corresponds to xylR of B. subtilis. Since it requires sugars for its expression, and the system is repressed by a metabolite from the pentose metabolism pathway, we used a minimal medium, M9 (Sambrook, 1989), but we changed the glucose for arginine as carbon source in order to get the lowest interference in the expression of GFP from another monosaccharides species in the medium. We use a gradient for both, xylose and arabinose on cultures at 0.1 O.D (540 nm). We could see that the expression of GFP increases as the amount of sugars added also increases. An amount of 0.01% (g/ml) of arabinose is enough for an increase of 4 times the basal expression, and the maximum production is approximately 5 times greater for the downstream genes with 0.1%(g/ml) of arabinose. Xylose gradient had a small ...
http://2012.igem.org/wiki/index.php?title=Team:UNAM_Genomics_Mexico/Parts&diff=prev&oldid=295813
Words in 21 letters with FWords in 21 letters with F
List of all the English words with 21 letters containing letter F. aminoacyltransferases, antiferroelectrically, antiferromagnetically, arabinosyltransferase, arylsulfotransferases, arylsulphotransferase, biofunctionalisations, biofunctionalizations
https://lotsofwords.com/f/21-letters
Team:Paris/Transduction overview2 construction - 2009.igem.orgTeam:Paris/Transduction overview2 construction - 2009.igem.org
Once again after the process of obtaining FecA as a biobrick, we have to clone it into a low copy number plasmid such as psb3t5 and with an inducible promotor such as pBAD Afterwards it will be necessary to double transform it with the previous pfec construction in a FecA deleted strain and on a 1% glucose medium and 1% arabinose medium . So on the 1% arabinose medium the FecA would be expressed , translocated in the outer membrane and its constitutive activity will activated fecR and FecI and finaly pfec, and like previously the RFP will be expresed and visible. The glucose medium is a a negative control. ...
http://2009.igem.org/wiki/index.php?title=Team:Paris/Transduction_overview2_construction&oldid=144524
Team:UC Davis/Modeling - 2013.igem.orgTeam:UC Davis/Modeling - 2013.igem.org
With the parameter estimates generated from a nonlinear regression, the model displays a decrease in GFP fluorescence as induction levels of arabinose and theophylline are increased. Furthermore, the effect of the relative promoter strength is accurately reflected in the graphs generated by the model. A small relative promoter strength results in a a lower baseline fluorescence under conditions of no repression, and lower fluorescence levels across all ranges of arabinose and theophylline. This model may be used to approximate the behavior of systems under control of Anderson promoters that have been engineered to be repressible by our synthetic transcription factors, to a certain degree of accuracy. Below is our experimental data for five Anderson promoters with their reported relative promoter strengths, presented in terms of relative GFP fluorescence ...
http://2013.igem.org/wiki/index.php?title=Team:UC_Davis/Modeling&diff=361628&oldid=356529
RCSB PDB - 3QEF: The structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the...RCSB PDB - 3QEF: The structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the...
As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/structure/3QEF
abn2 - Extracellular endo-alpha-(1-|5)-L-arabinanase 2 precursor - Bacillus subtilis (strain 168) - abn2 gene & proteinabn2 - Extracellular endo-alpha-(1-|5)-L-arabinanase 2 precursor - Bacillus subtilis (strain 168) - abn2 gene & protein
Involved in the degradation of arabinan and is a key enzyme in the complete degradation of the plant cell wall. Catalyzes the internal cleavage of alpha-(1->5)-L-arabinofuranosyl residues of the alpha-1,5-L-arabinan to produce arabino-oligosaccharides and L-arabinose. It is also active toward linear branched sugar beet arabinan, and pectin from apple.
http://www.uniprot.org/uniprot/P42293
pbad/his A, B, and C pbad/myc-his A, B, and C - PDFpbad/his A, B, and C pbad/myc-his A, B, and C - PDF
pbad/his A, B, and C pbad/myc-his A, B, and C Vectors for Dose-Dependent Expression of Recombinant Proteins Containing N- or C-Terminal 6 His Tags in E. coli Catalog nos. V430-01, V Version J 29
http://docplayer.net/420150-Pbad-his-a-b-and-c-pbad-myc-his-a-b-and-c.html
Publication : USDA ARSPublication : USDA ARS
Citation: Kiszonas, A.M., Fuerst, E.P., Morris, C.F. 2013. Wheat arabinoxylan structure provides insight into function. Cereal Chemistry. 90:387-395. Interpretive Summary: Arabinoxylans have a unique structure, which contributes to their important function in plant physiology and end-use quality. The complex and heterogeneous structure leads to two very diverse fractions based on water extractability. These two fractions, WEAX and WUAX, differ in their physical properties with respect to arabinose substitution and molecular weight. This results in varied influence on end-use quality. The genetic and environmental influences on arabinoxylan molecules does not conclusively suggest complete genetic or environmental control over the abundance or structure of the molecules. Because of these varied results across many studies, and the highly variable nature of arabinoxylan influence over end-use quality, there is a wealth of research that may still be undertaken to further understand the complex ...
https://www.ars.usda.gov/research/publications/publication/?seqNo115=291152
Arai Corsair Rx7 Sale : Save up to 82%Arai Corsair Rx7 Sale : Save up to 82%
Buy arai corsair rx7 and save big - low UK Shipping & fast. Top deal of the day : Save up to 82% on arai corsair rx7 sale bargains!
http://www.smarterdeal.co.uk/search?q=arai+corsair+rx7
E. coli plasmid vector pORF5 - incomplete.E. coli plasmid vector pORF5 - incomplete.
Misc.Comments : Open reading frame vector. E.coli MC1000 = F- araD139 delta[ara,leu]7697 delta[lac]chi74 galK- galU- rpsL. Medium is 1227 LB plus ampicillin ...
http://genome-www.stanford.edu/vectordb/vector_descrip/PORF5.html
Sequence Similarity Search - BLASTSequence Similarity Search - BLAST
ara:Arad_1370 K00799 glutathione S-transferase [EC:2.5.1.18] , (GenBank) glutathione S-transferase protein (A) MLTIYGVYRSRASRNYWMAEELGIEFKSVPVIQAGRIANPLATDAPLNTTSPEFLAINPM GMIPCIKDGALVMHESLAINLYLARKYGGPLAGKTVEEEGQLLMWTMWAATEVEPYSVAL VRIYDNGLEGSEAGKAGIAVACRSLKKPLDVLEQHLQNQDYLVGDRFTVADLNTAEVLRY AQTEQPLFDSRPKVKAWIERCQSRTAYKTMQAGRAKEPA ...
http://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=ara:Arad_1370+aa
WIS Plasma Laboratory - Alexander StarobinetsWIS Plasma Laboratory - Alexander Starobinets
inproceedings{osin:2003a, author = {Osin, D. and Arad, R. and Tsigutkin, K. and Doron, R. and Starobinets, A. and Bernshtam, V. and Maron, Y. and Fruchtman, A. and Fisher, A ...
https://plasma-gate.weizmann.ac.il/index.php?mact=BibMan,cntnt01,default,0&cntnt01cite_key=osin%3A2003a&cntnt01export=bibtex&cntnt01returnid=117
Banat & CrisanaBanat & Crisana
Romania group tours, Banat & Crisana group tours, group tours 2017 Romania, adventure tours in Banat & Crisna, visit Timisoara, visit Arad, visit Oradea, personalized travel in Romania, vacation in Romania, vacation in Banat & Crisana, travel offers 2017 in Romania, explore Banat & Crisana, visit Romania 2017
http://ciel-voyages.eu/banat-crisana.html
Products in Polymers, Spectrum Chemical on Thomas ScientificProducts in Polymers, Spectrum Chemical on Thomas Scientific
* found in: Arabinogalactan, ARABINOGALACTAN is a biopolymer containing galactose and arabinose monosaccharides. It is a component of many gum plants and..
http://www.thomassci.com/nav/cat1/polymers/manufacturer/spectrumchemical/0
Tikkie and FinDock team up for Salesforce | by ABN AMRO | ABN AMRO Developer Blog | MediumTikkie and FinDock team up for Salesforce | by ABN AMRO | ABN AMRO Developer Blog | Medium
In an exclusive arrangement with ABN AMRO Tikkie, FinDock is launching full Tikkie integration enabling Salesforce customers of any size to use Tikkie directly from within Salesforce. With over 6…
https://medium.com/abn-amro-developer/tikkie-and-findock-team-up-for-salesforce-e7d4f6752801
Berk2010-Conor - OpenWetWareBerk2010-Conor - OpenWetWare
Transposition Buffer: Added 1.0165mg to each mL of NEB2 (MgCl2 tetrahydrate is 203.3g/mol and were attempting to copy a transposition buffer that contains 150mM of MgCl2). We added 36.6mg of MgCl2 to 32.4mL of water and 3.6mL of 10xNEB2 to make 150mM MgCl2 NEB2. We also added 5 drops of diluted HCl (tube labeled diluted HCl... we made it my dipping a pasteur pipette in the 12M HCL and then in 50mL of mgH20) to bring the pH from 7.8 to 7.6 or so. Spun down all 5mLs of cells and 1uL of control cells (no ara). Resuspended in NEB2+MgCl2 buffer. Transferred control into a tube. Combined all 5mL resuspended cells into one tube, and then separated into 5 tubes. Added 1uL of atc and 10uL of arabinose to each mL of cells at 1:05pm. Put in 37deg shaker. Started adding DNA at 1:40pm. For DNA, we mixed two minipreps of 9145-1144. Well, we mixed them after adding DNA from one of the MPs to the 1uL tubes and the 13 .5uL tube (Whoops). Somehow, we ran out of MP, so were only adding up to 10uL of DNA. Time ...
https://openwetware.org/wiki/?title=Berk2010-Conor&oldid=444701
Benitec Biopharma Limited - ABN, ACN, Business names, Former namesBenitec Biopharma Limited - ABN, ACN, Business names, Former names
Detailed company information about Benitec Biopharma Limited. ABN, ACN, ABR, former names, business names, trading names and other information - all in one place
http://www.aubiz.net/company/benitec-biopharma-limited-068943662/
Brenfield Pty Ltd - ABN, ACN, Business names, Former namesBrenfield Pty Ltd - ABN, ACN, Business names, Former names
Detailed company information about Brenfield Pty Ltd. ABN, ACN, ABR, former names, business names, trading names and other information - all in one place
http://www.aubiz.net/company/brenfield-pty-ltd-009138130/
Phenomenex HPLC Application #17937: ABN Mix on Synergi 4u Hydro-RP 150x4.6Phenomenex HPLC Application #17937: ABN Mix on Synergi 4u Hydro-RP 150x4.6
HPLC Application #17937: ABN Mix on Synergi 4u Hydro-RP 150x4.6. Column used: Synergi™ 4 µm Hydro-RP 80 Å, LC Column 150 x 4.6 mm, Ea Part#: 00F-4375-E0
http://www.phenomenex.com/Application/Detail/17937
Immune Support Gummies by Airborne® ABN18572 - OnTimeSupplies.comImmune Support Gummies by Airborne® ABN18572 - OnTimeSupplies.com
Discover Airborne® Immune Support Gummies ABN18572 and other low cost First Aid & Health Supplies with speedy delivery from OnTimeSupplies.com!
https://www.ontimesupplies.com/abn18572-immune-support-gummies-assorted-flavors-21-bottle.html
Wohl degradationWohl degradation
The classic example is the conversion of glucose to arabinose as shown below. The reaction is named after the German chemist ... Braun, Géza (1940). "D-Arabinose". Organic Syntheses. 20: 14.; Collective Volume, 3, p. 101. Clarke, H. T.; Nagy, S. M. (1940 ...
https://en.wikipedia.org/wiki/Wohl_degradation
D-arabinonolactonaseD-arabinonolactonase
Oxidation of D-arabinose". Journal of Bacteriology. 74 (2): 180-5. PMC 289912. PMID 13475218. Biology portal v t e. ...
https://en.wikipedia.org/wiki/D-arabinonolactonase
HomopolysaccharideHomopolysaccharide
A polysaccharide of arabinose 5. Xylan - A polysaccharide of xylose Champe, Harvey, Ferrier. Biochemistry 4th Edition. 2008. 90 ...
https://en.wikipedia.org/wiki/Homopolysaccharide
RibulokinaseRibulokinase
Simpson FJ, Wolin MJ, Wood WA (1958). "Degradation of L-arabinose by Aerobacter aerogenes. I. A pathway involving ...
https://en.wikipedia.org/wiki/Ribulokinase
L-ribulose-5-phosphate 4-epimeraseL-ribulose-5-phosphate 4-epimerase
The arabinose system enables the take up the pentose L-arabinose, and then the conversion of intracellular arabinose in three ... Ribulose 5-phosphate 4-epimerase is found on the well studied L-arabinose operon. This operon consists of eight genes araA-araH ... WOLIN MJ, SIMPSON FJ, WOOD WA (1958). "Degradation of L-arabinose by Aerobacter aerogenes. III Identification and properties of ... Schlelf, Robert (December 2000). "Regulation of the L-arabinose operon of Escherichia coli". Trends in Genetics. 16 (12): 559- ...
https://en.wikipedia.org/wiki/L-ribulose-5-phosphate_4-epimerase
Catabacter hongkongensisCatabacter hongkongensis
They produce acid from arabinose, glucose and xylose. They do not produce indole or reduce nitrate. Symptoms of C. ...
https://en.wikipedia.org/wiki/Catabacter_hongkongensis
VidarabineVidarabine
... is an analog of adenosine with the D-ribose replaced with D-arabinose. As you can see from figure 1.1 that it is a ... which contained D-arabinose rather than D-ribose. These compounds led to the synthesis of a new generation, sugar modified ...
https://en.wikipedia.org/wiki/Vidarabine
InducerInducer
In the ara operon, arabinose is the inducer. Index inducer or just inducer predictably induce metabolism via a given pathway ...
https://en.wikipedia.org/wiki/Inducer
L-arabinonolactonaseL-arabinonolactonase
Weimberg R, Doudoroff M (December 1955). "The oxidation of L-arabinose by Pseudomonas saccharophila". The Journal of Biological ...
https://en.wikipedia.org/wiki/L-arabinonolactonase
ArabinosyltransferaseArabinosyltransferase
An arabinosyltransferase is a transferase enzyme acting upon arabinose. This enzyme is involved in polymerisation of ... since the arabinose residues occur only in a furanose form. This enzyme has important clinical applications as it is believed ...
https://en.wikipedia.org/wiki/Arabinosyltransferase
OpineOpine
For example, agrocinopine A is a phosphodiester of sucrose and L-arabinose. The name opine comes from octopine, the first opine ... Agrocinopine A is phosphodiester of sucrose and L-Arabinose. Agrocinopine B is the corresponding phosphodiester, in which the ...
https://en.wikipedia.org/wiki/Opine
Fétizon oxidationFétizon oxidation
Formation of Tetroses from D-Xylose and L-Arabinose". Acta Chem. Scand. 26: 1709-1710. doi:10.3891/acta.chem.scand.26-1709. ... oxidation of D-xylose and L-arabinose to D-threose and L-erythrose respectively, and oxidation of L-sorbose to afford L-threose ...
https://en.wikipedia.org/wiki/Fétizon_oxidation
Burkholderia thailandensisBurkholderia thailandensis
It is usually distinguished from B. pseudomallei by its ability to assimilate arabinose. Other differences between these ... Smith MD, Angus BJ, Wuthiekanun V, White NJ (1997). "Arabinose assimilation defines a nonvirulent biotype of Burkholderia ... Smith MD, Angus BJ, Wuthiekanun V, White NJ (1997). "Arabinose assimilation defines a nonvirulent biotype of Burkholderia ... Lertpatanasuwan N, Sermsri K, Petkaseam A, Trakulsomboon S, Thamlikitkul V, Suputtamongkol Y (1999). "Arabinose-positive ...
https://en.wikipedia.org/wiki/Burkholderia_thailandensis
Gum arabicGum arabic
Arabinogalactan is a biopolymer consisting of arabinose and galactose monosaccharides. It is a major component of many plant ... Gum arabic is a complex mixture of glycoproteins and polysaccharides predominantly consisting of arabinose and galactose. It is ...
https://en.wikipedia.org/wiki/Gum_arabic
L-arabinitol 4-dehydrogenaseL-arabinitol 4-dehydrogenase
Chiang C, Knight SG (1961). "L-Arabinose metabolism by cell-free extracts of Penicillium chrysogenum". Biochim. Biophys. Acta. ...
https://en.wikipedia.org/wiki/L-arabinitol_4-dehydrogenase
CytarabineCytarabine
Cytosine arabinoside combines a cytosine base with an arabinose sugar. It is an antimetabolic agent with the chemical name of 1 ...
https://en.wikipedia.org/wiki/Cytarabine
UTP-xylose-1-phosphate uridylyltransferaseUTP-xylose-1-phosphate uridylyltransferase
"ENZYMATIC SYNTHESIS OF URIDINE DIPHOSPHATE XYLOSE AND URIDINE DIPHOSPHATE ARABINOSE". Proc. Natl. Acad. Sci. U.S.A. 42 (6): 333 ...
https://en.wikipedia.org/wiki/UTP—xylose-1-phosphate_uridylyltransferase
ArabinogalactanArabinogalactan
Both the arabinose and galactose exist solely in the furanose configuration. The galactan portion of microbial arabinogalactan ... Arabinogalactan is a biopolymer consisting of arabinose and galactose monosaccharides. Two classes of arabinogalactans are ...
https://en.wikipedia.org/wiki/Arabinogalactan
Ruff degradationRuff degradation
In 1898, Otto Ruff published his work on the transformation of D-Glucose to D-Arabinose later called the Ruff degradation. In ... thus forming D-Arabinose. Ruff degradation shortens an aldose chain by removing one carbon v t e. ... this reaction, D-Glucose is converted to D-Arabinose . In this reaction, the terminal aldehyde group is converted to a ...
https://en.wikipedia.org/wiki/Ruff_degradation
Regulator geneRegulator gene
ISBN 978-0-7167-4939-4. Casadaban, Malcolm J. (1976-07-05). "Regulation of the regulatory gene for the arabinose pathway, araC ...
https://en.wikipedia.org/wiki/Regulator_gene
Gum arabicGum arabic
It is the original source of the sugars arabinose and ribose, both of which were first discovered and isolated from it, and are ... Arabinogalactan is a biopolymer consisting of arabinose and galactose monosaccharides. It is a major component of many plant ...
https://en.wikipedia.org/wiki/Acacia_gum
RepressorRepressor
The L-arabinose operon houses genes coding for arabinose-digesting enzymes. These function to break down arabinose as an ... In the presence of both Arabinose and araC, araC binds with the arabinose and acts as an activator. This conformational change ... In the absence of Arabinose but presence of araC, araC regions form dimers, and bind to bring ara02 and araI1 domains closer by ... In the absence of Arabinose and araC (repressor), loop formation is not initiated and structural gene expression will be lower ...
https://en.wikipedia.org/wiki/Repressor
UDP-glucuronic acid dehydrogenaseUDP-glucuronic acid dehydrogenase
A key enzyme for lipid A modification with 4-amino-4-deoxy-L-arabinose and polymyxin resistance". Biochemistry. 43 (42): 13370- ... Identification and function oF UDP-4-deoxy-4-formamido-L-arabinose". The Journal of Biological Chemistry. 280 (14): 14154-67. ... involved in 4-amino-4-deoxy-L-arabinose biosynthesis". The Journal of Biological Chemistry. 280 (24): 23000-8. doi:10.1074/jbc. ... UDP-4-amino-4-deoxy-L-arabinose formyltransferase). Breazeale SD, Ribeiro AA, McClerren AL, Raetz CR (April 2005). "A ...
https://en.wikipedia.org/wiki/UDP-glucuronic_acid_dehydrogenase
RibuloseRibulose
... sugars are composed in the pentose phosphate pathway from arabinose. They are important in the formation of many ... "Characterization of an L-Arabinose Isomerase from Bacillus velezensis and Its Application for L-Ribulose and L-Ribose ...
https://en.wikipedia.org/wiki/Ribulose
Petasis reactionPetasis reaction
Vinylboronic acid is first coupled with L-arabinose 1 and Bis(4-methoxyphenyl)methanamine 2 to form an stereochemically-defined ... Petasis used this reaction to prepare Boc-protected mannosamine from D-arabinose. With chiral amine nucleophile Generally ...
https://en.wikipedia.org/wiki/Petasis_reaction
Zymomonas mobilisZymomonas mobilis
Wild-type Z. mobilis cannot ferment C5 sugars like xylose and arabinose which are important components of lignocellulosic ... Deanda, K; Zhang, M; Eddy, C; Picataggio, S (1996). "Development of an arabinose-fermenting Zymomonas mobilis strain by ... USA has made significant contributions in expanding its substrate range to include C5 sugars like xylose and arabinose., Acetic ...
https://en.wikipedia.org/wiki/Zymomonas_mobilis
SAMHD1SAMHD1
... has been shown to be able to hydrolyze arabinose 5'-triphosphates. SAMHD1 has been shown to be a biomarker and influence ... arabinose C (ara-C; cytarabine) responsiveness. Viral protein x (Vpx) has been proposed to be potential therapy to improve ...
https://en.wikipedia.org/wiki/SAMHD1
ArabitolArabitol
It can be formed by the reduction of either arabinose or lyxose. Some organic acid tests check for the presence of D-arabitol, ...
https://en.wikipedia.org/wiki/Arabitol
Xylose isomeraseXylose isomerase
This bacterium was mistakenly classified as a L. plantarum, which normally grows on the sugar L-arabinose, and rarely grown on ... Some examples include: D-ribose, L-arabinose, L-rhamnose, and D-allose. Conversion of glucose to fructose by xylose isomerase ... and L-arabinose. Twenty hexoses and nine pentoses, including xylulose, were considered to be "rare sugars". Hence D-xylose ...
https://en.wikipedia.org/wiki/Xylose_isomerase
Cellulosic ethanolCellulosic ethanol
Karhumaa K, Wiedemann B, Hahn-Hagerdal B, Boles E, Gorwa-Grauslund MF (2006) Co-utilization of L-arabinose and D-xylose by ... Becker J, Boles E (2003). "A modified Saccharomyces cerevisiae strain that consumes L-Arabinose and produces ethanol". Appl ... and arabinose, and even both together. Yeast cells are especially attractive for cellulosic ethanol processes because they have ... a significant amount of xylose and arabinose (five-carbon sugars derived from the hemicellulose portion of the lignocellulose) ...
https://en.wikipedia.org/wiki/Cellulosic_ethanol
D-arabinose (CHEBI:17108)D-arabinose (CHEBI:17108)
D-arabinose 5-phosphate (CHEBI:79058) has functional parent D-arabinose (CHEBI:17108). aldehydo-D-arabinose (CHEBI:46983) is a ... D-arabinose (CHEBI:17108) has role Saccharomyces cerevisiae metabolite (CHEBI:75772) D-arabinose (CHEBI:17108) is a arabinose ( ... D-arabinofuranose (CHEBI:79054) is a D-arabinose (CHEBI:17108). D-arabinopyranose (CHEBI:46994) is a D-arabinose (CHEBI:17108) ... CHEBI:17108 - D-arabinose. Main. ChEBI Ontology. Automatic Xrefs. Reactions. Pathways. Models. ...
https://www.ebi.ac.uk/chebi/searchId.do?chebiId=CHEBI:17108
Arabinose - WikipediaArabinose - Wikipedia
However, L-arabinose is in fact more common than D-arabinose in nature and is found in nature as a component of biopolymers ... Arabinose gets its name from gum arabic, from which it was first isolated. In synthetic biology, arabinose is often used as a ... The operon directs the catabolism of arabinose in E. coli, and it is dynamically activated in the presence of arabinose and the ... The L-arabinose operon, also known as the araBAD operon, has been the subject of much biomolecular research. ...
https://en.wikipedia.org/wiki/Arabinose
Arabinose isomerase - WikipediaArabinose isomerase - Wikipedia
Other names in common use include D-arabinose(L-fucose) isomerase, D-arabinose isomerase, L-fucose isomerase, and D-arabinose ... In enzymology, an arabinose isomerase (EC 5.3.1.3) is an enzyme that catalyzes the chemical reaction D-arabinose ⇌ {\ ... Cohen SS (1953). "Studies on D-ribulose and its enzymatic conversion to D-arabinose". J. Biol. Chem. 201 (1): 71-84. PMID ... The systematic name of this enzyme class is D-arabinose aldose-ketose-isomerase. ...
https://en.wikipedia.org/wiki/Arabinose_isomerase
Transport and metabolism of glucose and arabinose in Bifidobacterium breve. - PubMed - NCBITransport and metabolism of glucose and arabinose in Bifidobacterium breve. - PubMed - NCBI
Arabinose uptake in B. breve was not directly dependent on phosphorylation or any other energy-linked form of transport but may ... 2-DC had no effect on arabinose uptake, but NaF was stimulatory. High levels of phosphorylation of glucose and 2-DC by PEP and ... Studies using D-[U-14C]-labelled arabinose showed that it was fermented to pyruvate, formate, lactate and acetate, whereas the ... Transport and metabolism of glucose and arabinose in Bifidobacterium breve.. Degnan BA1, Macfarlane GT. ...
https://www.ncbi.nlm.nih.gov/pubmed/8216508?dopt=Abstract
Production and Utilization of L-Arabinose in ChinaProduction and Utilization of L-Arabinose in China
L-arabinose is mainly produced by chemical or enzymatic hydrolysis of hemicellulose. The taste of L-arabinose is quite similar ... However, L-arabinose has not been widely used in functional foods due to high price and lack of publicity and guidance. A ... As a functional additive, L-arabinose can be used in medical and pharmaceutical applications for the treatment of diseases such ... L-arabinose is a newly developed low-caloric monosaccharide, which has many biomedical and health effects, especially ...
https://scirp.org/journal/paperinformation.aspx?paperid=86537
RCSB PDB - Protein Feature View - Arabinose 5-phosphate isomerase - Q60AU8 (Q60AU8 METCA)RCSB PDB - Protein Feature View - Arabinose 5-phosphate isomerase - Q60AU8 (Q60AU8 METCA)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
http://www.rcsb.org/pdb/protein/Q60AU8
SPECTRUM L-Arabinose, 1kg, CAS 5328-37-0, Poly - 46AG33|AR110-1KG - GraingerSPECTRUM L-Arabinose, 1kg, CAS 5328-37-0, Poly - 46AG33|AR110-1KG - Grainger
Looking for SPECTRUM L-Arabinose, 1kg, CAS 5328-37-0, Poly (46AG33)? Graingers got your back. Price:$1732.00. Easy ordering & ...
https://www.grainger.com/product/SPECTRUM-L-Arabinose-46AG33
87-72-9 - L-(+)-Arabinose, 99% - A11921 - Alfa Aesar87-72-9 - L-(+)-Arabinose, 99% - A11921 - Alfa Aesar
L-(+)-Arabinose is used to identify and differentiate and characterize pentose sugar isomerase. It is also used as the carbon ... A Link between Arabinose Utilization and Oxalotrophy in Bradyrhizobium japonicum. Appl. Environ. Microbiol. 2014, 80 (7), 2094- ... L-Arabinose Binding, Isomerization, and Epimerization by D-Xylose Isomerase: X-Ray/Neutron Crystallographic and Molecular ...
https://www.alfa.com/de/catalog/A11921/
Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase (Journal Article) | ETDEWEBMechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase (Journal Article) | ETDEWEB
ETDEWEB / Search Results / Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase ... Bhatnagar, D, and Bhattacharya, A K. Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase. ... Bhatnagar, D, & Bhattacharya, A K. Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase. ... title = {Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase}. author = {Bhatnagar, D, and ...
https://www.osti.gov/etdeweb/biblio/6096134
araC - Arabinose operon regulatory protein - Escherichia coli (strain K12) - araC gene & proteinaraC - Arabinose operon regulatory protein - Escherichia coli (strain K12) - araC gene & protein
In the presence of arabinose, activates the expression of the araBAD, araE, araFGH and araJ promoters (PubMed:4362626, PubMed: ... 328165, PubMed:6251457, PubMed:2962192, PubMed:6319708, PubMed:2231717, PubMed:1447222). In the absence of arabinose, ... Transcription factor that regulates the expression of several genes involved in the transport and metabolism of L-arabinose ( ... Arabinose operon regulatory proteinAdd BLAST. 292. Proteomic databases. PaxDb, a database of protein abundance averages across ...
https://www.uniprot.org/uniprot/P0A9E0
Engineering Pseudomonas putida S12 for efficient utilization of D-xylose and L-arabinose. - PubMed - NCBIEngineering Pseudomonas putida S12 for efficient utilization of D-xylose and L-arabinose. - PubMed - NCBI
Utilization of d-xylose and l-arabinose may proceed via (partly) shared pathways. Indications were found that l-arabinose can ... glucose and arabinose (B); or glucose, xylose, and arabinose (C). Data points are the averages of the results of duplicate ... Engineering Pseudomonas putida S12 for efficient utilization of D-xylose and L-arabinose.. Meijnen JP1, de Winde JH, ... Surprisingly, without any further engineering, the evolved D-xylose-utilizing strain metabolized l-arabinose as efficiently as ...
https://www.ncbi.nlm.nih.gov/pubmed?Db=pubmed&Cmd=ShowDetailView&TermToSearch=18586973
CAS No.87-72-9,L(+)-Arabinose SuppliersCAS No.87-72-9,L(+)-Arabinose Suppliers
Arabinose) for price inquiry. where to buy 87-72-9(L(+)-Arabinose).Also offer free database of 87-72-9(L(+)-Arabinose) ... Product Name: L(+)-Arabinose Synonyms: BETA-L-ARABINOPYRANOSE;BETA-L-(+)-ARABINOSE;L-(+)-ARABINOSE;Arabinose(L);L-(+)-ARABINOSE ... L-(+)-Arabinose CAS No. 87-72-9 Brand: Orchid Chemical Specifications Name L-Arabinose Synonyms L-(+)-Arabinose; L- ... Best price arabinose for hot sale/cas87-72-9 1.Basic information: 1. CAS NO.: 87-72-9 2. Appearance: White crystalline powder 3 ...
https://www.lookchem.com/cas-87/87-72-9.html
CAS No.5328-37-0,L-Arabinose SuppliersCAS No.5328-37-0,L-Arabinose Suppliers
where to buy 5328-37-0(L-Arabinose).Also offer free database of 5328-37-0(L-Arabinose) including MSDS sheet(poisoning, toxicity ... food grade Sweetener aldehydo-L-arabinose cas:5328-37-0 Product name: food grade Sweetener aldehydo-L-arabinose cas:5328-37-0 ... L-Arabinose 1) Quick Response Within 12 hours; 2) Quality Guarantee: All products are strictly tested by our QC, confirmed by ... Product Name L-Arabinose Appearance white crystalline powder CAS NO. 5328-37-0 Molecular Formula C5H10O5 Molecular Weight ...
https://www.lookchem.com/cas-532/5328-37-0.html
At5g44480 - Putative UDP-arabinose 4-epimerase 4 - Arabidopsis thaliana (Mouse-ear cress) - At5g44480 gene & proteinAt5g44480 - Putative UDP-arabinose 4-epimerase 4 - Arabidopsis thaliana (Mouse-ear cress) - At5g44480 gene & protein
UDP-arabinose 4-epimerase 1 (MUR4), Probable UDP-arabinose 4-epimerase 3 (At4g20460), Putative UDP-arabinose 4-epimerase 4 ( ... UDP-L-arabinose biosynthesis. This protein is involved in step 1 of the subpathway that synthesizes UDP-L-arabinose from UDP- ... At5g44480), Putative UDP-arabinose 4-epimerase 2 (At2g34850). This subpathway is part of the pathway UDP-L-arabinose ... Putative UDP-arabinose 4-epimerase 4Add BLAST. 436. Proteomic databases. PaxDb, a database of protein abundance averages across ...
https://www.uniprot.org/uniprot/Q9FI17
CiteSeerX - Cloning, Functional Analysis, and Transcriptional Regulation of the Bacillus subtilis araE Gene Involved in L...CiteSeerX - Cloning, Functional Analysis, and Transcriptional Regulation of the Bacillus subtilis araE Gene Involved in L...
These observations are consistent with a model according to which in the absence of L-arabinose, AraR binds to a site(s) within ... Therefore, we assume that araE encodes a permease involved in L-arabinose transport into the cell. The araE promoter region ... Transcriptional studies demonstrated that the expression from the araE promoter is induced by L-arabinose, repressed by glucose ... termed araE by analogy to the Escherichia coli L-arabinose permease gene. Here, we report the cloning and sequencing of the ...
https://citeseerx.ist.psu.edu/viewdoc/citations?doi=10.1.1.978.4954
View topic - Carbo Sep Coregel 87P and molecule of arabinose & mannose?View topic - Carbo Sep Coregel 87P and molecule of arabinose & mannose?
So, arabinose would elute ~16 min from the 87P column, but 24min on the CHO 682 column.. Have a good day ... The column Carbo Sep Coregel 87P will be a column appropriated in order to analyse the molecule of arabinose and mannose ?. ... Re: Carbo Sep Coregel 87P and molecule of arabinose & mannos. by flerfol » Tue 22 Dec 2015 10:34 ... The 87P would only provide ~30 seconds between peaks of Mannose and Arabinose. The CHO 682 column (PN: CHO-99-9854) would give ...
http://www.interchim.com/forum/post1439.html
Use of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium. | Journal of Clinical MicrobiologyUse of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium. | Journal of Clinical Microbiology
Use of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium.. M Ford, J D Perry, F K Gould ... Cephalexin-aztreonam-arabinose agar (CAA), a new selective agar, was examined in comparison with nalidixic acid-colistin agar ... Use of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium. ... Use of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium. ...
https://jcm.asm.org/content/32/12/2999?ijkey=a132e9bd5f79ed91a3c5a823ba8fd927ed2841a2&keytype2=tf_ipsecsha
Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. | Journal of...Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. | Journal of...
Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter.. L M Guzman, D Belin ... phoA expression can be modulated over a wide range of inducer (arabinose) concentrations and reduced to extremely low levels by ... We have constructed a series of plasmid vectors (pBAD vectors) containing the PBAD promoter of the araBAD (arabinose) operon ... Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. ...
https://jb.asm.org/content/177/14/4121?ijkey=e05ab084d50e4ad0af49a87c8f4a0970bc7d8f3d&keytype2=tf_ipsecsha
RCSB PDB - 1APB: A PRO TO GLY MUTATION IN THE HINGE OF THE ARABINOSE-BINDING PROTEIN ENHANCES BINDING AND ALTERS...RCSB PDB - 1APB: A PRO TO GLY MUTATION IN THE HINGE OF THE ARABINOSE-BINDING PROTEIN ENHANCES BINDING AND ALTERS...
A Pro to Gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity. Sugar-binding and ... L-arabinose binding protein-like L-arabinose-binding protein Escherichia coli [TaxId: 562] ... A PRO TO GLY MUTATION IN THE HINGE OF THE ARABINOSE-BINDING PROTEIN ENHANCES BINDING AND ALTERS SPECIFICITY: SUGAR-BINDING AND ...
http://www.rcsb.org/pdb/explore/derivedData.do?structureId=1APB
Effects of a Dietary Supplement Containing L-Arabinose and Trivalent Patented Food-source of Chromium on Blood Glucose and...Effects of a Dietary Supplement Containing L-Arabinose and Trivalent Patented Food-source of Chromium on Blood Glucose and...
Effects of a Dietary Supplement Containing L-Arabinose and Trivalent Patented Food-source of Chromium on Blood Glucose and ... A combination of l-arabinose and chromium lowers circulating glucose and insulin levels after an acute oral sucrose challenge. ... Insulin (L-Arabinose). The safety and scientific validity of this study is the responsibility of the study sponsor and ...
https://clinicaltrials.gov/ct2/show/results/NCT01107431?intr=dietary+supplements
Method of Producing Xylitol Using Hydrolysate Containing Xylose and Arabinose Prepared from Byproduct of Tropical Fruit Biomass...Method of Producing Xylitol Using Hydrolysate Containing Xylose and Arabinose Prepared from Byproduct of Tropical Fruit Biomass...
Disclosed is a method of producing xylitol using a hydrolysate containing xylose and arabinose prepared from byproducts of ... Arabinose. Xylose. Arabinose. Xylose. Arabinose. Yield. Purity. Yield. Purity. Yield. Purity. Yield. Purity. Yield. Purity. ... Method of Producing Xylitol Using Hydrolysate Containing Xylose and Arabinose Prepared from Byproduct of Tropical Fruit Biomass ... As a result, the fraction with xylose in high content and the fraction having high arabinose content can be obtained. The ...
http://www.freepatentsonline.com/y2010/0068121.html
Misdiagnosis of Cytosine arabinose syndrome - RightDiagnosis.comMisdiagnosis of Cytosine arabinose syndrome - RightDiagnosis.com
Misdiagnosis of Cytosine arabinose syndrome including hidden diseases, diagnosis mistakes, alternative diagnoses, differential ... When checking for a misdiagnosis of Cytosine arabinose syndrome or confirming a diagnosis of Cytosine arabinose syndrome, it is ... Cytosine arabinose syndrome: Medical Mistakes. Related medical mistakes may include: *Cancer Health Mistakes: *Cancer (All) -- ... Common Misdiagnoses and Cytosine arabinose syndrome. Spitz nevi misdiagnosed as dangerous melanoma skin cancer: One possible ...
https://www.rightdiagnosis.com/c/cytosine_arabinose_syndrome/misdiag.htm
Single Cell Kinetics of Phenotypic Switching in the Arabinose Utilization System of E. coliSingle Cell Kinetics of Phenotypic Switching in the Arabinose Utilization System of E. coli
Because the system is regulated via the internal arabinose level sensed by AraC, internal arabinose must be rapidly depleted by ... The model also predicts that mutations which disrupt the positive feedback of internal arabinose on the production of arabinose ... which is part of the arabinose regulon and has been annotated as a possible arabinose efflux protein, is responsible for rapid ... Here, we analyze the switching kinetics of a paradigmatic inducible system, the arabinose utilization system in E. coli. Using ...
https://epub.ub.uni-muenchen.de/33739/
Bioconversion of D-galactose to D-tagatose: continuous packed bed reaction with an immobilized thermostable L-arabinose...Bioconversion of D-galactose to D-tagatose: continuous packed bed reaction with an immobilized thermostable L-arabinose...
L-arabinose isomerase from Thermoanaerobacter mathranii (TMAI) was recombinantly overexpressed and immobilized in calcium ... The continuous enzymatic conversion of D-galactose to D-tagatose with an immobilized thermostable L-arabinose isomerase in ... Bioconversion of D-galactose to D-tagatose: continuous packed bed reaction with an immobilized thermostable L-arabinose ...
https://www.sigmaaldrich.com/catalog/papers/22038246
THE BINDING OF SUGARS TO THE L-ARABINOSE-BINDING PROTEIN FROM ESCHERICHIA COLITHE BINDING OF SUGARS TO THE L-ARABINOSE-BINDING PROTEIN FROM ESCHERICHIA COLI
... electron density allowed for a model for L-arabinose binding to the L-arabinose binding protein to be proposed. The L-arabinose ... The sugar-binding site of the L-arabinose binding protein, an essential component of the high-affinity L-arabinose uptake ... THE BINDING OF SUGARS TO THE L-ARABINOSE-BINDING PROTEIN FROM ESCHERICHIA COLI. ... The observation that the original structure might have been solved with bound L-arabinose necessitated the synthesis of the ...
https://scholarship.rice.edu/handle/1911/15571
Engineering of Saccharomyces cerevisiae for Efficient Anaerobic Alcoholic Fermentation of l-Arabinose | Applied and...Engineering of Saccharomyces cerevisiae for Efficient Anaerobic Alcoholic Fermentation of l-Arabinose | Applied and...
... plantarum arabinose isomerase for arabinose (28 mM) (11) may have contributed to the decreasing arabinose consumption rates. In ... Expression of the L. plantarum arabinose pathway in S. cerevisiae.In this work, araA (l-arabinose isomerase), araB (l- ... Production of ethanol from l-arabinose by Saccharomyces cerevisiae containing a fungal l-arabinose pathway. FEMS Yeast Res. 3: ... Although the arabinose in the anaerobic cultures was completely consumed, a decreasing arabinose consumption rate over time at ...
https://aem.asm.org/content/73/15/4881?ijkey=b8edb0eadf68bc24821c194718841383034e6eae&keytype2=tf_ipsecsha
D-Arabinose | GoldBioD-Arabinose | GoldBio
D-Arabinose is a reducing sugar useful as a substrate in analysis of arabinose isomerases and synthesis of D-erythroascorbic ... D-arabinose is converted to D-ribulose by an arabinose isomerase enzyme, which can then be phosphorylated and enter the pentose ... As opposed to most other sugars, D-arabinose, featured here, is actually less commonly found in nature than L-arabinose. ... D-Arabinose is a five-carbon reducing sugar. It is a constituent of arabinogalactans that make up the cell wall of mycobacteria ...
https://www.goldbio.com/product/1042/d-arabinose
The oxidation of L-arabinose by Pseudomonas saccharophila. - Semantic ScholarThe oxidation of L-arabinose by Pseudomonas saccharophila. - Semantic Scholar
Preliminary studies revealed that the oxidation of n-arabinose by this organism is strikingly different from that of glucose. ... The oxidation of L-arabinose by Pseudomonas saccharophila.. @article{Weimberg1955TheOO, title={The oxidation of L-arabinose by ... trifolii characterised and applied for bioconversion of l-arabinose to l-arabonate with Saccharomyces cerevisiae. *Niina Aro- ... Enzymatic Characterization of 17 L-arabinose Negative Mutants of Escherichia Coli. *ELLIS ENGLESBEIRG ...
https://www.semanticscholar.org/paper/The-oxidation-of-L-arabinose-by-Pseudomonas-Weimberg-Doudoroff/2756743364db560f3ae9a8a1010c3e217001e4ad
DIGITAL.CSIC: One-pot cascade reactions using fructose-6-phosphate aldolase: Efficient synthesis of D-arabinose 5-phosphate, D...DIGITAL.CSIC: One-pot cascade reactions using fructose-6-phosphate aldolase: Efficient synthesis of D-arabinose 5-phosphate, D...
One-pot cascade reactions using fructose-6-phosphate aldolase: Efficient synthesis of D-arabinose 5-phosphate, D-fructose 6- ... D-fructose 6-phosphate and D-arabinose 5-phosphate. The whole synthetic strategy is based on an aldol addition reaction ...
http://digital.csic.es/handle/10261/81053
Characterization of an L-arabinose isomerase from Bacillus coagulans NL01 and its application for D-tagatose production |...Characterization of an L-arabinose isomerase from Bacillus coagulans NL01 and its application for D-tagatose production |...
Background L-arabinose isomerase (AI) is a crucial catalyst for the biotransformation of D-galactose to D-tagatose. In previous ... According to the ratio (8.7: 1) between the k cat/Km for L-arabinose and D-galactose, L-arabinose was obviously a more ... The activity of BCAI crude extract was 2.3 U mg-1 for L-arabinose and 0.3 U mg-1 for D-galactose. Then, the crude extract was ... 1). But many studies showed that the catalytic efficiency (k cat/K m) of AIs for L-arabinose was generally 10 times (or higher ...
https://rd.springer.com/article/10.1186/s12896-016-0286-5
IsomeraseOperonUtilizationEnzymeXylose and arabinoseGlucose and arabinoseSucraseUptakeFunction of Arabinose concentrationSweetenerGeneGalactosePresence of L-arabinosePathwayMonosaccharidePentose sugarSmall intestineHydrolysisMannoseProteinSynthesisGenesAraCBiomassSubstrateAnaerobic growthChromiumConvertsYeastSucroseSugar BlockerPectinCatabolismSugarsFermentationConcentrationDegradationCrystallineConcentrationsBindsInducerDisplaystyleIsomerizationC5H10O5PromoterResiduesMetabolicCerevisiaeMoleculePolysaccharidesCellulose
Isomerase25
  • In enzymology, an arabinose isomerase (EC 5.3.1.3) is an enzyme that catalyzes the chemical reaction D-arabinose ⇌ {\displaystyle \rightleftharpoons } D-ribulose Hence, this enzyme has one substrate, D-arabinose, and one product, D-ribulose. (wikipedia.org)
  • The systematic name of this enzyme class is D-arabinose aldose-ketose-isomerase. (wikipedia.org)
  • Other names in common use include D-arabinose(L-fucose) isomerase, D-arabinose isomerase, L-fucose isomerase, and D-arabinose ketol-isomerase. (wikipedia.org)
  • L-(+)-Arabinose is used to identify and differentiate and characterize pentose sugar isomerase. (alfa.com)
  • Kovalevsky, A. L-Arabinose Binding, Isomerization, and Epimerization by D-Xylose Isomerase: X-Ray/Neutron Crystallographic and Molecular Simulation Study. (alfa.com)
  • An attempt has been made to find out how U.V. irradiation of E.coli B/r cells causes catabolite repression to inhibit L-arabinose isomerase synthesis. (osti.gov)
  • Bhatnagar, D, and Bhattacharya, A K. Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase. (osti.gov)
  • misc{etde_6096134, title = {Mechanism of ultraviolet light induced catabolite repression of L-arabinose isomerase} author = {Bhatnagar, D, and Bhattacharya, A K} abstractNote = {An attempt has been made to find out how U.V. irradiation of E.coli B/r cells causes catabolite repression to inhibit L-arabinose isomerase synthesis. (osti.gov)
  • Bioconversion of D-galactose to D-tagatose: continuous packed bed reaction with an immobilized thermostable L-arabinose isomerase and efficient purification by selective microbial degradation. (sigmaaldrich.com)
  • The continuous enzymatic conversion of D-galactose to D-tagatose with an immobilized thermostable L-arabinose isomerase in packed-bed reactor and a novel method for D-tagatose purification were studied. (sigmaaldrich.com)
  • L-arabinose isomerase from Thermoanaerobacter mathranii (TMAI) was recombinantly overexpressed and immobilized in calcium alginate. (sigmaaldrich.com)
  • D-arabinose is converted to D-ribulose by an arabinose isomerase enzyme, which can then be phosphorylated and enter the pentose phosphate pathway. (goldbio.com)
  • L-arabinose isomerase (AI) is a crucial catalyst for the biotransformation of D-galactose to D-tagatose. (springer.com)
  • Another method is the enzymatic process that mainly depends on L-arabinose isomerase (AI, EC 5.3.1.4). (springer.com)
  • Below are the list of possible Probable arabinose 5-phosphate isomerase products. (mybiosource.com)
  • Also known as Probable arabinose 5-phosphate isomerase (API). (mybiosource.com)
  • Gene araA encoding an l -arabinose isomerase (AraA) from the hyperthermophile, Thermotoga neapolitana 5068 was cloned, sequenced, and expressed in Escherichia coli . (oup.com)
  • The deduced amino acid sequence has 94.8% identical amino acids compared with the residues in a putative l -arabinose isomerase of Thermotoga maritima . (oup.com)
  • This chapter describes the assay method, purification procedure, and properties of L-arabinose isomerase. (sacredheartrs.org)
  • Geobacillus thermodenitrificans, with a double-site mutation in l-arabinose isomerase, produced 95 g l-ribulose l−1 from g l-arabinose l−1 under. (sacredheartrs.org)
  • In enzymology, a L-arabinose isomerase (EC ) is an enzyme that catalyzes the chemical reaction. (sacredheartrs.org)
  • In a previous work (Paveia, 1986) the structural genes for L-arabinose utilization araA, araB and araD - coding for L-arabinose isomerase, L-ribulokinase and L-ribulose 5-phosphate 4-epimerase, respectively and mutations in a presumptive regulatory gene araC were mapped. (core.ac.uk)
  • The characterization of Ara'C mutants by L-arabinose isomerase activity revealed that this activity was reduced in the presence of L-arabinose and repressed by glucose. (core.ac.uk)
  • The products of the structural genes exhibited similarity in aminoacid composition and protein sizes to the enzymes L-arabinose isomerase, L-ribulokinase and L-ribulose 5-phosphate 4-epimerase of E.coli and S.thyphimurium. (core.ac.uk)
  • The araA gene encoding L-arabinose isomerase (AI) from the hyperthermophilic bacterium Thermotoga maritima was cloned and overexpressed in Escherichia coli as a fusion protein containing a C-terminal hexahistidine sequence. (leehicam.com)
Operon9
  • The L-arabinose operon, also known as the araBAD operon, has been the subject of much biomolecular research. (wikipedia.org)
  • The operon directs the catabolism of arabinose in E. coli, and it is dynamically activated in the presence of arabinose and the absence of glucose. (wikipedia.org)
  • 3279415 ). In the absence of arabinose, AraC binds to the araO2 and araI1 half-sites in the promoter region of the araBAD operon, leading to the formation of a DNA loop that blocks access of RNA polymerase to the promoter. (uniprot.org)
  • We have constructed a series of plasmid vectors (pBAD vectors) containing the PBAD promoter of the araBAD (arabinose) operon and the gene encoding the positive and negative regulator of this promoter, araC. (asm.org)
  • Using time-lapse fluorescence microscopy of microcolonies in a microfluidic chamber, which permits sudden up-and down-shifts in the inducer arabinose, we characterize the single-cell gene expression dynamics of the araBAD operon responsible for arabinose degradation. (uni-muenchen.de)
  • High-affinity L-arabinose transport operon. (semanticscholar.org)
  • The nucleotide sequence of the 'high-affinity' L-arabinose transport operon has been determined 3' from the regulatory region and found to contain three open reading frames designated araF, araG and araH. (semanticscholar.org)
  • The L-arabinose operon of the model bacterium Escherichia coli has been a focus for research in molecular biology for over 40 years, and has been investigated extensively at the genetic , biochemical , physiological , and biophysical levels. (wikidoc.org)
  • In this thesis, we propose a Boolean model of a similar nature for the arabinose operon. (clemson.edu)
Utilization8
  • Pessi, G. A Link between Arabinose Utilization and Oxalotrophy in Bradyrhizobium japonicum. (alfa.com)
  • Engineering Pseudomonas putida S12 for efficient utilization of D-xylose and L-arabinose. (nih.gov)
  • Utilization of d -xylose and l -arabinose may proceed via (partly) shared pathways. (nih.gov)
  • Here, we analyze the switching kinetics of a paradigmatic inducible system, the arabinose utilization system in E. coli. (uni-muenchen.de)
  • This fermentation was achieved by combining the expression of the structural genes for the l -arabinose utilization pathway of Lactobacillus plantarum , the overexpression of the S. cerevisiae genes encoding the enzymes of the nonoxidative pentose phosphate pathway, and extensive evolutionary engineering. (asm.org)
  • The aim os this work was to study the genes involved in L-arabinose utilization of Bacillus subtilis. (core.ac.uk)
  • A first approach in this study, the isolation of constitutive mutants for L-arabinose utilization (Ara'c) and mapping of ara'c mutations, showed that they are located in the locus araC between the cys B and his A markers on the B.subtilis chromosome. (core.ac.uk)
  • Although l-arabinose is a highlighted pentose that has been identified as next-generation biomass, arabinose fermentation has not yet undergone extensive development for industrial utilization. (elsevier.com)
Enzyme14
  • citation needed] Originally commercialized as a sweetener, arabinose is an inhibitor of sucrase, the enzyme that breaks down sucrose into glucose and fructose in the small intestine. (wikipedia.org)
  • Yields of Larabinose recovery for the crude extract and the commercial enzyme were 17.04 % and 2.78 %, respectively, based on the reported average content of L-arabinose in mesquite gum. (redalyc.org)
  • The thermophilic enzyme had a maximum activity of l -arabinose isomerization and d -galactose isomerization at 85°C, and required divalent cations such as Co 2+ and Mn 2+ for its activity and thermostability. (oup.com)
  • The apparent K m values of the enzyme for l -arabinose and d -galactose were 116 mM ( v max , 119 μmol min −1 mg −1 ) and 250 mM ( v max , 14.3 μmol min −1 mg −1 ), respectively, that were determined in the presence of both 1 mM Co 2+ and 1 mM Mn 2+ . (oup.com)
  • Yields of L-arabinose recovery for the crude extract and the commercial enzyme were 17.04 % and 2.78 %, respectively, based on the reported average content of L-arabinose in mesquite gum. (scielo.org.mx)
  • L-arabinose - inhibits enzyme sucrase that digests sucrose, thus suppressing glycemic index and caloric impact of sugary food. (alphawellness.com.sg)
  • L-arabinose, derived from non-GMO corn cob, inhibits enzyme sucrase that digests sucrose, thus reducing sugar uptake. (alphawellness.com.sg)
  • 1.L-arabinose can be used as a sucrose enzyme inhibitor to lower the Glycaemic Index(GI) of sucrose containing products. (cbaextract.com)
  • The most representative feature of L-Arabinose is that it can selectively affect the sucrose enzyme which influences the sucrose digestion indisaccharide-hydrolysing enzymes in small intestine, and so Arabinose can well stop the absorption of sucrose in body. (cbaextract.com)
  • When consumed, L-arabinose selectively inhibits the sucrase enzyme in the small intestine. (techconnect.org)
  • During the period that the sucrase enzyme is inhibited by L-arabinose, the splitting of sucrose is delayed or even prevented, and the release of glucose and fructose to the blood is delayed. (techconnect.org)
  • This activity of L-Arabinose is selective to the sucrase enzyme. (techconnect.org)
  • Enzyme activity assays showed that the Weimberg pathway was active in cells grown, not only on xylose but also on arabinose. (mdpi.com)
  • the apparent Vmax values (at 90°C) were 41.3 U/mg (L-arabinose) and 8.9 U/mg (D-galactose), and the catalytic efficiencies (kcat/Km) of the enzyme were 74.8 mM1 min1 (L-arabinose) and 8.5 mM1 min1 (D-galactose). (leehicam.com)
Xylose and arabinose7
  • Thus, a P. putida S12-derived strain was obtained that efficiently utilizes the three main sugars present in lignocellulosic hydrolysate: glucose, xylose, and arabinose. (nih.gov)
  • or glucose, xylose, and arabinose (C). Data points are the averages of the results of duplicate measurements. (nih.gov)
  • and producing xylitol with high yield based on repeated batch fermentation using a hydrolysate containing xylose and arabinose as a carbon source. (freepatentsonline.com)
  • In addition, the present invention relates to an active carbon produced by carbonization and activation of a hydrolysate remainder of a tropical fruit shell, the byproduct of xylose and arabinose production, at a certain temperature and a preparation method of the same. (freepatentsonline.com)
  • The present invention relates to a method of producing xylitol using a hydrolysate containing xylose and arabinose prepared from a byproduct of a tropical fruit biomass. (freepatentsonline.com)
  • Wild-type strains of Saccharomyces cerevisiae , the organism used in industrial ethanol production, cannot ferment xylose and arabinose. (asm.org)
  • Here, we expanded this approach to xylose and arabinose catabolic pathway engineering and demonstrated that bioprospected xylose and arabinose catabolic pathways from U. bevomyces offer alternative choices for enabling efficient pentose catabolism in S. cerevisiae. (kist.re.kr)
Glucose and arabinose2
  • Transport and metabolism of glucose and arabinose in Bifidobacterium breve. (nih.gov)
  • In addition, efficient ethanol production from sugar mixtures containing glucose and arabinose, which is crucial for application in industrial ethanol production, was achieved. (asm.org)
Sucrase3
  • L-arabinose is a newly developed low-caloric monosaccharide, which has many biomedical and health effects, especially intestinal sucrase inhibition effect. (scirp.org)
  • L Arabinose appears to selectively inhibit the sucrase activity in the small intestine which can control the increase of blood sugar caused by intake of sugar. (theingredienthouse.com)
  • L-arabinose is a kind of aldopentoses, it's a low-calurie sweetener, it inhibits the sucrase activity and prevents increasing of blood glucose, therefore, it can prevent fat accumulation and against high blood glucose disease. (cbaextract.com)
Uptake4
  • 2-DC had no effect on arabinose uptake, but NaF was stimulatory. (nih.gov)
  • Arabinose uptake in B. breve was not directly dependent on phosphorylation or any other energy-linked form of transport but may be assimilated by glucose-dependent facilitated diffusion. (nih.gov)
  • The model also predicts that mutations which disrupt the positive feedback of internal arabinose on the production of arabinose uptake proteins change the heterogeneous on-switching behavior into a homogeneous, graded response. (uni-muenchen.de)
  • The sugar-binding site of the L-arabinose binding protein, an essential component of the high-affinity L-arabinose uptake system in Escherichia coli, is located deep in a cleft formed by the two domains of the protein. (rice.edu)
Function of Arabinose concentration2
  • Maximum luminescence output of BBa_K325219 as a function of Arabinose concentration. (igem.org)
  • Figure 1 - Light output of BBa_K325909 as a function of Arabinose concentration in the media. (igem.org)
Sweetener4
  • As a low-calorie sweetener [2] [3], L-arabinose has been approved by the American Medical Society and Japanese Ministry of Health to be used as an anti-obesity agent, nutritional supplements or prescription drugs. (scirp.org)
  • 3.Arabinose, as a low calorie sweetener, is approved to be used as a safe food additive by US FDA and Japan. (cbaextract.com)
  • 4.Arabinose is a non-calorie natural compound sweetener, and it is good to anti-obesity, prevention & cure. (cbaextract.com)
  • Arabinose, Food Additive, Food Sweetener manufacturer / supplier in China, offering China Supply Sweeteners Food Grade D (-) -Arabinose Arabinose, 99% High Purity Veterinary Drugs CAS 1392-21-8 Sineptina, 99% High Purity Powder Additive CAS: 51-35-4 L-Hydroxyproline and so on. (made-in-china.com)
Gene2
  • In this study, we integrated a heterologous fungal arabinose pathway with a deletion of PHO13 phosphatase gene. (elsevier.com)
  • PHO13 deletion increased arabinose consumption rate and specific ethanol productivity under aerobic conditions and consequently depleted sedoheptulose by activation of the TAL1 gene. (elsevier.com)
Galactose4
  • The location of a C6 substituent by difference Fourier analysis of crystals soaked in solutions of the C6 analog D-galactose and a fit of an L-arabinose molecule to the "extraneous" electron density allowed for a model for L-arabinose binding to the L-arabinose binding protein to be proposed. (rice.edu)
  • l-Arabinose/d-galactose 1-dehydrogenase of Rhizobium leguminosarum bv. (semanticscholar.org)
  • The L-Arabinose/D-Galactose test kit is a simple, reliable and accurate UV method for the measurement and analysis of L-arabinose and/or D-galactose in various materials including foods, feeds, beverages and plant products. (megazyme.com)
  • Pectin, PECTIN It consists of methylated galacturonic acid, galactose & arabinose. (expertsmind.com)
Presence of L-arabinose1
  • Figure 2 (a) shows the presence of L-arabinose in corn cob hemicellulose: the backbone is β-1,4-conjugated D-xylan, which can be combined with the hemiacetal hydroxyl of L-arabinose in the side chain at both the 2 and 3 positions of the xylose residue. (scirp.org)
Pathway7
  • Because the system is regulated via the internal arabinose level sensed by AraC, internal arabinose must be rapidly depleted by leakage or export from the cell, or by degradation via a non-canonical pathway. (uni-muenchen.de)
  • The rarity of ethanolic arabinose fermentation may be due to a redox imbalance in the fungal arabinose pathway as a result of the use of NADPH for the reductive reactions and the production of NADH in the oxidation reactions ( 6 , 36 ) (Fig. 1 ). (asm.org)
  • Verhoeven, Maarten D;Bracher, Jasmine M;Nijland, Jeroen G;Bouwknegt, Jonna;Daran, Jean-Marc G;Driessen, Arnold J M;van Maris, Antonius J A;Pronk, Jack T 2018-05-31 00:00:00 ABSTRACT Cas9-assisted genome editing was used to construct an engineered glucose-phosphorylation-negative S. cerevisiae strain, expressing the Lactobacillus plantaruml-arabinose pathway and the Penicillium chrysogenum transporter PcAraT. (deepdyve.com)
  • ABSTRACT Cas9-assisted genome editing was used to construct an engineered glucose-phosphorylation-negative S. cerevisiae strain, expressing the Lactobacillus plantaruml-arabinose pathway and the Penicillium chrysogenum transporter PcAraT. (deepdyve.com)
  • They encode the metabolic enzymes for breaking down the monosaccharide sugar arabinose into D-xylulose-5-phosphate , which is then metabolised via the pentose phosphate pathway . (wikidoc.org)
  • In addition, we suggested an alternative arabinose catabolic pathway which, after directed evolution and pathway engineering, enabled S. cerevisiae to grow on arabinose as a sole carbon source in minimal medium with growth rates upwards of 0.05 h(-1). (kist.re.kr)
  • This pathway represents the most efficient growth of yeast on pure arabinose minimal medium. (kist.re.kr)
Monosaccharide2
  • Arabinose is an aldopentose - a monosaccharide containing five carbon atoms, and including an aldehyde (CHO) functional group. (wikipedia.org)
  • L Arabinose is a monosaccharide containing 5 carbon atoms. (theingredienthouse.com)
Pentose sugar1
  • biochem a pentose sugar that is an isomeric form of arabinose and that occurs in RNA and riboflavin. (dictionary.com)
Small intestine1
  • Depending on the amount of L-arabinose in the small intestine, the digestion of sucrose is delayed and/or (partially) prevented. (techconnect.org)
Hydrolysis2
  • L-arabinose is mainly produced by chemical or enzymatic hydrolysis of hemicellulose. (scirp.org)
  • Mixtures of the α-L-arabinofuranosidases, with specific action on AXOS, have been combined with β-xylosidase and β-xylanase to obtain an optimal mixture for hydrolysis of arabinoxylan to L-arabinose and D-xylose. (megazyme.com)
Mannose2
  • Carbo Sep Coregel 87P and molecule of arabinose & mannose? (interchim.com)
  • The 87P would only provide ~30 seconds between peaks of Mannose and Arabinose. (interchim.com)
Protein5
  • In synthetic biology, arabinose is often used as a one-way or reversible switch for protein expression under the Pbad promoter in E. coli. (wikipedia.org)
  • We explored whether the poorly characterized membrane protein AraJ, which is part of the arabinose regulon and has been annotated as a possible arabinose efflux protein, is responsible for rapid depletion. (uni-muenchen.de)
  • The observation that the original structure might have been solved with bound L-arabinose necessitated the synthesis of the heavy-atom analog, its structure consistent with the sugar-binding specificity of the protein. (rice.edu)
  • Small angle X-ray scattering experiments indicate that the L-arabinose-binding protein undergoes a substantial conformational change upon the binding of substrate: the radius of gyration of the protein molecule decreases by (TURN)1 A with the addition of L-arabinose. (rice.edu)
  • If arabinose is absent, the AraC protein assumes a different conformation. (wikidoc.org)
Synthesis5
  • A classic method for the organic synthesis of arabinose from glucose is the Wohl degradation. (wikipedia.org)
  • One-pot multienzymatic reactions have been performed for the synthesis of 1-deoxy-D-fructose 6-phosphate, 1,2-dideoxy-D-arabino-hept-3-ulose 7-phosphate, D-fructose 6-phosphate and D-arabinose 5-phosphate. (csic.es)
  • L-arabinose is more common than D-arabinose in nature, it can be used as pharmaceutical intermediate, preparing culture medium and be used for synthesis in the flavour industry. (cbaextract.com)
  • 4.L-arabinose can be used as raw material for the synthesis of fine chemicals as well as pharmaceutical intermediate. (cbaextract.com)
  • Primer extension analysis and transcriptional fusions showed that the synthesis of ara mRNA is induced by L-arabinose and repressed by glucose. (core.ac.uk)
Genes2
  • Candidate Zn2Cys6 TF genes were selected according to their transcript profiles on L-arabinose. (omictools.com)
  • Deletion mutants of these genes were screened for their growth phenotype on L-arabinose. (omictools.com)
AraC1
  • To finish a construction with Pbad/araC, which is a promoter whose activity depends on addition of arabinose in medium. (igem.org)
Biomass1
  • For cost-effective and efficient ethanol production from lignocellulosic fractions of plant biomass, the conversion of not only major constituents, such as glucose and xylose, but also less predominant sugars, such as l -arabinose, is required. (asm.org)
Substrate1
  • Our synthetic endeavours en route to C-glycosidic derivatives mimicking either the transition state of glycosyl transfer or ArnT natural substrate will be presented. (eurocarb2019.com)
Anaerobic growth3
  • The resulting S. cerevisiae strain exhibited high rates of arabinose consumption (0.70 g h −1 g [dry weight] −1 ) and ethanol production (0.29 g h −1 g [dry weight] −1 ) and a high ethanol yield (0.43 g g −1 ) during anaerobic growth on l -arabinose as the sole carbon source. (asm.org)
  • This strain, which showed a growth rate of 0.26 h−1 on l-arabinose in aerobic batch cultures, was subsequently evolved for anaerobic growth on l-arabinose in the presence of d-glucose and d-xylose. (deepdyve.com)
  • Gal2N376T, T89I and Gal2T89I variants showed a lower Km for l-arabinose and a higher Km for d-glucose than wild-type Gal2, while reverting Gal2N376T, T89I to Gal2N376 in an evolved strain negatively affected anaerobic growth on arabinose. (deepdyve.com)
Chromium1
  • A combination of l-arabinose and chromium lowers circulating glucose and insulin levels after an acute oral sucrose challenge. (clinicaltrials.gov)
Converts3
  • This work reports the first one-pot enzymatic cascade which completely converts l -arabinose to l-ribulose using four reactions catalyzed by. (sacredheartrs.org)
  • PvUAM1 encodes a switchgrass homolog of UDP-arabinose mutase, which converts UDP-Ara p to UDP-Ara f . (frontiersin.org)
  • One of them has been purified and shown to be d-arabinose dehydrogenase (Ara1p), which converts (R/S)-acetoin to meso-2,3-butanediol and (2S,3S)-2,3-butanediol. (nih.gov)
Yeast1
  • Some organic acid tests check for the presence of arabinose, which may indicate overgrowth of intestinal yeast such as Candida albicans or other yeast/fungus species. (wikipedia.org)
Sucrose6
  • The taste of L-arabinose is quite similar to that of sucrose, with approximately 50% of the sweetness. (scirp.org)
  • The sweetness of L-arabinose is about half of sucrose. (scirp.org)
  • In dinitrophenol-treated tissues, in which all permeability processes are irreversibly damaged and in which sucrose and pentoses penetrate into most of the cell water, the entry rate of pentoses and sucrose is initially similar but subsequently D -xylose and L -arabinose penetrate more rapidly than their corresponding optical isomers. (rupress.org)
  • 1. Arabinose can take metabolic role to sucrose in the intestines, and can stop the conversion. (cbaextract.com)
  • Reducing glycemic response in food products with L-Arabinose L-Arabinose can play an important role in the management of blood glucose and insulin levels related to sucrose intake. (techconnect.org)
  • The addition of L-Arabinose to a sucrose containing diet maintains all advantages of sucrose while strongly reducing the impact of sucrose consumption on the human body. (techconnect.org)
Sugar Blocker1
Pectin1
  • However, L-arabinose is in fact more common than D-arabinose in nature and is found in nature as a component of biopolymers such as hemicellulose and pectin. (wikipedia.org)
Catabolism2
  • Yet, the efficiency of this pentose catabolism (especially for the case of arabinose) remains suboptimal. (kist.re.kr)
  • In this study we identified the L-arabinose-responsive regulator of Pyricularia oryzae that regulates L-arabinose release and catabolism. (omictools.com)
Sugars2
  • Although glucose and xylose are often the predominant sugars in these feedstocks, the economically efficient production of ethanol also requires the conversion of smaller carbohydrate fractions, such as l -arabinose, at high rates and yields ( 9 , 23 ). (asm.org)
  • As opposed to most other sugars, D-arabinose, featured here, is actually less commonly found in nature than L-arabinose. (goldbio.com)
Fermentation4
  • All control strains of E. faecium were easily differentiated from Enterococcus faecalis and Enterococcus durans on the basis of arabinose fermentation on CAA. (asm.org)
  • Although metabolic and evolutionary engineering has enabled the efficient alcoholic fermentation of xylose under anaerobic conditions, the conversion of l -arabinose into ethanol by engineered S. cerevisiae strains has previously been demonstrated only under oxygen-limited conditions. (asm.org)
  • This study reports the first case of fast and efficient anaerobic alcoholic fermentation of l -arabinose by an engineered S. cerevisiae strain. (asm.org)
  • The next challenge is the fermentation of other pentoses, such as l -arabinose. (asm.org)
Concentration1
  • This page describes the relationship between Arabinose concentration in the medium with light output. (igem.org)
Degradation1
  • We find that rapid off-switching does not depend on internal arabinose degradation. (uni-muenchen.de)
Crystalline2
  • L-arabinose is an odorless white needle-like crystalline at room temperature, and it is soluble in water, slightly soluble in alcohol, insoluble in ether, methanol and acetone. (scirp.org)
  • L-Arabinose is a white crystalline powder with a sweetness about 50% of that of sugar. (theingredienthouse.com)
Concentrations4
  • phoA expression can be modulated over a wide range of inducer (arabinose) concentrations and reduced to extremely low levels by the presence of glucose, which represses expression. (asm.org)
  • The highest concentrations of L-Arabinose can be found in instant coffee, wine and sake. (techconnect.org)
  • Evolution of luminescence with time at different Arabinose concentrations. (igem.org)
  • tn10 with time at different Arabinose concentrations. (igem.org)
Binds1
  • The L-arabinose molecule binds in a chair conformation with the OH(1) axial ((beta)-anomer). (rice.edu)
Inducer1
  • While there is significant, inducer-dependent cell-to-cell variation in the timing of the on-switching, the off-switching triggered by sudden removal of arabinose is homogeneous and rapid. (uni-muenchen.de)
Displaystyle1
  • L-arabinose ⇌ {\displaystyle \rightleftharpoons } \ rightleftharpoons L-ribulose. (sacredheartrs.org)
Isomerization1
  • Catalyzes the reversible aldol-ketol isomerization between D-ribulose 5-phosphate (Ru5P) and D-arabinose 5-phosphate (A5P). (mybiosource.com)
C5H10O51
  • L-arabinose (C5H10O5, Mr = 150.13), an aldopentose, is initially isolated from arabic gum via complex chemical and physical methods [5] [6]. (scirp.org)
Promoter2
  • The araE low affinity L-arabinose transport promoter. (uniprot.org)
  • It is under the control of an Arabinose induced promoter. (igem.org)
Residues1
  • A decrease in cell wall-associated arabinose was expected, which was likely caused by fewer Ara f residues in the arabinoxylan. (frontiersin.org)
Metabolic1
  • Studies using D-[U-14C]-labelled arabinose showed that it was fermented to pyruvate, formate, lactate and acetate, whereas the principal metabolic products of D-[U-14C]-labelled glucose were acetate and formate. (nih.gov)
Cerevisiae2
  • Although wild-type S. cerevisiae strains rapidly ferment hexoses with high efficiency, they cannot grow on or use pentoses, such as d -xylose and l -arabinose ( 3 ). (asm.org)
  • Laboratory evolution of a glucose-phosphorylation-deficient, arabinose-fermenting S. cerevisiae. (deepdyve.com)
Molecule1
  • This "extraneous" density was previously attributed to a bound L-arabinose molecule, and its presence accounts for early failures of difference Fourier analyses of crystals soaked in or co-crystallized with L-arabinose to locate the binding site. (rice.edu)
Polysaccharides2
  • As a component of heteropolysaccharides that is found in gum, hemicellulose, bacterial polysaccharides and some glycoside, L-arabinose exists in the form of β-L-arabinose. (scirp.org)
  • L-(+)-Arabinose is the naturally occurring isomer and is a constituent of plant polysaccharides. (thomassci.com)
Cellulose2
  • 83% L-Arabinose Plus, 17% Trehalose plus spray micro cellulose film coating (veg. (sweet-cures.com)
  • Cell wall-associated arabinose was decreased in leaves and stems by over 50%, but there was an increase in cellulose. (frontiersin.org)
Hugh M O'Neill | ORNL
Hugh M O'Neill | ORNL (ornl.gov)
Bulk Fine Chemicals | Spectrum Chemical
Bulk Fine Chemicals | Spectrum Chemical (spectrumchemical.com)
Team:Cambridge/Bioluminescence/Firefly Characterisation - 2010.igem.org
Team:Cambridge/Bioluminescence/Firefly Characterisation - 2010.igem.org (2010.igem.org)
SWISS-MODEL Template Library | 4r1o.1
SWISS-MODEL Template Library | 4r1o.1 (swissmodel.expasy.org)
TALEN mediated targeted mutagenesis of the caffeic acid O-methyltransferase in highly polyploid sugarcane improves cell wall...
TALEN mediated targeted mutagenesis of the caffeic acid O-methyltransferase in highly polyploid sugarcane improves cell wall... (link.springer.com)
The intersection between cell wall disassembly, ripening, and fruit susceptibility to Botrytis cinerea | PNAS
The intersection between cell wall disassembly, ripening, and fruit susceptibility to Botrytis cinerea | PNAS (pnas.org)
Carbohydrate - Configuration | Britannica.com
Carbohydrate - Configuration | Britannica.com (britannica.com)
Correlative GC-TOF-MS-based metabolite profiling and LC-MS-based protein profiling reveal time-related systemic regulation of...
Correlative GC-TOF-MS-based metabolite profiling and LC-MS-based protein profiling reveal time-related systemic regulation of... (link.springer.com)
Design and characterization of synthetic fungal-bacterial consortia for direct production of isobutanol from cellulosic biomass...
Design and characterization of synthetic fungal-bacterial consortia for direct production of isobutanol from cellulosic biomass... (pnas.org)
Conversion of rice straw to bio-based chemicals: an integrated process using Lactobacillus brevis | SpringerLink
Conversion of rice straw to bio-based chemicals: an integrated process using Lactobacillus brevis | SpringerLink (link.springer.com)
Heme Degrading Protein HemS Is Involved in Oxidative Stress Response of Bartonella henselae
Heme Degrading Protein HemS Is Involved in Oxidative Stress Response of Bartonella henselae (journals.plos.org)
The Highly Conserved Bacterial RNase YbeY Is Essential in Vibrio cholerae, Playing a Critical Role in Virulence, Stress...
The Highly Conserved Bacterial RNase YbeY Is Essential in Vibrio cholerae, Playing a Critical Role in Virulence, Stress... (journals.plos.org)
Molecules | Free Full-Text | Antiviral Effects of Houttuynia cordata Polysaccharide Extract on Murine Norovirus-1 (MNV-1)-A...
Molecules | Free Full-Text | Antiviral Effects of Houttuynia cordata Polysaccharide Extract on Murine Norovirus-1 (MNV-1)-A... (mdpi.com)
Fast MAS 1 H- 13 C correlation NMR for structural investigations of plant cell walls | SpringerLink
Fast MAS 1 H- 13 C correlation NMR for structural investigations of plant cell walls | SpringerLink (link.springer.com)
Use of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium. | Journal of Clinical Microbiology
Use of cephalexin-aztreonam-arabinose agar for selective isolation of Enterococcus faecium. | Journal of Clinical Microbiology (jcm.asm.org)
Sucrose Archives - Rainbow Grocery
Sucrose Archives - Rainbow Grocery (rainbow.coop)
Polysaccharide - New World Encyclopedia
Polysaccharide - New World Encyclopedia (newworldencyclopedia.org)
46825 | Molecules | Chemistry
46825 | Molecules | Chemistry (scribd.com)
A Novel Serum Metabolomics-Based Diagnostic Approach to Pancreatic Cancer | Cancer Epidemiology, Biomarkers & Prevention
A Novel Serum Metabolomics-Based Diagnostic Approach to Pancreatic Cancer | Cancer Epidemiology, Biomarkers & Prevention (cebp.aacrjournals.org)
Cloning and expression of a novel α-1,3-arabinofuranosidase from Penicillium oxalicum sp. 68 | SpringerLink
Cloning and expression of a novel α-1,3-arabinofuranosidase from Penicillium oxalicum sp. 68 | SpringerLink (link.springer.com)
Attempted use of PACE for riboswitch discovery generates three new translational theophylline riboswitch side products |...
Attempted use of PACE for riboswitch discovery generates three new translational theophylline riboswitch side products |... (link.springer.com)
At a given temperature, K = 1.3 × 10 −2 for the reaction N 2 ( g ) + 3 H 2 ( g ) ⇌ 2 NH 3 ( g ) Calculate values of K for the...
At a given temperature, K = 1.3 × 10 −2 for the reaction N 2 ( g ) + 3 H 2 ( g ) ⇌ 2 NH 3 ( g ) Calculate values of K for the... (bartleby.com)
Sweet Cures Products | Waterfall D-Mannose, Probiotics, Urine Test Strips
Sweet Cures Products | Waterfall D-Mannose, Probiotics, Urine Test Strips (waterfall-d-mannose.com)
Team:HokkaidoU Japan/Notebook/September29 - 2010.igem.org
Team:HokkaidoU Japan/Notebook/September29 - 2010.igem.org (2010.igem.org)
View topic - Carbo Sep Coregel 87P and molecule of arabinose & mannose?
View topic - Carbo Sep Coregel 87P and molecule of arabinose & mannose? (interchim.com)
Recommended Test Panel for Differentiation of Klebsiella Species on the Basis of a Trilateral Interlaboratory Evaluation of 18...
Recommended Test Panel for Differentiation of Klebsiella Species on the Basis of a Trilateral Interlaboratory Evaluation of 18... (jcm.asm.org)
Application Notes for Karl Fischer Titration | Sigma-Aldrich
Application Notes for Karl Fischer Titration | Sigma-Aldrich (sigmaaldrich.com)
Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. | Journal of...
Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. | Journal of... (jb.asm.org)
Identification of a d-Arabinose-5-Phosphate Isomerase in the Gram-Positive Clostridium tetani | Journal of Bacteriology
Identification of a d-Arabinose-5-Phosphate Isomerase in the Gram-Positive Clostridium tetani | Journal of Bacteriology (jb.asm.org)
SPECTRUM L-Arabinose, 1kg, CAS 5328-37-0, Poly - 46AG33|AR110-1KG - Grainger
SPECTRUM L-Arabinose, 1kg, CAS 5328-37-0, Poly - 46AG33|AR110-1KG - Grainger (grainger.com)
Identification of two inner-membrane proteins required for the transport of lipopolysaccharide to the outer membrane of...
Identification of two inner-membrane proteins required for the transport of lipopolysaccharide to the outer membrane of... (pnas.org)
Making Cellulosic Ethanol | HowStuffWorks
Making Cellulosic Ethanol | HowStuffWorks (science.howstuffworks.com)