Aquaporin 1
Aquaporin 5
Aquaporin 5 is a water-specific channel protein that is expressed primarily in alveolar, tracheal, and upper bronchial EPITHELIUM. It plays an important role in maintaining water HOMEOSTASIS in the LUNGS and may also regulate release of SALIVA and TEARS in the SALIVARY GLANDS and the LACRIMAL GLAND.
Aquaporin 3
Aquaporin 4
Aquaporins
Aquaporin 2
Aquaporin 6
Water
Mercuric Chloride
Osmosis
Aquaglyceroporins
Blood Group Antigens
Water-Electrolyte Balance
Glycerol
Permeability
Cell Membrane Permeability
Plant Transpiration
Kidney Tubules, Collecting
Kidney Concentrating Ability
Diabetes Insipidus, Nephrogenic
A genetic or acquired polyuric disorder characterized by persistent hypotonic urine and HYPOKALEMIA. This condition is due to renal tubular insensitivity to VASOPRESSIN and failure to reduce urine volume. It may be the result of mutations of genes encoding VASOPRESSIN RECEPTORS or AQUAPORIN-2; KIDNEY DISEASES; adverse drug effects; or complications from PREGNANCY.
Plant Proteins
Ion Channels
Neuromyelitis Optica
Polyuria
Biological Transport
Xenopus laevis
Osmotic Pressure
Oocytes
Antidiuretic Agents
Molecular Sequence Data
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Tulipa
Vapor Pressure
Amino Acid Sequence
Cistaceae
Plant Roots
Brain Edema
Increased intracellular or extracellular fluid in brain tissue. Cytotoxic brain edema (swelling due to increased intracellular fluid) is indicative of a disturbance in cell metabolism, and is commonly associated with hypoxic or ischemic injuries (see HYPOXIA, BRAIN). An increase in extracellular fluid may be caused by increased brain capillary permeability (vasogenic edema), an osmotic gradient, local blockages in interstitial fluid pathways, or by obstruction of CSF flow (e.g., obstructive HYDROCEPHALUS). (From Childs Nerv Syst 1992 Sep; 8(6):301-6)
Cell Membrane
Membrane Proteins
Lens, Crystalline
Gene Expression Regulation, Plant
Renal Agents
Drugs used for their effects on the kidneys' regulation of body fluid composition and volume. The most commonly used are the diuretics. Also included are drugs used for their antidiuretic and uricosuric actions, for their effects on the kidneys' clearance of other drugs, and for diagnosis of renal function.
Osmolar Concentration
Vasopressins
Antidiuretic hormones released by the NEUROHYPOPHYSIS of all vertebrates (structure varies with species) to regulate water balance and OSMOLARITY. In general, vasopressin is a nonapeptide consisting of a six-amino-acid ring with a cysteine 1 to cysteine 6 disulfide bridge or an octapeptide containing a CYSTINE. All mammals have arginine vasopressin except the pig with a lysine at position 8. Vasopressin, a vasoconstrictor, acts on the KIDNEY COLLECTING DUCTS to increase water reabsorption, increase blood volume and blood pressure.
Immunohistochemistry
RNA, Messenger
RNA sequences that serve as templates for protein synthesis. Bacterial mRNAs are generally primary transcripts in that they do not require post-transcriptional processing. Eukaryotic mRNA is synthesized in the nucleus and must be exported to the cytoplasm for translation. Most eukaryotic mRNAs have a sequence of polyadenylic acid at the 3' end, referred to as the poly(A) tail. The function of this tail is not known for certain, but it may play a role in the export of mature mRNA from the nucleus as well as in helping stabilize some mRNA molecules by retarding their degradation in the cytoplasm.
Glomeromycota
Microscopy, Electron, Scanning Transmission
A type of TRANSMISSION ELECTRON MICROSCOPY in which the object is examined directly by an extremely narrow electron beam scanning the specimen point-by-point and using the reactions of the electrons that are transmitted through the specimen to create the image. It should not be confused with SCANNING ELECTRON MICROSCOPY.
Salivary Glands
Deamino Arginine Vasopressin
Propylene Glycol
Mesophyll Cells
Mesembryanthemum
Kidney Medulla
Kidney
Submandibular Gland
One of two salivary glands in the neck, located in the space bound by the two bellies of the digastric muscle and the angle of the mandible. It discharges through the submandibular duct. The secretory units are predominantly serous although a few mucous alveoli, some with serous demilunes, occur. (Stedman, 25th ed)
Receptors, Vasopressin
Specific molecular sites or proteins on or in cells to which VASOPRESSINS bind or interact in order to modify the function of the cells. Two types of vasopressin receptor exist, the V1 receptor in the vascular smooth muscle and the V2 receptor in the kidneys. The V1 receptor can be subdivided into V1a and V1b (formerly V3) receptors.
Droughts
Astrocytes
A class of large neuroglial (macroglial) cells in the central nervous system - the largest and most numerous neuroglial cells in the brain and spinal cord. Astrocytes (from "star" cells) are irregularly shaped with many long processes, including those with "end feet" which form the glial (limiting) membrane and directly and indirectly contribute to the BLOOD-BRAIN BARRIER. They regulate the extracellular ionic and chemical environment, and "reactive astrocytes" (along with MICROGLIA) respond to injury.
Reverse Transcriptase Polymerase Chain Reaction
Xenopus
Mercury
A silver metallic element that exists as a liquid at room temperature. It has the atomic symbol Hg (from hydrargyrum, liquid silver), atomic number 80, and atomic weight 200.59. Mercury is used in many industrial applications and its salts have been employed therapeutically as purgatives, antisyphilitics, disinfectants, and astringents. It can be absorbed through the skin and mucous membranes which leads to MERCURY POISONING. Because of its toxicity, the clinical use of mercury and mercurials is diminishing.
Gene Expression
Rats, Sprague-Dawley
Spinacia oleracea
Glycerol Kinase
An enzyme that catalyzes the formation of glycerol 3-phosphate from ATP and glycerol. Dihydroxyacetone and L-glyceraldehyde can also act as acceptors; UTP and, in the case of the yeast enzyme, ITP and GTP can act as donors. It provides a way for glycerol derived from fats or glycerides to enter the glycolytic pathway. EC 2.7.1.30.
Protein Transport
Pichia
Rats, Brattleboro
Plant Stomata
Proteolipids
Protein-lipid combinations abundant in brain tissue, but also present in a wide variety of animal and plant tissues. In contrast to lipoproteins, they are insoluble in water, but soluble in a chloroform-methanol mixture. The protein moiety has a high content of hydrophobic amino acids. The associated lipids consist of a mixture of GLYCEROPHOSPHATES; CEREBROSIDES; and SULFOGLYCOSPHINGOLIPIDS; while lipoproteins contain PHOSPHOLIPIDS; CHOLESTEROL; and TRIGLYCERIDES.
Blotting, Western
Saline Solution, Hypertonic
Antimony Potassium Tartrate
Plant Leaves
Base Sequence
Malpighian Tubules
Glial Fibrillary Acidic Protein
Sequence Homology, Amino Acid
RNA, Complementary
Immunoblotting
Microscopy, Immunoelectron
Models, Molecular
Solute Carrier Family 12, Member 1
4-Chloromercuribenzenesulfonate
Mice, Knockout
Strains of mice in which certain GENES of their GENOMES have been disrupted, or "knocked-out". To produce knockouts, using RECOMBINANT DNA technology, the normal DNA sequence of the gene being studied is altered to prevent synthesis of a normal gene product. Cloned cells in which this DNA alteration is successful are then injected into mouse EMBRYOS to produce chimeric mice. The chimeric mice are then bred to yield a strain in which all the cells of the mouse contain the disrupted gene. Knockout mice are used as EXPERIMENTAL ANIMAL MODELS for diseases (DISEASE MODELS, ANIMAL) and to clarify the functions of the genes.
DNA Primers
Urea
Hypertonic Solutions
Arabidopsis
Gene Expression Regulation
Morula
Sodium-Potassium-Chloride Symporters
DNA, Complementary
Epithelial Cells
Cells that line the inner and outer surfaces of the body by forming cellular layers (EPITHELIUM) or masses. Epithelial cells lining the SKIN; the MOUTH; the NOSE; and the ANAL CANAL derive from ectoderm; those lining the RESPIRATORY SYSTEM and the DIGESTIVE SYSTEM derive from endoderm; others (CARDIOVASCULAR SYSTEM and LYMPHATIC SYSTEM) derive from mesoderm. Epithelial cells can be classified mainly by cell shape and function into squamous, glandular and transitional epithelial cells.
Quercus
Cloning, Molecular
Protein Conformation
The characteristic 3-dimensional shape of a protein, including the secondary, supersecondary (motifs), tertiary (domains) and quaternary structure of the peptide chain. PROTEIN STRUCTURE, QUATERNARY describes the conformation assumed by multimeric proteins (aggregates of more than one polypeptide chain).
Zea mays
Molecular Dynamics Simulation
Hydroxyethyl Starch Derivatives
Long-term regulation of aquaporins in the kidney. (1/515)
The discovery of the aquaporin family of water channels has greatly improved our understanding of how water crosses epithelial cells, particularly in the kidney. The study of the mechanisms involved in the regulation of collecting duct water permeability, in particular, has advanced very rapidly since the identification and characterization of aquaporin-2 (AQP2) in 1993. One of the more surprising findings has been the dramatic long-term changes that are seen in the abundance of this protein, as well as the recognition that these changes represent a way of modulating the acute antidiuretic effects of vasopressin. Furthermore, such changes seem to be of etiological and pathological significance in a number of clinical disorders of water balance. This review focuses on the various conditions in which AQP2 expression is altered (either increased or decreased) and on what this can tell us about the signals and mechanisms controlling these changes. Ultimately, this may be of great value in the clinical management of water balance disorders. Evidence is also now beginning to emerge that there are similar changes in the expression of other renal aquaporins, which had previously been thought to provide an essentially constitutive water permeability pathway, suggesting that they too should be considered as regulatory factors in the control of body water balance. (+info)Vasopressin regulates apical targeting of aquaporin-2 but not of UT1 urea transporter in renal collecting duct. (2/515)
In the renal inner medullary collecting duct (IMCD), vasopressin regulates two key transporters, namely aquaporin-2 (AQP2) and the vasopressin-regulated urea transporter (VRUT). Both are present in intracellular vesicles as well as the apical plasma membrane. Short-term regulation of AQP2 has been demonstrated to occur by vasopressin-induced trafficking of AQP2-containing vesicles to the apical plasma membrane. Here, we have carried out studies to determine whether short-term regulation of VRUT occurs by a similar process. Cell surface labeling with NHS-LC-biotin in rat IMCD suspensions revealed that vasopressin causes a dose-dependent increase in the amount of AQP2 labeled at the cell surface, whereas VRUT labeled at the cell surface did not increase in response to vasopressin. Immunoperoxidase labeling of inner medullary thin sections from Brattleboro rats treated with 1-desamino-8-D-arginine vasopressin (DDAVP) for 20 min revealed dramatic translocation of AQP2 to the apical region of the cell, with no change in the cellular distribution of VRUT. In addition, differential centrifugation of inner medullary homogenates from Brattleboro rats treated with DDAVP for 60 min revealed a marked depletion of AQP2 from the low-density membrane fraction (enriched in intracellular vesicles) but did not alter the quantity of VRUT in this fraction. Finally, AQP2-containing vesicles immunoisolated from a low-density membrane fraction from renal inner medulla did not contain immunoreactive VRUT. Thus vasopressin-mediated regulation of AQP2, but not of VRUT, depends on regulated vesicular trafficking to the plasma membrane. (+info)An impaired routing of wild-type aquaporin-2 after tetramerization with an aquaporin-2 mutant explains dominant nephrogenic diabetes insipidus. (3/515)
Autosomal recessive and dominant nephrogenic diabetes insipidus (NDI), a disease in which the kidney is unable to concentrate urine in response to vasopressin, are caused by mutations in the aquaporin-2 (AQP2) gene. Missense AQP2 proteins in recessive NDI have been shown to be retarded in the endoplasmic reticulum, whereas AQP2-E258K, an AQP2 mutant in dominant NDI, was retained in the Golgi complex. In this study, we identified the molecular mechanisms underlying recessive and dominant NDI. Sucrose gradient centrifugation of rat and human kidney proteins and subsequent immunoblotting revealed that AQP2 forms homotetramers. When expressed in oocytes, wild-type AQP2 and AQP2-E258K also formed homotetramers, whereas AQP2-R187C, a mutant in recessive NDI, was expressed as a monomer. Upon co-injection, AQP2-E258K, but not AQP2-R187C, was able to heterotetramerize with wild-type AQP2. Since an AQP monomer is the functional unit and AQP2-E258K is a functional but misrouted water channel, heterotetramerization of AQP2-E258K with wild-type AQP2 and inhibition of further routing of this complex to the plasma membrane is the cause of dominant NDI. This case of NDI is the first example of a dominant disease in which the 'loss-of-function' phenotype is caused by an impaired routing rather than impaired function of the wild-type protein. (+info)Aquaporin-6: An intracellular vesicle water channel protein in renal epithelia. (4/515)
All characterized mammalian aquaporins (AQPs) are localized to plasma membranes where they function chiefly to mediate water transport across cells. Here we show that AQP6 is localized exclusively in intracellular membranes in renal epithelia. By using a polyclonal antibody to the C terminus of AQP6, immunoblots revealed a major 30-kDa band in membranes from rat renal cortex and medulla. Endoglycosidase treatment demonstrated presence of an intracellular high mannose glycan on each subunit. Sequential ultracentrifugation of rat kidney homogenates confirmed that AQP6 resides predominantly in vesicular fractions, and immunohistochemical and immunoelectron microscopic studies confirmed that >98% of AQP6 is located in intracellular membrane vesicles. In glomeruli, AQP6 is present in membrane vesicles within podocyte cell bodies and foot processes. In proximal tubules, AQP6 is also abundant in membrane vesicles within the subapical compartment of segment 2 and segment 3 cells, but was not detected in the brush border or basolateral membranes. In collecting duct, AQP6 resides in intracellular membrane vesicles in apical, mid, and basolateral cytoplasm of type A intercalated cells, but was not observed in the plasma membrane. Unlike other members of the AQP family, the unique distribution in intracellular membrane vesicles in multiple types of renal epithelia indicates that AQP6 is not simply involved in transcellular fluid absorption. Moreover, our studies predict that AQP6 participates in distinct physiological functions such as glomerular filtration, tubular endocytosis, and acid-base metabolism. (+info)The Cre/loxP system and gene targeting in the kidney. (5/515)
The Cre/loxP and Flp/FRT systems mediate site-specific DNA recombination and are being increasingly utilized to study gene function in vivo. These systems allow targeted gene disruption in a single cell type in vivo, thereby permitting study of the physiological and pathophysiological impact of a given gene product derived from a particular cell type. In the kidney, the Cre/loxP system has been employed to achieve gene deletion selectively within principal cells of the collecting duct. Disruption of target genes in the collecting duct, such as endothelin-1 or polycystic kidney disease-1 (PKD1), could lead to important insights into the biological roles of these gene products. With selection of the appropriate renal cell-specific promoters, these recombination systems could be used to target gene disruption to virtually any renal cell type. Although transgenic studies utilizing these recombination systems are promising, they are in their relative infancy and can be time consuming and expensive and yield unanticipated results. It is anticipated that continued experience with these systems will produce an important tool for analyzing gene function in renal health and disease. (+info)Urinary excretion of aquaporin-2 in rat is mediated by a vasopressin-dependent apical pathway. (6/515)
Clinical studies have shown that aquaporin-2 (AQP2), the vasopressin-regulated water channel, is excreted in the urine, and that the excretion increases in response to vasopressin. However, the cellular mechanisms involved in AQP2 excretion are unknown, and it is unknown whether the excretion correlates with AQP2 levels in kidney or levels in the apical plasma membrane. The present study was undertaken to clarify these issues. Immunoblotting of rat urine samples revealed significant excretion of AQP2, whereas AQP3, being a basolateral aquaporin in the same cells, was undetectable. Thus, there was a nonproportional excretion of AQP2 and AQP3 (compared with kidney levels), indicating that AQP2 is excreted predominantly via a selective apical pathway and not by whole cell shedding. Urinary AQP2 was associated with small vesicles, membrane fragments, and multivesicular bodies as determined by immunoelectron microscopy and negative staining techniques. In rats with normal water supply, daily urinary excretion of AQP2 was 3.9+/-0.9% (n = 6) of total kidney expression. Treatment with desmopressin acetate subcutaneously caused a fourfold increase in urinary excretion of AQP2 during 8 h. Forty-eight hours of thirsting, known to increase endogenous vasopressin secretion, resulted in a three-fold increase in kidney AQP2 levels but urinary excretion increased ninefold to 15+/-3% (n = 6) of AQP2 in kidney of thirsted rats. Moreover, rats that were thirsted for 48 h and subsequently allowed free access to water for 24 h produced a decrease in urinary AQP2 excretion to 38+/-15% (n = 6) of that during thirsting. In Brattleboro rats or lithium-treated normal rats completely lacking vasopressin action, and hence having extremely low levels of AQP2 in the apical plasma membrane, AQP2 was undetectable in urine. Thus, conditions with known altered vasopressin levels and altered levels of AQP2 in the apical plasma membrane were associated with corresponding major changes in AQP2 urine excretion. In contrast, in such conditions, kidney AQP2 levels and urinary AQP2 excretion did not show a proportional relationship. (+info)Effects of missense mutations on rat aquaporin-2 in LLC-PK1 porcine kidney cells. (7/515)
BACKGROUND: Mutations in the aquaporin-2 (AQP2) gene have been found in families with nephrogenic diabetes insipidus (NDI), but the pathophysiological mechanisms of how mutant AQP2 causes the disease are still not clear. METHODS: Wild-type (WT) AQP2 and four mutants-T126M, A147T, R187C, and S216P-were transiently expressed in LLC-PK1 cells. The osmotic water permeability of LLC-PK1 cells expressing AQP2 mutants was determined by stopped-flow light-scattering microphotometry. Cell surface expression, subcellular localization, and effects of vasopressin stimulation were examined by surface biotin labeling and confocal immunohistochemistry. RESULTS: The osmotic water permeability (Pf) of cells expressing WT increased significantly after vasopressin treatment, whereas the Pf of cells expressing T126M A147T, R187C, and S216P was not significantly different from that of the control even after vasopressin stimulation. Confocal immunohistochemistry demonstrated distribution of WT and A147T in early/recycling endosomal compartments and vasopressin-responsive translocation and surface expression. In contrast, stainings of T126M, R187C, and S216P were similar to that of Grp78, indicating that these mutants were misassembled and retarded in the endoplasmic reticulum. CONCLUSION: Our results indicated that the intracellular distribution and vasopressin-regulated trafficking of A147T is intact, in contrast to the other three mutants, of which both were impaired. Thus, it is conceivable that the disruption of the AQP2 channel function accounts for the pathogenesis of A147T NDI, whereas trafficking defects account for that of the other types, suggesting that the pathophysiology of AQP2-related NDI is heterogeneous. (+info)Lack of vasopressin-independent upregulation of AQP-2 gene expression in homozygous Brattleboro rats. (8/515)
Arginine vasopressin (AVP) plays an important role in the expression of aquaporin (AQP-2) in the collecting duct. The present study was undertaken to determine whether there is an AVP-independent regulation of AQP-2 gene expression in homozygous Brattleboro rats in which endogenous AVP is absent. Exogenous administration of 1-deamino-8-D-AVP produced an antidiuresis and expressed AQP-2 mRNA and AQP-2 protein in the renal medulla of the homozygous Brattleboro rats. Twelve hours of water deprivation produced severe dehydration in the homozygous Brattleboro rats, such that urinary osmolality increased from 200 to 649 mosmol/kgH(2)O. However, no increase in AQP-2 mRNA expression was observed after this dehydration, and the medullary tissue content and urinary excretion of AQP-2 also remained unchanged. Increases in AQP-2 mRNA expression and AQP-2 protein were evident in Long-Evans rats after 64 h of water deprivation, with a severity of dehydration almost equal to the 12-h dehydrated, homozygous Brattleboro rats. These results indicate the lack of an AVP-independent mechanism for upregulating AQP-2 mRNA expression in renal collecting duct cells. (+info)
Mankhwala 7 Opambana Othandiza Khansa Yammapapo-Yavomerezedwa ndi FDA
Ulendo waku India komanso zokopa alendo zikukumana ndi mavuto azachuma
Acquired nephrogenic diabetes insipidus - Gooddiabeteslife
Hydrochorothiazide attenuates lithium-induced Nephrogenic Diabetes Insipidus independently of the sodium-chloride co...
Effectiveness of rhGH Treatment in a Boy with Nephrogenic Diabetes Insipidus | ESPE2015
Nephrogenic Diabetes Insipidus: Its Symptoms, Causes, Treatment & Diet - Diabetes Self Caring
Complications of Nephrogenic diabetes insipidus - RightDiagnosis.com
Aquaporins in the kidney: from molecules to medicine. - Aquaporin and water channels
KEGG PATHWAY: Vasopressin-regulated water reabsorption - Mus musculus (mouse)
Diabetes - The School of Biomedical Sciences Wiki
Urinary Concentration Defect and Renal Glycosuria in Cyclosporine-treated Rats | 대한전해질학회 | KISS
The role of putative phosphorylation sites in the targeting and shuttling of the aquaporin-2 water channel. - Physiomics
Urine Osmolality Test: Purpose, Procedure, and Results
Comparison of urine concentrations of CXCL1 between a t | Open-i
Diabetes insipidus: Lithium-induced nephrogenic diabetes insipidus in older people at The Medical Dictionary
Nephrogenic diabetes insipidus - Wikipedia
Decreased aquaporin-2 expression and apical plasma membrane delivery in kidney collecting ducts of polyuric hypercalcemic rats....
Atorvastatin for the Treatment of Lithium-Induced Nephrogenic Diabetes Insipidus: A Randomized Controlled...
A Family Case of Nephrogenic Diabetes Insipidus - NDI Foundation
Aldose Reductase-Deficient Mice Develop Nephrogenic Diabetes Insipidus - NDI Foundation
A Pediatric Case of Primary Sj$ddot{o}$grens Syndrome Associated with Nephrogenic Diabetes Insipidus and Renal Tubular Acidosis
Amelioration of polyuria in nephrogenic diabetes insipidus due to aquaporin-2 deficiency
What causes nephrogenic diabetes insipidus?
nephrogenic diabetes insipidus Disease Ontology Browser - DOID:12387
The Circle Practice - Library - Health A-Z
Nephrogenic Diabetes Insipidus - Genitourinary Disorders - Merck Manuals Professional Edition
Diabetes insipidus - nephrogenic
The Circle Practice - Library - Health A-Z
Kirkby Malzeard & Masham Surgeries - Library - Health A-Z
NHS website
NHS website
Jørgen Frøkiær - Research outputs - Research - Aarhus University
Demeclocycline-Induced Nephrogenic Diabetes InsipidusIn-Vivo and In-Vitro Studies | Annals of Internal Medicine | American...
The Gonen Lab: Structure Gallery
HEALTH
Water, Water Everywhere: A New Cause and a New Treatment for Nephrogenic Diabetes Insipidus | American Society of Nephrology
Amiloride blocks lithium entry through the sodium channel thereby attenuating the resultant nephrogenic diabetes insipidus.
Most recent papers with the keyword Patern recognition receptors | Read by QxMD
Browse In Polyuria, Kidney, Diabetes insipidus, Abdominal pain, Age, Hormone, Female, White | EDM Case Reports
Browse In Diabetes insipidus, Abdominal pain, Female, Hormone, Polyuria, Signs and Symptoms | EDM Case Reports
Exactly What Contributes To Nephrogenic Diabetes Insipidus? Why You Ought To Be Aware Of Details?
Nephrogenic diabetes insipidus - Vitamin Life
Taurine modulates arginine vasopressin-mediated regulation of renal function<...
TCDB » SEARCH
Urine-concentrating mechanism in the inner medulla: Function of the thin limbs of the loops of henle<...
AVPR2 - Vasopressin V2 receptor - Sus scrofa (Pig) - AVPR2 gene & protein
Water & pH | Harpers Illustrated Biochemistry, 30e | AccessMedicine | McGraw-Hill Medical
ADCY6 gene - Genetics Home Reference
What does kidney medulla mean?
Aquaporin-2 (254-267), pSER261, human
Medal for Research Excellence
Q&A Drugstore: Vigara online top doctors advice!
Revas h 50/12.5mg tablet 15s
Urine Osmolality: Reference Range, Interpretation, Collection and Panels
Analysis of the Causes of Lithium-Induced Polyuria | Clinical Science | Portland Press
EGFR-mediated expression of aquaporin-3 is involved in human s...
decreased urine osmolality Mammalian Phenotype Term (MP:0002988)
Polyuria (Aftercare Instructions) - What You Need to Know
AVP gene
The arginine vasopressin stimulates the process of phosphorylation of aquaporin 2 (AQP2) at renal tissue, which contributes to ... "Arginine vasopressin stimulates phosphorylation of aquaporin-2 in rat renal tissue". The American Journal of Physiology. 276 (2 ... 50 (2): 573-601. doi:10.1021/ja01389a050. ISSN 0002-7863. Turner, R. A.; Pierce, J. G.; du VIGNEAUD, V. (July 1951). "The ... 2 (5): 763-767. ISSN 0261-4189. PMID 6315416. Arima, Hiroshi; House, Shirley B.; Gainer, Harold; Aguilera, Greti (November 2002 ...
Neurohypophysial hormone
"Antidiuretic action of oxytocin is associated with increased urinary excretion of aquaporin-2". Nephrol. Dial. Transplant. 19 ( ... 19 (2): 225-32. doi:10.1681/ASN.2007010029. PMC 2396735. PMID 18057218. Joo KW, Jeon US, Kim GH, Park J, Oh YK, Kim YS, Ahn C, ... 227 (2): 553-64. doi:10.1113/jphysiol.1972.sp010047. PMC 1331210. PMID 4678722. Hatton GI (September 1988). "Pituicytes, glia ...
SNAP23
... colocalization with aquaporin-2 in collecting duct vesicles". The American Journal of Physiology. 275 (5 Pt 2): F752-60. doi: ... 26 (2): 457-64. doi:10.1016/S0896-6273(00)81177-0. PMID 10839363. Martín-Martín B, Nabokina SM, Blasi J, Lazo PA, Mollinedo F ( ... 285 (2): 320-7. doi:10.1006/bbrc.2001.5144. PMID 11444845. Logan MR, Lacy P, Bablitz B, Moqbel R (Feb 2002). "Expression of ... 375 (Pt 2): 433-40. doi:10.1042/BJ20030427. PMC 1223698. PMID 12877659. Valdez AC, Cabaniols JP, Brown MJ, Roche PA (Mar 1999 ...
STX4
... colocalization with aquaporin-2 in collecting duct vesicles". The American Journal of Physiology. 275 (5 Pt 2): F752-60. doi: ... possible role in aquaporin-2 trafficking". The Journal of Clinical Investigation. 98 (4): 906-13. doi:10.1172/JCI118873. PMC ... 3.0.CO;2-5. PMID 10508479. Paumet F, Le Mao J, Martin S, Galli T, David B, Blank U, Roa M (Jun 2000). "Soluble NSF attachment ... 143 (2): 303-4. doi:10.1016/0378-1119(94)90117-1. PMID 8206394. Low SH, Vasanji A, Nanduri J, He M, Sharma N, Koo M, Drazba J, ...
Vasopressin
Aquaporins allow water to move down their osmotic gradient and out of the nephron, increasing the amount of water re-absorbed ... Vasopressin, acting through cAMP, also increases transcription of the aquaporin-2 gene, thus increasing the total number of ... This occurs through increased transcription and insertion of water channels (Aquaporin-2) into the apical membrane of ... Wilson JL, Miranda CA, Knepper MA (2013). "Vasopressin and the Regulation of Aquaporin-2". Clinical and Experimental Nephrology ...
Demeclocycline
"Demeclocycline attenuates hyponatremia by reducing aquaporin-2 expression in the renal inner medulla". Am. J. Physiol. Renal ...
Vasopressin receptor antagonist
Congenital nephrogenic diabetes insipidus (NDI) may result from V2R or aquaporin-2 (AQP2) mutations. Exogenously administered ... doi:10.1007/s00018-006-6054-2. PMID 16794787. Decaux, G; Soupart, A; Vassart, G (2008). "Non-peptide arginine-vasopressin ... V1R and/or V2R antagonists may serve as molecular chaperones to mitigate misfolding defects in selected patients with type 2 ...
Primary polydipsia
June 1999). "Urinary excretion of aquaporin-2 water channel differentiates psychogenic polydipsia from central diabetes ... 20 (2): 375-385. doi:10.1093/schbul/20.2.375. PMID 8085139.CS1 maint: multiple names: authors list (link) Dundas, Brian; Harris ... 157 (2): 569-593. Bibcode:1969NYASA.157..569F. doi:10.1111/j.1749-6632.1969.tb12908.x. ISSN 1749-6632. PMID 5255630. Siegler EL ... 66 (2): 283-286. doi:10.1097/01.psy.0000116717.42624.68. ISSN 1534-7796. PMID 15039516.(subscription required) Lee, H. S.; Kwon ...
Non-invasive micro-test technology
Horng, J.L.; Chao, P.L.; Chen, P.Y.; Shih, T.H.; Lin, L.Y. (2015). "Aquaporin 1 Is Involved in Acid Secretion by Ionocytes of ... a novel aquaporin gene from Medicago sativa, confers salt tolerance in transgenic Arabidopsis". Environmental and Experimental ... 419 (1-2): 141-152. doi:10.1007/s11104-017-3335-5. S2CID 1202467. Ma, Y.; Dai, X.; Xu, Y.; Luo, W.; Zheng, X.; Zheng, D.; Pan, ... 53 (1-2): 59-69. doi:10.1016/0376-7388(90)80006-8. Kunkel, J.G.; Cordeiro, S.; Xu, Y.; Shipley, A.M.; Feijó, J.A. (2006). " ...
Nephrogenic diabetes insipidus
Marples D, Frøkiaer J, Dørup J, Knepper MA, Nielsen S (April 1996). "Hypokalemia-induced downregulation of aquaporin-2 water ...
Phosphoproteomics
... regulation of aquaporin-2 phosphorylation at two sites". Proc Natl Acad Sci U S A. 103 (18): 7159-64. doi:10.1073/pnas. ... including three novel phosphorylation sites in the vasopressin-sensitive water channel aquaporin-2 (AQP2). Since the inception ... 6 (2): 1-11. doi:10.1093/gigascience/giw015. ISSN 2047-217X. PMC 5466708. PMID 28327990. Lim, Y. (2005). "Mining the tumor ...
Diabetes insipidus
... it acts on proteins called aquaporins and more specifically aquaporin 2 in the following cascade. When released, ADH binds to ... Nephrogenic DI results from lack of aquaporin channels in the distal collecting duct (decreased surface expression and ... stimulating translocation of the aquaporin 2 channel stored in the cytoplasm of the distal convoluted tubules and collecting ... 4 (2): 177-85. doi:10.1023/A:1022946220908. PMID 12766546. S2CID 33533827. Loffing J (November 2004). "Paradoxical antidiuretic ...
SKIP
"The inositol Inpp5k 5-phosphatase affects osmoregulation through the vasopressin-aquaporin 2 pathway in the collecting system ...
Vacuole
Proteins found in the tonoplast (aquaporins) control the flow of water into and out of the vacuole through active transport, ... "Acceleration of vacuolar regeneration and cell growth by overexpression of an aquaporin NtTIP1;1 in tobacco BY-2 cells". Plant ... 213 (2): 149-157. doi:10.1111/j.1574-6968.2002.tb11299.x. PMID 12167531. Retrieved 5 November 2020. Alberts B, Johnson B, Lewis ... 41 (2): 218-227. doi:10.3109/1040841X.2013.821650. ISSN 1040-841X. PMID 23919298. S2CID 11384111. Pappas, George D.; Brandt, ...
VAMP2
... possible role in aquaporin-2 trafficking". The Journal of Clinical Investigation. 98 (4): 906-13. doi:10.1172/JCI118873. PMC ... 14 (2): 217-23. doi:10.1002/j.1460-2075.1995.tb06994.x. PMC 398073. PMID 7835332. Chapman ER, An S, Barton N, Jahn R (Nov 1994 ... 20 (2): 169-80. doi:10.1006/mcne.2002.1122. PMID 12093152. S2CID 23927545. Margittai M, Otto H, Jahn R (Mar 1999). "A stable ... 138 (1-2): 171-4. doi:10.1016/0378-1119(94)90802-8. PMID 8125298. Jagadish MN, Fernandez CS, Hewish DR, Macaulay SL, Gough KH, ...
Secretin
Evidence for a secretin-induced vesicular translocation of aquaporin-1". The Journal of Biological Chemistry. 272 (20): 12984-8 ... translocation of aquaporin 2, or both are found. It has been suggested that "Secretin as a neurosecretory hormone from the ... "Secretin promotes osmotic water transport in rat cholangiocytes by increasing aquaporin-1 water channels in plasma membrane. ... 80 (2): 185-94. doi:10.1006/geno.2002.6814. PMID 12160732. Lee LT, Tan-Un KC, Chow BK (2006). "Retinoic acid-induced human ...
Na-K-Cl cotransporter
Increased NKCC2 activity aids in water reabsorption in the collecting duct through aquaporin 2 channels by creating a hypo- ... 13 (2): 183-8. doi:10.1038/ng0696-183. PMID 8640224. S2CID 42296304. Plata C, Meade P, Vazquez N, Hebert SC, Gamba G (Mar 2002 ... 22 (2): 192-5. doi:10.1038/9713. PMID 10369265. S2CID 23779936. Dzhala VI, Talos DM, Sdrulla DA, Brumback AC, Mathews GC, Benke ... isoform 2) exon 21 in the final gene product. NKCC1 is widely distributed throughout the human body; it has important functions ...
Vasopressin receptor 2
Ishikawa SE (Feb 2002). "[Nephrogenic diabetes insipidus associated with mutations of vasopressin V2 receptors and aquaporin-2 ... 55 (2): 278-86. PMC 1918376. PMID 8037205. Yuasa H, Ito M, Oiso Y, Kurokawa M, Watanabe T, Oda Y, Ishizuka T, Tani N, Ito S, ... 2 (2): 103-6. doi:10.1038/ng1092-103. PMID 1303257. van den Ouweland AM, Dreesen JC, Verdijk M, Knoers NV, Monnens LA, Rocchi M ... 2 (2): 99-102. doi:10.1038/ng1092-99. PMID 1303271. van den Ouweland AM, Knoop MT, Knoers VV, Markslag PW, Rocchi M, Warren ST ...
Ralf Kaldenhoff
Aquaporin tetramer composition modifies the function of tobacco aquaporins. Journal of Biological Chemistry, 2010. 285(41): p. ... He is known for his work on the aquaporin protein class, where he detected facilitated diffusion of CO2 in plant tissue and ... Kaldenhoff was one of the first scientists to describe plant aquaporins. He initially accomplished to analyse the function and ... For the first time, Kaldenhoff could provide evidence that an aquaporin molecule could conduct CO₂. Kaldenhoff also worked on ...
Antidiuretski hormon - Википедија, слободна енциклопедија
2004). „Antidiuretic action of oxytocin is associated with increased urinary excretion of aquaporin-2". Nephrology, Dialysis, ... 2]. Antidiuretski hormon (ADH) ili vazopresin je ljudski hormon, izlučevina zadnjeg režnja hipofize, zapravo nervnog završetka ... V2. Agonisti: Dezmopresin • Ornipresin • Vazopresin. Antagonisti: Konivaptan • Demeklociklin • Liksivaptan • Mozavaptan • ... OX2. Agonisti: Oreksin-A. Antagonisti: Almoreksant • SB-649,868 • TCS-OX2-29 ...
Protein kinase A
phosphorylation of aquaporin 2 (stimulating it)[12]. Thick ascending limb cell. kidney. Vasopressin → V2 receptor. stimulate Na ... Casein kinase 2, is known to exist in a physiological tetrameric complex.[2] ... 577 (2): 101-108. doi:10.1016/j.gene.2015.11.052. PMC 4713328. PMID 26687711.. ...
Daf-2
... elegans by downregulating DAF-16/FOXO activity and aquaporin gene expression". Cell Metabolism. 10 (5): 379-91. doi:10.1016/j. ... The protein predicted from DAF-2's sequence is 35% identical to the human insulin receptor, which regulates metabolism; 34% ... Mutations in DAF-2 have been shown by Cynthia Kenyon to double the lifespan of the worms. In a 2007 episode of WNYC's Radiolab ... DAF-2 is the only member of the insulin receptor family in C. elegans but it corresponds, in form and function, to multiple ...
AQP7
Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin ... Aquaporin-7 is a protein that in humans is encoded by the AQP7 gene. Aquaporins/major intrinsic protein (MIP) are a family of ... "Entrez Gene: AQP7 aquaporin 7". Dibas AI, Mia AJ, Yorio T (1998). "Aquaporins (water channels): role in vasopressin-activated ... Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. ...
Arabidopsis thaliana responses to salinity
Molecular and Cellular Features of Aquaporin Expression". Plant Physiology. 139 (2): 790-805. doi:10.1104/pp.105.065029. PMC ... 6 (2): 275-286. doi:10.1093/mp/sst017. PMID 23355543. Boursiac, Y.; Chen, S.; Luu, D. T.; Sorieul, M.; Van Den Dries, N.; ... 128 (2): 379-387. doi:10.1104/pp.010524. PMC 148901. PMID 11842142. Babourina, O. (2000). "Effect of Sudden Salt Stress on Ion ... doi:10.1007/s00425-005-0074-2. PMID 16079998. Demidchik, V.; Tester, M. (2002). "Sodium Fluxes through Nonselective Cation ...
Vasopressin receptor
The increased intracellular cAMP in the kidney in turn triggers fusion of aquaporin-2-bearing vesicles with the apical plasma ...
Phloretin
... inhibits aquaporin 9 (AQP9) on mouse hepatocytes. Phlorizin is the 2'-glucoside of phloretin Naringin dihydrochalcone ... 11 (2): 79-88. doi:10.1111/j.1463-1326.2008.00982.x. PMID 19125776. Crespy, V.; Aprikian, O.; Morand, C.; Besson, C.; Manach, C ... Idris, I.; Donnelly, R. (2009). "Sodium-glucose co-transporter-2 inhibitors: An emerging new class of oral antidiabetic drug". ...
Kidney
... calbindin expressed in distal tubules and aquaporin 2 expressed in the collecting duct cells. The mammalian kidney develops ... 2:23) state that God searches out and inspects the kidneys, or "reins", of humans, together with the heart. The kidneys, like ... They are located on the left and right in the retroperitoneal space, and in adult humans are about 12 centimetres (4 1⁄2 inches ... 5 (2/3): 70-83. doi:10.4024/230503.jbpc.05.02. Maton, Anthea; Jean Hopkins; Charles William McLaughlin; Susan Johnson; Maryanna ...
Cav1.2
272 (3 Pt 2): H1372-81. PMID 9087614.. *. Yu W, Andersson B, Worley KC, Muzny DM, Ding Y, Liu W, Ricafrente JY, Wentland MA, ... The calcium channel consists of a complex of alpha-1, alpha-2/delta and beta subunits in a 1:1:1 ratio. The S3-S4 linkers of ...
Diuretic
Competitive vasopressin antagonism leads to decreased number of aquaporin channels in the apical membrane of the renal ... 2. proximal tubule Loop diuretics bumetanide,[17] ethacrynic acid,[17] furosemide,[17] torsemide Inhibits the Na-K-2Cl ... 2. proximal tubule[17]. Carbonic anhydrase inhibitors acetazolamide,[17] dorzolamide Inhibits H+ secretion, resultant promotion ... 9 (2): 159-62. doi:10.1007/BF00860731. PMID 7794709.. *^ Bakhireva LN, Barrett-Connor E, Kritz-Silverstein D, Morton DJ (June ...
Red blood cell
Aquaporin 1 - water transporter, defines the Colton Blood Group;. *Glut1 - glucose and L-dehydroascorbic acid transporter; ... 39 (2): 189. doi:10.1093/icb/39.2.189.. *^ "BBC Bitesize - GCSE Biology - Blood - Revision 2". www.bbc.co.uk. Retrieved 2017-11 ... 15 (2): 96-97. doi:10.1111/j.1440-1754.1979.tb01197.x.. *^ Higgins, John (2014). "Red Blood Cell Population Dynamics". Clinics ... 118 (2): 146-52. PMID 1856577.. *^ Kabanova S, Kleinbongard P, Volkmer J, Andrée B, Kelm M, Jax TW (2009). "Gene expression ...
Semipermeable membrane
Aquaporins are protein channel pores permeable to H2O water. Reverse osmosisEdit. This section does not cite any sources. ... A cell membrane consists of proteins and phospholipids.[2] Signaling molecules send chemical messages to the proteins in the ...
TRPC6
Two of the primary active constituents responsible for the antidepressant and anxiolytic benefits of Hypericum perforatum, also known as St. John's Wort, are hyperforin and adhyperforin.[9][10] These compounds are inhibitors of the reuptake of serotonin, norepinephrine, dopamine, γ-aminobutyric acid, and glutamate, and they are reported to exert these effects by binding to and activating TRPC6.[10][11] Recent results with hyperforin have cast doubt on these findings as similar currents are seen upon Hyperforin treatment regardless of the presence of TRPC6.[12] ...
Inositol trisphosphate receptor
74 (2): 125-37. doi:10.1254/jjp.74.125. PMID 9243320.. *^ Supattapone S, Worley PF, Baraban JM, Snyder SH (January 1988). " ... This page was last edited on 2 December 2020, at 15:34 (UTC). ... PtdIns(3,4)P2 (PKB/Akt, PDPK1); Sphingolipids: C1P. *Ceramide ( ... 2] The InsP3R complex is formed of four 313 kDa subunits. In amphibians, fish and mammals, there are 3 paralogs and these can ... 2] Inositol triphosphate receptor represents a dominant second messenger leading to the release of Ca2+ from intracellular ...
Electron crystallography
... highest resolution protein structure solved by electron crystallography of 2D crystals is that of the water channel aquaporin-0 ... 59 (Pt 2): 117-26. doi:10.1107/S0108767302022559. PMID 12604849.. *^ Weirich, T; Portillo, J; Cox, G; Hibst, H; Nicolopoulos, S ... doi:10.1016/S0022-2836(05)80271-2. PMID 2359127.. *^ Kühlbrandt, Werner; Wang, Da Neng; Fujiyoshi, Yoshinori (February 1994). " ... Radiation damage was recently investigated using MicroED[2][3] of thin 3D crystals in a frozen hydrated state. ...
Kidney
However, when plasma blood volume is low and ADH is released the aquaporins that are opened are also permeable to urea. This ... ADH binds to principal cells in the collecting duct that translocate aquaporins to the membrane, allowing water to leave the ... ADH acts on the V2 receptor and inserts aquaporins on the luminal side ... but at the same time setting up an osmotic gradient for water to follow should the aquaporins of the collecting duct be opened ...
Cell membrane
Such molecules can diffuse passively through protein channels such as aquaporins in facilitated diffusion or are pumped across ... 134 (2): 751-753. doi:10.1021/ja2076873. PMC 3262119. PMID 22239722.. *^ Staff (January 25, 2012). "Chemists Synthesize ... 29 (2): 88. doi:10.1002/ar.1090290205.. *^ Plowe, J. Q. (1931). "Membranes in the plant cell. I. Morphological membranes at ... There are 2 types of ER, smooth and rough. The rough ER has ribosomes attached to it used for protein synthesis, while the ...
Inward-rectifier potassium channel
24 (2): 107-15. doi:10.1007/BF00211406. PMID 8582318.. *^ a b "1.A.2 Inward Rectifier K Channel (IRK-C) Family". TCDB. ... Activation by PIP2[edit]. All Kir channels require phosphatidylinositol 4,5-bisphosphate (PIP2) for activation.[10] PIP2 binds ... ISBN 0-87893-321-2. External links[edit]. *Inward+Rectifier+Potassium+Channels at the US National Library of Medicine Medical ... To date, seven subfamilies have been identified in various mammalian cell types,[1] plants,[2] and bacteria.[3] They are the ...
TRPV
aquaporin 5, calmodulin, pacsin 3 2 TRPV5 calcium-selective TRP channel intestine, kidney, placenta 100:1 TRPV6 annexin II / ... PIP2 signaling ligands are represented by space-filling models (carbon = white, oxygen = red, phosphorus = orange).[1] ... Mutations in TRPs have been linked to neurodegenerative disorders, skeletal dysplasia, kidney disorders,[2] and may play an ... In group 2 there are TRPP ("P" for polycystic) and TRPML ("ML" for mucolipin). ...
தைராய்டு சுரப்புக் குறை - தமிழ் விக்கிப்பீடியா
Yeum CH, Kim SW, Kim NH, Choi KC, Lee J (July 2002). "Increased expression of aquaporin water channels in hypothyroid rat ... வளர்சிதை மாற்றக் குறியீட்டைச் சிதைத்தல் (தொகுதி 2 இல் 1) - ஜேம்ஸ் பி. லாவெல்லே R.Ph. C.C.N. N.D, ISBN 1442950390, பக்கம் 100 ... "The International Journal of Neuropsychopharmacology 3 (2): 167-174. doi:10.1017/S1461145700001826. http://journals.cambridge. ...
GJB1
98 (2): 172-5. doi:10.1007/s004390050183. PMID 8698335.. *^ a b c d e f g h i j "GJB1 gene". Genetics Home Reference. US ... doi:10.1002/(SICI)1098-1004(1999)13:1,11::AID-HUMU2,3.0.CO;2-A. PMID 9888385.. ...
AQP1 - Wicipedia
"Increased aquaporin 1 expression in the tunica albuginea of Peyronie's disease patients: an in vivo pilot study. ". Histol ... "Overexpression of Aquaporin 1 on cysts of patients with polycystic liver disease.". Rev Esp Enferm Dig. 2016. PMID 26838488. ... "Overexpression of Aquaporin-1 is a Prognostic Factor for Biochemical Recurrence in Prostate Adenocarcinoma. ". Pathol Oncol Res ... "Red blood cell aquaporin-1 expression is decreased in hereditary spherocytosis. ". Ann Hematol. 2016. PMID 27465156. ...
Аквапорин-1 - Вікіпедія
Аквапорин-1, AQP1 (англ. Aquaporin 1 (Colton blood group)) - білок, який кодується геном AQP1, розташованим у людей на ... de Groot B.L., Engel A., Grubmueller H. (2001). A refined structure of human aquaporin-1.. FEBS Lett. 504: 206 - 211. PubMed ... AQP1, AQP-CHIP, CHIP28, CO, aquaporin 1 (Colton blood group). Зовнішні ІД. OMIM: 107776 MGI: 103201 HomoloGene: 68051 GeneCards ... Сполуки, які фізично взаємодіють з Aquaporin 1 переглянути/редагувати посилання на ВікіДаних. ...
Secretina, a enciclopedia libre
Evidence for a secretin-induced vesicular translocation of aquaporin-1" (PDF). J. Biol. Chem. 272 (20): 12984-12988. PMID ... H2N-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-CONH2.[9] ... É famosa por ser a primeira hormona que foi identificada.[2] Nos humanos a secretina está codificada polo xene SCT.[3][4] ... 6,0 6,1 6,2 6,3 Chu JY, Lee LT, Lai CH, Vaudry H, Chan YS, Yung WH, Chow BK (2009). "Secretin as a neurohypophysial factor ...
Nephron
Aquaporins are membrane proteins that selectively conduct water molecules while preventing the passage of ions and other ... ADH affects the function of aquaporins, resulting in the reabsorption of water molecules as it passes through the collecting ... Archived October 2, 2007, at the Wayback Machine. *^ Hook, Jerry B. & Goldstein, Robin S. (1993). Toxicology of the Kidney. ... The ascending limb of loop of Henle is divided into 2 segments: Lower end of ascending limb is very thin and is lined by simple ...
Urinary system
... water permeability of the kidney's collecting duct and distal convoluted tubule by inducing translocation of aquaporin-CD water ... 1. Human urinary system: 2. Kidney, 3. Renal pelvis, 4. Ureter, 5. Urinary bladder, 6. Urethra. (Left side with frontal section ... 2 Function *2.1 Urine formation *2.1.1 Regulation of concentration and volume ... Average urine production in adult humans is about 1-2 litres (L) per day, depending on state of hydration, activity level, ...
Hyponatremia
... occurs in one of two ways: either the osmoreceptor-aquaporin feedback loop is overwhelmed, or it is interrupted. ... "Physiology and pathophysiology of renal aquaporins". Seminars in nephrology. 21 (3): 231-8. doi:10.1053/snep.2001.21647. PMID ... 2 (1): 151-61. doi:10.2215/CJN.02730806. PMID 17699400.. *^ "High incidence of mild hyponatraemia in females using ecstasy at a ... 2 (Suppl_3): iii12-iii19. doi:10.1093/ndtplus/sfp154. PMC 2762827. PMID 19881932.. ...
GLUT1
"Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains". Biochimica et ... Glucose transporter 1 (or GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), is ... GLUT1 Deficiency Syndrome 2[edit]. Other mutations, like GLY314SER, ALA275THR, ASN34ILE, SER95ILE, ARG93TRP, ARG91TRP, a 3-bp ... GLUT1 accounts for 2 percent of the protein in the plasma membrane of erythrocytes. GLUT1, found in the plasma membrane of ...
File:Ideogram house mouse chromosome 6.svg
Aquaporin 1. *Arachidonate 5-lipoxygenase. *Atrophin 1. *BH3 interacting-domain death agonist ...
Lithium (medication)
Nielsen, J.; Kwon, T.H.; Christensen, B.M.; Frokiaer, J.; Nielsen, S. (May 2008). "Dysregulation of renal aquaporins and ... 4 (2): 117-128. doi:10.1038/sj.mp.4000494. PMID 10208444.. *^ a b c Marmol, F. (2008). "Lithium: Bipolar disorder and ... 2 (5): 193-202. doi:10.1093/jat/2.5.193.. *^ R. Baselt, Disposition of Toxic Drugs and Chemicals in Man, 8th edition, ... 2CO. 3), sold under several trade names, is the most commonly prescribed, while lithium citrate (Li. 3C. 6H. 5O. 7) is also ...
Transmembrane protein
Aquaporins. *Chloride channels. *Outer membrane auxiliary proteins (polysaccharide transporter) - α-helical transmembrane ... Schematic representation of transmembrane proteins: 1) a single transmembrane α-helix (bitopic membrane protein). 2) a ...
Voltage-gated calcium channel
49 (2): 151-64. doi:10.1007/BF03020488. PMID 11823393.. *^ Hall JE (2011). Guyton and Hall Textbook of Medical Physiology with ... α2δ Subunit[edit]. The α2δ gene forms two subunits: α2 and δ (which are both the product of the same gene). They are linked to ... α2δ, β, possibly γ. Cerebellar granule cells, other neurons T-type calcium channel ("Transient"). low voltage activated. Cav3.1 ... The α2δ subunit is also a binding site of the central depressant and anxiolytic drug phenibut, in addition to actions at other ...
Sweat gland
... can sometimes come with abnormal aquaporin 5 in the sweat glands.[70] ... 2. Elsevier Health Sciences. p. 253. ISBN 9780721686073. .. *^ Spearman, Richard Ian Campbell (1973). The Integument: A ... 139 (2): 173-183. doi:10.1007/BF00523636. PMID 4352229.. *. Slegers, J. F. G. (1964). "The mechanism of sweat-secretion". ... 2][14][8] In both sweat gland types, the secretory coils are surrounded by contractile myoepithelial cells that function to ...
Gap junction
384 (2): 205-15. doi:10.1006/abbi.2000.2131. PMID 11368307.. *^ a b c Maeda, Shoji; Nakagawa, So; Suga, Michihiro; Yamashita, ... 162 (2): 235-52. doi:10.1007/BF00209209. PMID 1237352. S2CID 38441429.. *^ Orci L, Malaisse-Lagae F, Amherdt M, et al. ( ... 96 (2): 231-8. PMID 1698798.. *^ Johnson, R. G.; Reynhout, J. K.; Tenbroek, E. M.; Quade, B. J.; Yasumura, T.; Davidson, K. G. ... 179 (2): 169-75. doi:10.1007/BF00219794. PMID 858161. S2CID 21604678.. *^ McGinley D, Posalaky Z, Provaznik M (October 1977). " ...
Aquaporin 2 - Wikipedia
It is the only aquaporin regulated by vasopressin. The basic job of aquaporin 2 is to reabsorb water from the urine while its ... This aquaporin is also regulated by food intake. Fasting reduces expression of this aquaporin independently of vasopressin. ... Aquaporin 2 is in kidney epithelial cells and usually lies dormant in intracellular vesicle membranes. When it is needed, ... This aquaporin is regulated in two ways by the peptide hormone vasopressin: short-term regulation (minutes) through trafficking ...
Identification of phosphorylation-dependent binding partners of aquaporin-2 using protein mass spectrometry. - PubMed - NCBI
Identification of phosphorylation-dependent binding partners of aquaporin-2 using protein mass spectrometry.. Zwang NA1, ... Identification of Phosphorylation-Dependent Binding Partners of Aquaporin-2 Using Protein Mass Spectrometry ... Identification of Phosphorylation-Dependent Binding Partners of Aquaporin-2 Using Protein Mass Spectrometry ... Identification of Phosphorylation-Dependent Binding Partners of Aquaporin-2 Using Protein Mass Spectrometry ...
Aquaporin-2 (254-267), pSER261, human
Quantitative phosphoproteomics of vasopressin-sensitive renal cells: Regulation of aquaporin-2 phosphorylation at two sites |...
aquaporin;. dDAVP,. (deamino-Cys1, d-Arg8)vasopressin;. FT,. Fourier transform;. ICR,. ion cyclotron resonance;. IMAC,. ... Quantitative phosphoproteomics of vasopressin-sensitive renal cells: Regulation of aquaporin-2 phosphorylation at two sites. ... Quantitative phosphoproteomics of vasopressin-sensitive renal cells: Regulation of aquaporin-2 phosphorylation at two sites ... Quantitative phosphoproteomics of vasopressin-sensitive renal cells: Regulation of aquaporin-2 phosphorylation at two sites ...
AQP1 - Aquaporin 1 splice variant 2 - Homo sapiens (Human) - AQP1 gene & protein
Aquaporin 1 splice variant 2Imported. ,p>Information which has been imported from another database using automatic procedures ... Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]SAAS annotation. Automatic assertion according to rulesi ... tr,Q6JSD8,Q6JSD8_HUMAN Aquaporin 1 splice variant 2 (Fragment) OS=Homo sapiens OX=9606 GN=AQP1 PE=2 SV=1 ...
Aquaporin 2 Antibody (PA5-78808)
Invitrogen Anti-Aquaporin 2 Polyclonal, Catalog # PA5-78808. Tested in Western Blot (WB), Immunohistochemistry (Frozen) (IHC (F ... Aquaporin-CD; Collecting duct water channel protein; Water channel protein for renal collecting duct; water-channel aquaporin 2 ... Cite Aquaporin 2 Polyclonal Antibody. The following antibody was used in this experiment: Aquaporin 2 Polyclonal Antibody from ... Sample was incubated with Aquaporin 2 polyclonal antibody (Product# PA5-78808).. Western blot analysis of Aquaporin 2 in Lane 1 ...
Aquaporin 2 Antibody (PA5-22865)
Amelioration of polyuria in nephrogenic diabetes insipidus due to aquaporin-2 deficiency
AQP-2 deficiency in these patients with an early-stop codon is associated with complete unresponsiveness of the collecting duct ... to vasopressin, implying an indispensable role for AQP-2 in vasopressin antidiuresis. Urinary PGE2 and 6-keto PGF1 alpha are ... Amelioration of polyuria in nephrogenic diabetes insipidus due to aquaporin-2 deficiency Clin Endocrinol (Oxf). 1998 Jul;49(1): ... due to an autosomal recessive aquaporin-2 (AQP-2) early-stop codon. This paper describes the clinical manifestations and ...
Diffusion in the endoplasmic reticulum of an aquaporin-2 mutant causing human nephrogenic diabetes insipidus. - PubMed - NCBI
Mutations in the aquaporin-2 (AQP2) water channel cause the hereditary renal disease nephrogenic diabetes insipidus (NDI). The ... Diffusion in the endoplasmic reticulum of an aquaporin-2 mutant causing human nephrogenic diabetes insipidus.. Levin MH1, ... ATP depletion by 2-deoxyglucose and azide resulted in comparable slowing/immobilization of wild-type and T126M AQP2. These ... AQP2 translational diffusion in the ER was not slowed by the T126M mutation; diffusion coefficients were (in cm(2)/s x 10(-)10 ...
Plants | Free Full-Text | Accumulation of TIP2;2 Aquaporin during Dark Adaptation Is Partially PhyA Dependent in Roots of...
In Arabidopsis thaliana, mRNA levels of one of the aquaporin genes, TIP2;2, increase during dark adaptation and decrease under ... Numerous studies have described the light regulation of aquaporin genes, but none have identified the regulatory mechanisms ... Fluorescence of TIP2;2-GFP protein in the endodermis of roots in the wild-type seedlings increased during dark adaptation, but ... In this paper, we focus on the role of phytochrome A (phyA) signaling in the regulation of the TIP2;2 protein. We generated ...
IJMS | Free Full-Text | Urine Aquaporin-2: A Promising Marker of Response to the Arginine Vasopressin Type-2 Antagonist,...
Urine aquaporin-2 has recently been demonstrated as a promising predictor of response to tolvaptan. We here validated aquaporin ... Long-term efficacy of tolvaptan treatment in the responders defined by aquaporin-2 needs to be validated in the future ... a member of the aquaporin family, is an arginine vasopressin-regulated water channel expressed in the renal collecting duct, ... The arginine vasopressin type-2 antagonist, tolvaptan, is a new-generation diuretic; it is especially indicated in patients ...
Patients with autosomal nephrogenic diabetes insipidus homozygous for mutations in the aquaporin 2 water-channel gene
Recently, mutations in the autosomal gene coding for water-channel aquaporin 2 (AQP2) of the renal collecting duct … ... Patients with autosomal nephrogenic diabetes insipidus homozygous for mutations in the aquaporin 2 water-channel gene Am J Hum ... In the present study, missense mutations and a single nucleotide deletion in the aquaporin 2 gene of three NDI patients from ... Recently, mutations in the autosomal gene coding for water-channel aquaporin 2 (AQP2) of the renal collecting duct were ...
Physiology and Pathophysiology of the Aquaporin-2 Water Channel - NDI Foundation
In mammals six different aquaporins have been identified up to now, four of which (aquaporin-1 to aquaporin-4) are expressed in ... Because of its importance for normal water homeostasis and its involvement in many water balance disorders, aquaporin-2, the ... Aquaporins are integral membrane proteins, which function as specialized water channels to facilitate the passage of water ... In mammals six different aquaporins have been identified up to now, four of which (aquaporin-1 to aquaporin-4) are expressed in ...
Molecular evolution of mammalian aquaporin-2. Further evidence trhat elephant shrew and aardvark join the paenungulate clade
Fluconazole increases osmotic water transport in renal collecting duct through effects on aquaporin-2 trafficking | MDC Berlin
Inner Ear Arginine Vasopressin-Vasopressin Receptor 2-Aquaporin 2 Signaling Pathway Is Involved in the Induction of Motion...
... and the aquaporin 2 (AQP2) signaling pathway in the inner ear play important roles in hearing and balance functions through ... aquaporin 2 signaling pathway was potentially involved in the development of motion sickness and that blocking V2R with ... In the present study our results showed that activation of the inner ear arginine vasopressin-vaspopressin receptor 2 (V2R)- ... Inner Ear Arginine Vasopressin-Vasopressin Receptor 2-Aquaporin 2 Signaling Pathway Is Involved in the Induction of Motion ...
GATA2 Regulates Body Water Homeostasis through Maintaining Aquaporin 2 Expression in Renal Collecting Ducts | Molecular and...
Roles of aquaporins in kidney revealed by transgenic mice. Semin. Nephrol. 26:200-208. doi:10.1016/j.semnephrol.2006.02.002. ... Regulation of aquaporin-2 gene transcription by GATA-3. Biochem. Biophys. Res. Commun. 232:65-68. doi:10.1006/bbrc.1997.6236. ... Aquaporin-2 abundance in the renal collecting duct: new insights from cultured cell models. Am. J. Physiol. Renal Physiol. 297: ... Nephrogenic diabetes insipidus in mice lacking aquaporin-3 water channels. Proc. Natl. Acad. Sci. U. S. A. 97:4386-4391. doi: ...
Bile Acid G Protein-Coupled Membrane Receptor TGR5 Modulates Aquaporin 2-Mediated Water Homeostasis | American Society of...
Bile Acid G Protein-Coupled Membrane Receptor TGR5 Modulates Aquaporin 2-Mediated Water Homeostasis. Suchun Li, Miaojuan Qiu, ... Bile Acid G Protein-Coupled Membrane Receptor TGR5 Modulates Aquaporin 2-Mediated Water Homeostasis ... Bile Acid G Protein-Coupled Membrane Receptor TGR5 Modulates Aquaporin 2-Mediated Water Homeostasis ... Bile Acid G Protein-Coupled Membrane Receptor TGR5 Modulates Aquaporin 2-Mediated Water Homeostasis ...
Aquaporin 2 is a vasopressin-independent, constitutive apical membrane protein in rat vas deferens. | Harvard Catalyst Profiles...
Aquaporin 2 is a vasopressin-independent, constitutive apical membrane protein in rat vas deferens. . 2000 Apr; 278(4):C791-802 ... Aquaporin 2 is a vasopressin-independent, constitutive apical membrane protein in rat vas deferens. ... Aquaporin 2 is a vasopressin-independent, constitutive apical membrane protein in rat vas deferens. ...
Anti-AQP2 / Aquaporin 2 Antibody | Rabbit anti-Rat Polyclonal | LSBio
Aquaporin 2 antibody LS-C3796 is an unconjugated rabbit polyclonal antibody to rat Aquaporin 2 (AQP2). Validated for ELISA, IF ... Aquaporin 2 antibody LS-C3796 is an unconjugated rabbit polyclonal antibody to rat Aquaporin 2 (AQP2). Validated for ELISA, IF ... Aquaporin 2 antibody LS-C3796 is an unconjugated rabbit polyclonal antibody to rat Aquaporin 2 (AQP2). Validated for ELISA, IF ... Recognizes rat Aquaporin 2 (AQP-CD/WCH-CD). Species sequence homology: mouse: 100%; human and ovine: 93% (14/15aa; residues 257 ...
Anti-AQP2 / Aquaporin 2 | General | Primary Antibodies | Antibodies | Products | Biomol GmbH - Life Science Shop
... also called AQUAPORIN-CD, is found in the apical cell membranes of the kidneys collecting duct principal cells and in ... AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidneys collecting duct principal ... Product information "Anti-AQP2 / Aquaporin 2" 0.5mg/ml if reconstituted with 0.2ml sterile DI water. ... Amino acids EPDTDWEEREVRRRQSVELHSPQSLPRGTKA of human Aquaporin 2 were used as the immunogen for the Aquaporin 2 antibody.. ...
Are aquaporin 4 antibodies appear in any other context than Devic's syndrom? - Page 2
Thread: Are aquaporin 4 antibodies appear in any other context than Devics syndrom? ... Are aquaporin 4 antibodies appear in any other context than Devics syndrom? ... I imagine it would be easier if there was at least a single good thing to look forward but there is nothing.[SIZE=2][/SIZE] ... She was released from the hospital yesterday where she got taken because of the rash from carbamazepin.[SIZE=2][/SIZE] ...
Anti-Aquaporin 2 (254-271) Rabbit pAb | 178612
Rabbit pAb Anti-Aquaporin 2 (254-271), rabbit polyclonal, recognizes the ~40 and ~29 kDa forms of aquaporin-2 in rat kidney ... Anti-Aquaporin 2 (254-271) Rabbit pAb MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other ... Anti-Aquaporin 2 (254-271), rabbit polyclonal, recognizes the ~40 and ~29 kDa forms of aquaporin-2 in rat kidney membrane. ... Detection of rat aquaporin 2 by immunoblotting. Samples: Rat kidney membranes (lane 1) and preincubated with a control peptide ...
Dual Effects of Hypertonicity on Aquaporin-2 Expression in Cultured Renal Collecting Duct Principal Cells | American Society of...
Dual Effects of Hypertonicity on Aquaporin-2 Expression in Cultured Renal Collecting Duct Principal Cells. Udo Hasler, Manlio ... Dual Effects of Hypertonicity on Aquaporin-2 Expression in Cultured Renal Collecting Duct Principal Cells ... Dual Effects of Hypertonicity on Aquaporin-2 Expression in Cultured Renal Collecting Duct Principal Cells ... Dual Effects of Hypertonicity on Aquaporin-2 Expression in Cultured Renal Collecting Duct Principal Cells ...
Ménière's Disease Pathophysiology: Endolymphatic Sac Immunohistochemical Study of Aquaporin-2, V2R Vasopressin Receptor, NKCC2,...
Ménières Disease Pathophysiology: Endolymphatic Sac Immunohistochemical Study of Aquaporin-2, V2R Vasopressin Receptor, NKCC2 ... Ménières Disease Pathophysiology: Endolymphatic Sac Immunohistochemical Study of Aquaporin-2, V2R Vasopressin Receptor, NKCC2 ... aquaporin-2 (AQP2), vasopressin receptor V2R, sodium potassium chloride cotransporter 2 (NKCC2), and transient receptor ...
A Heterotrimeric G Protein of the Gi Family is Required for cAMP-triggered Trafficking of Aquaporin 2 in Kidney Epithelial...
Central to its antidiuretic action in mammals is the redistribution of the water channel aquaporin 2 (AQP2) from intracellular ... a peptide corresponding to the alpha subunits of Gi1/2 was much less potent. Thus a member of the Gi family, most likely Gi3, ... Aquaporin-2 is a water-transporting protein located in the principal cells of the kidney collecting duct. Its function is to ... aquaporin 2 DEFINITION: Also called WCH-CD, this water channel makes the principal cells of the inner medullary collecting duct ...
Aquaporin-2 expression in primary cultured rat inner medullary collecting duct cells. - Semantic Scholar
We show here that primary cultures of rat inner medullary collecting duct (IMCD) cells retain AQP-2 expression for at least 6 ... We also found that coating the culture dishes with type IV collagen, rather than rat-tail collagen, retards AQP-2 ... Our data show that cAMP supplementation is sufficient for the maintenance of AQP-2 expression in primary cultured cells. The ... Immunofluorescence and biochemical studies indicate a shuttling of AQP-2-bearing vesicles after stimulation with vasopressin or ...
Proteomic analysis of lithium-induced nephrogenic diabetes insipidus: Mechanisms for aquaporin 2 down-regulation and cellular...
However, chronic treatment with lithium induces numerous kidney-related side effects, such as dramatically reduced aquaporin 2 ... Proteomic analysis of lithium-induced nephrogenic diabetes insipidus: Mechanisms for aquaporin 2 down-regulation and cellular ... After 1 or 2 weeks of lithium treatment, we identified 6 and 74 proteins with altered abundance compared with controls, ... As a model system, inner medullary collecting ducts (IMCD) isolated from rats treated with lithium for either 1 or 2 weeks were ...
Calcium signaling in vasopressin-induced aquaporin-2 trafficking<...
Balasubramanian, L., Sham, J. S. K., & Yip, K. P. (2008). Calcium signaling in vasopressin-induced aquaporin-2 trafficking. ... Calcium signaling in vasopressin-induced aquaporin-2 trafficking. / Balasubramanian, Lavanya; Sham, James S.K.; Yip, Kay Pong. ... Balasubramanian, L, Sham, JSK & Yip, KP 2008, Calcium signaling in vasopressin-induced aquaporin-2 trafficking, Pflugers ... It has been the general consensus that cAMP-mediated PKA-dependent phosphorylation of aquaporin-2 is the primary mechanism of ...
Vasopressin regulates apical targeting of aquaporin-2 but not of UT1 urea transporter in renal collecting duct. - Semantic...
... namely aquaporin-2 (AQP2) and the vasopressin-regulated urea transporter (VRUT). Both are present in intracellular vesicles as ... Acute and chronic metabolic acidosis interferes with aquaporin-2 translocation in the rat kidney collecting ducts. Tomohiko ... Vasopressin regulates apical targeting of aquaporin-2 but not of UT1 urea transporter in renal collecting duct.. @article{ ... In the renal inner medullary collecting duct (IMCD), vasopressin regulates two key transporters, namely aquaporin-2 (AQP2) and ...
AQP2ProteinTranslocationAntibodyMutationsMembraneGenePhosphorylationAQPsNephrogenicRegulationPermeabilityAQP1ArgininePathophysiologyTargeting of aquaporin-2 waterUrineMutationAQP3Collecting duct cellsReceptorGenesCell membranesExpression of aquaporinFunction of aquaporinProteinsMolecularUrea transporterAntibodiesGlycerolMembranesIntracellularVasopressin-inducedEpithelialMammalianRegulated by vasopressinRegulates the expressionAbundanceHumanMRNA expressionPeptide
AQP242
- This aquaporin is regulated in two ways by the peptide hormone vasopressin: short-term regulation (minutes) through trafficking of AQP2 vesicles to the apical region where they fuse with the apical plasma membrane long-term regulation (days) through an increase in AQP2 gene expression. (wikipedia.org)
- Vasopressin-mediated control of water permeability in the renal collecting duct occurs in part through regulation of the distribution of aquaporin-2 (AQP2) between the apical plasma membrane and intracellular membrane compartments. (nih.gov)
- Our studies confirmed previously identified interactions between AQP2 and hsc70, hsp70-1 and -2, as well as annexin II. (nih.gov)
- This peptide is a fragment of the human aquaporin-2 (AQP2) phosphorylated at Ser261. (anaspec.com)
- Previously unidentified phosphorylation sites were found for membrane proteins essential to collecting duct physiology, including eight sites among aquaporin-2 (AQP2), aquaporin-4, and urea transporter isoforms A1 and A3. (pnas.org)
- Aquaporin 2 (AQP2) is a hormonally regulated water channel located in the renal collecting duct. (thermofisher.com)
- Mutations in the aquaporin-2 (AQP2) water channel cause the hereditary renal disease nephrogenic diabetes insipidus (NDI). (nih.gov)
- ATP depletion by 2-deoxyglucose and azide resulted in comparable slowing/immobilization of wild-type and T126M AQP2. (nih.gov)
- Recently, mutations in the autosomal gene coding for water-channel aquaporin 2 (AQP2) of the renal collecting duct were reported in an NDI patient. (nih.gov)
- What follows in this process is not entirely clear, but it leads to water-transporting proteins called aquaporin-2 ( AQP2 proteins ) traveling from their holding place inside the CD cell to the apical membrane of the cell . (ndif.org)
- At present, there is speculation that a vesicle targeting protein , VAMP-2, that has been found in the AQP2-bearing vesicles may guide the vesicles to the membrane and then bind with a protein called syntaxin-4 that is expressed in the apical membrane of CD cells . (ndif.org)
- BACKGROUND: Arginine-vasopressin (AVP) binding to vasopressin V2 receptors promotes redistribution of the water channel aquaporin-2 (AQP2) from intracellular vesicles into the plasma membrane of renal collecting duct principal cells. (mdc-berlin.de)
- Upon purification of the GFP-positive cells, we found that collecting duct (CD)-specific markers, including aquaporin 2 (Aqp2), an important channel for water reabsorption from urine, were abundantly expressed. (asm.org)
- Avp is an antidiuretic hormone secreted from the hypothalamic neurons, and the primary target of the Avp signaling for urine volume regulation is Aqp2 ( 2 , 3 , 4 ). (asm.org)
- Avp binds to Avpr2 (Avp receptor type 2) in the principal cells of CD and subsequently induces phosphorylation of Aqp2 (via protein kinase A [PKA]) and its translocation to the luminal side of the principal cells. (asm.org)
- Methods We used tubule suspensions of inner medullary collecting duct (IMCD) cells from rat kidneys to investigate the effect of TGR5 signaling on aquaporin-2 (AQP2) expression, and examined the in vivo effects of TGR5 in mice with lithium-induced nephrogenic diabetes insipidus (NDI) and Tgr5 knockout ( Tgr5 −/− ) mice. (asnjournals.org)
- Aquaporin 2 antibody LS-C3796 is an unconjugated rabbit polyclonal antibody to rat Aquaporin 2 (AQP2). (lsbio.com)
- AQP2 (Aquaporin 2), also called. (biomol.com)
- AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. (biomol.com)
- We identified from the literature a group of proteins expressed on the ELS and involved in endolymph volume regulation: aquaporin-2 (AQP2), vasopressin receptor V2R, sodium potassium chloride cotransporter 2 (NKCC2), and transient receptor potential cation channel V4 (TRPV4). (iric.ca)
- Central to its antidiuretic action in mammals is the redistribution of the water channel aquaporin 2 ( AQP2 ) from intracellular vesicles to the apical membrane of kidney epithelial cells , an event initiated by an increase in cAMP and activation of protein kinase A . The subsequent steps of the signaling cascade are not known. (ndif.org)
- When the antidiuretic hormone , arginine vasopressin ( AVP ) binds with the vasopressin-2 receptor ( V2R ) it sends a signal to AQP2 vesicles waiting in the ER to shuttle to the cell membrane so the AQP2 can be inserted in it. (ndif.org)
- However, chronic treatment with lithium induces numerous kidney-related side effects, such as dramatically reduced aquaporin 2 (AQP2) abundance, altered renal function, and structural changes. (jhu.edu)
- As a model system, inner medullary collecting ducts (IMCD) isolated from rats treated with lithium for either 1 or 2 weeks were subjected to differential 2D gel electrophoresis combined with mass spectrometry and bioinformatics analysis to identify (i) signaling pathways affected by lithium and (ii) unique candidate proteins for AQP2 regulation. (jhu.edu)
- In the renal inner medullary collecting duct (IMCD), vasopressin regulates two key transporters, namely aquaporin-2 (AQP2) and the vasopressin-regulated urea transporter (VRUT). (semanticscholar.org)
- In the renal collecting duct, vasopressin regulates water permeability by a process that involves stimulation of adenylyl cyclase activity, cAMP production and subsequent translocation of water channel aquaporin-2 (AQP2) into the apical plasma membrane. (docphin.com)
- The AQP2 gene provides instructions for making a protein called aquaporin 2. (medlineplus.gov)
- Most of the known AQP2 gene mutations cause the aquaporin 2 protein to be misfolded into an incorrect 3-dimensional shape. (medlineplus.gov)
- Aquaporin-2 (AQP2) is an arginine vasopressin (AVP)-regulated water channel protein localized to the apical region of renal collecting duct cells and is involved in the regulation of water permeability. (elsevier.com)
- diabetes insipidus: Types and causes: …in a gene known as AQP2 (aquaporin 2), which encodes a specific form of aquaporin. (britannica.com)
- Mutations in the aquaporin-2 gene (AQP2), encoding the vasopressin-regulated water channel of the renal collecting duct, are responsible for the autosomal recessive or dominant forms of congenital nephrogenic diabetes insipidus. (elsevier.com)
- Lack of arginine vasopressin-induced phosphorylation of aquaporin-2 mutant AQP2-R254L explains dominant nephrogenic diabetes insipidus. (ru.nl)
- Water homeostasis in humans is regulated by vasopressin, which induces the translocation of homotetrameric aquaporin-2 (AQP2) water channels from intracellular vesicles to the apical membrane of renal principal cells. (ru.nl)
- Since the carboxyl terminus of aquaporin-2 (AQP2c) has a class I PDZ-interacting motif (X-T/S-X-Φ), the role of SNX27 in the regulation of AQP2 was studied. (au.dk)
- AVP increases the osmotic water permeability of the collecting duct cells through aquaporin-2 (AQP2) and aquaporin-3 (AQP3). (bvsalud.org)
- Binding of AVP to the arginine vasopressin receptor type 2 (AVPR2) in the basolateral membrane leads to translocation of aquaporin 2 (AQP2) water channels to the apical membrane of the collecting duct principal cells, inducing water permeability of the membrane. (springer.com)
- Aquaporin-2 (AQP2), when expressed in fully differentiated 3T3-L1 adipocytes, displays cAMP-dependent plasma membrane translocation in a manner similar to its behavior in renal epithelial cells. (elsevier.com)
- Interestingly, however, the peripheral AQP2 vesicles significantly overlapped vesicle-associated membrane protein-2, underscoring the role of the latter in hormone-regulated exocytosis. (elsevier.com)
- We tested whether severe congestive heart\ud failure (CHF), a condition associated with excess free-water retention, is accompanied by altered regulation of the vasopressin-regulated water channel, aquaporin-2 (AQP2), in the renal collecting duct. (core.ac.uk)
- Here, we describe the identification of a single base pair change in aquaporin-2 (Aqp2) in cph mutants through genetic linkage mapping. (wustl.edu)
- Hsp90 inhibitor partially corrects nephrogenic diabetes insipidus in a conditional knock-in mouse model of aquaporin-2 mutation Mutations in aquaporin-2 (AQP2) that interfere with its cellular processing can produce autosomal recessive nephrogenic diabetes insipidus (NDI). (tripdatabase.com)
- A recent study revealed that bottlenose dolphins acquired a novel isoform of aquaporin 2 generated by alternative splicing (alternative AQP2), which helps dolphins to live in hyperosmotic seawater. (bireme.br)
Protein31
- Identification of phosphorylation-dependent binding partners of aquaporin-2 using protein mass spectrometry. (nih.gov)
- In Arabidopsis thaliana , mRNA levels of one of the aquaporin genes, TIP2;2 , increase during dark adaptation and decrease under far-red light illumination, but the effects of light at the protein level and on the mechanism of light regulation remain unknown. (mdpi.com)
- In this paper, we focus on the role of phytochrome A (phyA) signaling in the regulation of the TIP2;2 protein. (mdpi.com)
- We generated Arabidopsis transgenic plants expressing a TIP2;2-GFP fusion protein driven by its own promoter, and showed several differences in TIP2;2 behavior between wild type and the phyA mutant. (mdpi.com)
- Fluorescence of TIP2;2-GFP protein in the endodermis of roots in the wild-type seedlings increased during dark adaptation, but not in the phyA mutant. (mdpi.com)
- The amount of the TIP2;2-GFP protein in wild-type seedlings decreased rapidly under far-red light illumination, and a delay in reduction of TIP2;2-GFP was observed in the phyA mutant. (mdpi.com)
- Aquaporin 2 is a vasopressin-independent, constitutive apical membrane protein in rat vas deferens. (harvard.edu)
- Aquaporin-2 is a water-transporting protein located in the principal cells of the kidney collecting duct . (ndif.org)
- Protein kinase A phosphorylation is involved in regulated exocytosis of aquaporin-2 in transfected LLC-PK1 cells. (semanticscholar.org)
- We demonstrate that members of several signaling pathways are activated by lithium treatment, including the PKB/Akt-kinase and the mitogen-activated protein kinases (MAPK), such as extracellular regulated kinase (ERK), c-Jun NH(2)-terminal kinase (JNK), and p38. (jhu.edu)
- Exogenous cAMP analog (8-pCPT-2′-O-Me-cAMP), which activates Epac (exchange protein directly activated by cAMP), but not PKA, triggers Ca 2+ mobilization and apical exocytosis. (elsevier.com)
- Aquaporin 3 is the protein product of the human AQP3 gene. (wikipedia.org)
- Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Tight Junction Protein 2 (TJP2) in Tissue homogenates, cell lysates and other biological fluids. (aquaporins.org)
- Known also as Tight Junction Protein 2 elisa. (aquaporins.org)
- Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Tight Junction Protein 2 (TJP2) in samples from Tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. (aquaporins.org)
- Here, we demonstrate that high intracellular CO 2 /HCO 3 − enhances currents mediated by the Arabidopsis thaliana guard cell S-type anion channel SLAC1 upon coexpression of any one of the Arabidopsis protein kinases OST1, CPK6, or CPK23 in Xenopus laevis oocytes. (plantcell.org)
- These findings identify the CO 2 -permeable PIP2;1 as key interactor of βCA4 and demonstrate functional reconstitution of extracellular CO 2 signaling to ion channel regulation upon coexpression of PIP2;1, βCA4, SLAC1, and protein kinases. (plantcell.org)
- These data further implicate SLAC1 as a bicarbonate-responsive protein contributing to CO 2 regulation of S-type anion channels. (plantcell.org)
- A synthetic peptide from the n-terminal region of human Aquaporin 7 (AQP7) conjugated to an immunogenic carrier protein was used as the immunogen. (novusbio.com)
- Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. (novusbio.com)
- Aquaporin-11: a channel protein lacking apparent transport function expressed in brain. (ebi.ac.uk)
- 2. Aquaporins are protein tunnels that allow which important molecule to travel across a cell membrane? (study.com)
- Aquaporin 2 (Ab-256) Antibody detects endogenous levels of total Aquaporin 2 protein. (genetex.com)
- Aquaporins (AQPs) are membrane protein channels that allow the rapid movement of water through epithelium . (bvsalud.org)
- Exogenous administration of 1-deamino-8- d -AVP produced an antidiuresis and expressed AQP-2 mRNA and AQP-2 protein in the renal medulla of the homozygous Brattleboro rats. (physiology.org)
- Increases in AQP-2 mRNA expression and AQP-2 protein were evident in Long-Evans rats after 64 h of water deprivation, with a severity of dehydration almost equal to the 12-h dehydrated, homozygous Brattleboro rats. (physiology.org)
- There are a few reports in homozygous Brattleboro rats showing that there is no change in AQP-2 protein in response to water deprivation and that 1-deamino-8- d -arginine vasopressin (dDAVP) treatment increased its expression ( 4 , 20 , 26 ). (physiology.org)
- Aquaporin-1 is an integral membrane protein that is considered to have an "open" structure. (proteopedia.org)
- Protein Kinase C (PKC) has been documented as a common signal transducer among the aquaporins. (proteopedia.org)
- Benga G. The first discovered water channel protein, later called aquaporin 1: molecular characteristics, functions and medical implications. (proteopedia.org)
- Combined immunological and proteomic approaches revealed that phosphorylation at two C-terminal sites (Ser280, Ser283) of PLASMA MEMBRANE INTRINSIC PROTEIN 2;1 ( At PIP2;1), a major plasma membrane aquaporin in rosettes, shows circadian oscillations and is correlated with K ros . (plantcell.org)
Translocation3
- Ser-261 phospho-regulation is involved in pS256 and pS269-mediated aquaporin-2 apical translocation. (phosphosolutions.com)
- In response to AVP there is an increased expression of AQP-2, its phosphorylation, and consequent translocation from intracellular vesicles to the apical membrane of the collecting duct epithelial cells ( 4 ). (pnas.org)
- These studies demonstrated that vasopressin regulates phosphorylation of a cluster of four serines in the carboxy-terminal tail of aquaporin-2 as a critical step in its translocation to the cell membrane. (nih.gov)
Antibody10
- The following antibody was used in this experiment: Aquaporin 2 Polyclonal Antibody from Thermo Fisher Scientific, catalog # PA5-78808, RRID AB_2745924. (thermofisher.com)
- Amino acids EPDTDWEEREVRRRQSVELHSPQSLPRGTKA of human Aquaporin 2 were used as the immunogen for the Aquaporin 2 antibody. (biomol.com)
- Primary antibody: Anti-Aquaporin 2 (254-271) Rabbit pAb (Cat. (merckmillipore.com)
- The antibody is a phosphopeptide corresponding to amino acid residues surrounding the phospho-Ser 269 of rat aquaporin 2. (phosphosolutions.com)
- Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phosphoenolpyruvate Carboxykinase 2, Mitochondrial (PCK2) in serum, plasma, tissue homogenates and other biological fluids. (aquaporins.org)
- There are currently no images for Aquaporin-7 Antibody (NBP1-30862). (novusbio.com)
- Immunofluorescence analysis of HeLa cells, using Aquaporin 2 (GTX87696) Antibody. (genetex.com)
- Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-52958] - Fetal Lung tissue at a concentration of 0.5ug/ml. (novusbio.com)
- Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-52958] - Human Intestine Tissue, antibody concentration 4-8ug/ml. (novusbio.com)
- Immunohistochemistry: Asialoglycoprotein Receptor 2 Antibody [NBP1-52958] - Human cilia Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X. (novusbio.com)
Mutations6
- In the present study, missense mutations and a single nucleotide deletion in the aquaporin 2 gene of three NDI patients from consanguineous matings are described. (nih.gov)
- A few mutations result in the production of functional aquaporin 2 water channels, but these channels are misrouted within the cell and do not reach the cell membrane. (medlineplus.gov)
- Loonen AJ, Knoers NV, van Os CH, Deen PM. Aquaporin 2 mutations in nephrogenic diabetes insipidus. (medlineplus.gov)
- Mutations in aquaporin-2 cause diabitis insipidus. (proteopedia.org)
- Mutations in aquaporin-0 in mice cause congenital cataracts. (proteopedia.org)
- Activating mutations on codon 12 and 13 of the k- ras gene [ 14 , 15 ], upregulation of cyclo-oxygenase 2 (COX-2), and inducible nitric oxide synthase (iNOS), as well as alterations in transforming growth factor β signaling, are also common features to both human and AOM-induced colon cancers [ 24 - 29 ]. (hindawi.com)
Membrane23
- When it is needed, vasopressin binds to the cell surface vasopressin receptor thereby activating a signaling pathway that causes the aquaporin 2 containing vesicles to fuse with the plasma membrane, so the aquaporin 2 can be used by the cell. (wikipedia.org)
- Much faster diffusion was found for a lipid probe (diOC(4)(3), 2.7 x 10(-)8 cm(2)/s) in the ER membrane and for unconjugated GFP in the aqueous ER lumen (6 x 10(-)8 cm(2)/s). (nih.gov)
- Aquaporins are integral membrane proteins , which function as specialized water channels to facilitate the passage of water through the cell membrane . (ndif.org)
- Anti-Aquaporin 2 (254-271), rabbit polyclonal, recognizes the ~40 and ~29 kDa forms of aquaporin-2 in rat kidney membrane. (merckmillipore.com)
- Vasopressin-stimulated increase in phosphorylation at serine 269 potentiates plasma membrane retention of aquaporin 2. (phosphosolutions.com)
- This hormone triggers chemical reactions that ultimately insert aquaporin 2 water channels into the membrane of collecting duct cells. (medlineplus.gov)
- Without signals from ADH, aquaporin 2 water channels are removed from the membrane of collecting duct cells. (medlineplus.gov)
- If aquaporin 2 water channels are not inserted into the membrane of collecting duct cells, the kidneys are unable to respond to signals from ADH. (medlineplus.gov)
- The aquaporins (AQPs) are a family of integral membrane proteins composed of two subfamilies: the orthodox aquaporins, which transport only water, and the aquaglyceroporins, which transport glycerol, urea, or other small solutes [ PMID: 16650285 ]. (ebi.ac.uk)
- Aquaporins contain two tandem repeats, each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA). (ebi.ac.uk)
- Aquaporins (Aqps) are a superfamily of integral membrane proteins which generally facilitate the permeation of water through plasma membranes. (frontiersin.org)
- Secretin promotes osmotic water transport in rat cholangiocytes by incresing aquaporin-1 water channels in plasma membrane. (wiley.com)
- Aquaporins are channel producing proteins which regulate the flow of water across the cell membrane. (proteopedia.org)
- Aquaporin-3 function is to promote glycerol permeability across cell membrane. (proteopedia.org)
- AQP-expressing cells generally contain several thousands, or more, AQPs per μm 2 of membrane, as compared with ten or fewer ion channels per μm 2 of membrane. (biologists.org)
- The aquaporins (AQPs) are small integral membrane proteins that transport water and in some cases small solutes such as glycerol. (springer.com)
- Aquaporins (AQPs) are membrane proteins that form water channels, allowing rapid movement of water across cell membranes. (biologists.org)
- This occurs through increased transcription and insertion of water channels ( Aquaporin-2 ) into the apical membrane of collecting tubule and collecting duct epithelial cells. (wikipedia.org)
- Aquaporins (AQPs) are integral membrane proteins that form pores in the membrane of biological cells. (cosmeticsandtoiletries.com)
- Alport syndrome is a hereditary progressive nephropathy characterized by lamellation and splitting of glomerular basement membrane (GBM) and associated with sensorineural defect leading to hearing loss and ocular defects (2). (ifcc.org)
- Aquaporins are integral membrane proteins that specialize in the regulation of cellular water flow across the cell membrane. (proteopedia.org)
- 1] "The Nicotiana tabacum plasma membrane aquaporin NtAQP1 is mercury-insensitive and permeable for glycerol. (tcdb.org)
- it regulates trafficking of aquaporin-2 water channels to and from the plasma membrane, and it regulates the expression of the aquaporin-2 gene in renal collecting duct cells. (nih.gov)
Gene12
- Transcriptional regulation of aquaporin-2 water channel gene by cAMP. (semanticscholar.org)
- Aquaporin-2 levels in vitro and in vivo are regulated by VACM-1, a cul 5 gene. (docphin.com)
- We characterized an aquaporin gene HvPIP2;5 from Hordeum vulgare and investigated its physiological roles in heterologous expression systems, yeast and Arabidopsis , under high salt and high osmotic stress conditions. (frontiersin.org)
- Da T, Verkman AS (2004) Aquaporin-4 gene disruption in mice protects against impaired retinal function and cell death after ischemia. (springer.com)
- The present study was undertaken to determine whether there is an AVP-independent regulation of AQP-2 gene expression in homozygous Brattleboro rats in which endogenous AVP is absent. (physiology.org)
- Also, the 5′-flanking region of the AQP-2 gene contains cAMP-responsive element ( 27 ). (physiology.org)
- AVP is known to be the important regulator of the transcription rates of the AQP-2 gene ( 10 , 17 ). (physiology.org)
- However, other factors that might be involved in the regulation of AQP-2 gene expression could not be ruled out ( 5 , 16 ). (physiology.org)
- Male homozygous Brattleboro rats, weighing 250-280 g, in which endogenous AVP was absent due to an inherited defect in the AVP gene ( 25 , 28 ) were used in the present experiments to examine the expression of AQP-2 mRNA in the kidneys in the presence or absence of exogenous dDAVP. (physiology.org)
- Vasopressin, acting through cAMP, also increases transcription of the aquaporin-2 gene, thus increasing the total number of aquaporin-2 molecules in collecting duct cells. (wikipedia.org)
- The disease occurs at a gene frequency of 1/5000 and is transmitted in most families as X-linked dominant trait (2). (ifcc.org)
- We recently characterized an intracellular isoform of matrix metalloproteinase-2 (MMP-2) induced by oxidative stress-mediated activation of an alternate promoter in the first intron of the MMP-2 gene. (medworm.com)
Phosphorylation5
- Phosphorylation of serine 256 is required for cAMP-dependent regulatory exocytosis of the aquaporin-2 water channel. (semanticscholar.org)
- It has been the general consensus that cAMP-mediated PKA-dependent phosphorylation of aquaporin-2 is the primary mechanism of vasopressin to regulate osmotic water permeability in kidney collecting duct. (elsevier.com)
- Aquaporin-2 Ser-261 phosphorylation is regulated in combination with Ser-256 and Ser-269 phosphorylation. (phosphosolutions.com)
- The role of putative phosphorylation sites in the targeting and shuttling of the aquaporin-2 water channel. (physiomics.eu)
- Transgenic expression of phosphodeficient and phosphomimetic forms of this aquaporin indicated that At PIP2;1 phosphorylation is necessary but not sufficient for K ros regulation. (plantcell.org)
AQPs1
- Aquaporins 11 and 12 are classified as members of a new AQP subfamily: the subcellular AQPs [ PMID: 17178102 ]. (ebi.ac.uk)
Nephrogenic5
- Cell biological aspects of the vasopressin type-2 receptor and aquaporin 2 water channel in nephrogenic diabetes insipidus" (PDF). (wikipedia.org)
- We have recently reported a large cluster of patients with nephrogenic diabetes insipidus (NDI) due to an autosomal recessive aquaporin-2 (AQP-2) early-stop codon. (nih.gov)
- Diffusion in the endoplasmic reticulum of an aquaporin-2 mutant causing human nephrogenic diabetes insipidus. (nih.gov)
- Shalev H, Romanovsky I, Knoers NV, Lupa S, Landau D (2004) Bladder function impairment in aquaporin-2 defective nephrogenic diabetes insipidus. (springer.com)
- Lithium (Li)-induced nephrogenic diabetes insipidus (NDI) has been attributed to the increased production of renal prostaglandin (PG)E(2). (tripdatabase.com)
Regulation7
- Numerous studies have described the light regulation of aquaporin genes, but none have identified the regulatory mechanisms behind this regulation via specific photoreceptor signaling. (mdpi.com)
- All of them have been implicated in the regulation of aquaporin-2 trafficking and/or water permeability. (elsevier.com)
- Aquaporin-4 (AQP4) is implicated in a number of physiopathological processes, particularly in the development of brain edema, and other functions such as the regulation of extracellular space volume, potassium buffering, waste clearance, and calcium signaling. (bioportfolio.com)
- An inactive PIP2;1 point mutation was identified that abrogated water and CO 2 permeability and extracellular CO 2 regulation of SLAC1 activity. (plantcell.org)
- In the present study, we further examined whether there is an AVP-independent regulation of AQP-2 mRNA expression by using the homozygous Brattleboro rats. (physiology.org)
- Aquaporin channels may be subject to intense short term regulation via signal transduction. (proteopedia.org)
- Regulation of aquaporin-2gene transcription by gate-3. (nii.ac.jp)
Permeability3
- PIP2;1 exhibited CO 2 permeability. (plantcell.org)
- Chou CL, Ma T, Yang B, Knepper MA, Verkman AS (1998) Fourfold reduction of water permeability in inner medullary collecting duct of aquaporin-4 knockout mice. (springer.com)
- Chou CL, Knepper MA, Hoek AN, Brown D, Yang B, Ma T, Verkman AS (1999) Reduced water permeability and altered ultrastructure in thin descending limb of Henle in aquaporin-1 null mice. (springer.com)
AQP13
- OBJECTIVE To evaluate trends in urine aquaporin-1 (AQP1) and perilipin 2 (PLIN2) concentrations in sufferers with very clear cell and papillary renal cell carcinoma (RCC) this analysis determined the partnership between your urine concentration of the biomarkers and tumor size, stage and grade. (medicalconsultingcenter.com)
- Aquaporin-1 (AQP1) was first discovered in human red blood cell membranes by Gheorghe Benga's research group in 1986. (proteopedia.org)
- AQP1 is formed as a tetramer in vivo , with each AQP1 monomer unit capable of transportation at a rate of ~2 trillion water molecules per second. (proteopedia.org)
Arginine4
- Aquaporin-2, a member of the aquaporin family, is an arginine vasopressin-regulated water channel expressed in the renal collecting duct, and a promising marker of the concentrating and diluting ability of the kidney. (mdpi.com)
- In order for the kidney to be able to reabsorb body water flowing through its collecting ducts (CDs), the following molecular sequence must take place: The antidiuretic hormone , arginine vasopressin ( AVP ) must bind with the vasopressin-2 receptor ( V2R ) located in the basolateral membranes of the principal cells of the kidney CDs. (ndif.org)
- We describe two new families with normal hypotensive and coagulation responses following the administration of desamino-8-D-arginine AVP, a clinical suggestion of normal vasopressin-2 receptors. (elsevier.com)
- Arginine vasopressin (AVP) plays an important role in the expression of aquaporin (AQP-2) in the collecting duct. (physiology.org)
Pathophysiology1
- Ménière's Disease Pathophysiology: Endolymphatic Sac Immunohistochemical Study of Aquaporin-2, V2R Vasopressin Receptor, NKCC2, and TRPV4. (iric.ca)
Targeting of aquaporin-2 water1
- Congestive heart failure in rats is associated with increased expression and targeting of aquaporin-2 water channel in collecting duct. (semanticscholar.org)
Urine8
- The basic job of aquaporin 2 is to reabsorb water from the urine while its being removed from the blood by the kidney. (wikipedia.org)
- Urine aquaporin-2 has recently been demonstrated as a promising predictor of response to tolvaptan. (mdpi.com)
- Requirement of human renal water channel aquaporin-2 for vasopressin-dependent concentration of urine. (medlineplus.gov)
- The persistent high urine volume after AVP administration was traced to a reduction in aquaporin-1 expression in the kidney of LXRβ −/− mice. (pnas.org)
- Keywords: Kidney Tumor, Urine Biomarkers, Aquaporin-1, Perilipin 2 Launch Renal cell carcinoma (RCC) may be the most lethal urologic malignancy1 and buy SB-742457 there's been a reliable rise in its occurrence1C5. (medicalconsultingcenter.com)
- Aquaporin-2 function is to reabsorb water from urine in the kidney. (proteopedia.org)
- metabolism was detected in blood, urine, bile and hepatocytes by means of the detection of [ 35 S]-SO 4 2- ions. (tripdatabase.com)
- [12] Aquaporins allow water to move down their osmotic gradient and out of the nephron, increasing the amount of water re-absorbed from the filtrate (forming urine) back into the bloodstream. (wikipedia.org)
Mutation2
- Nine patients with an AQP-2 mutation were studied. (nih.gov)
- Mutation of PIP2;1 in planta alone was insufficient to impair CO 2 - and abscisic acid-induced stomatal closing, likely due to redundancy. (plantcell.org)
AQP32
- Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. (novusbio.com)
- Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. (novusbio.com)
Collecting duct cells2
- Aquaporin-2 expression in primary cultured rat inner medullary collecting duct cells. (semanticscholar.org)
- These results indicate the lack of an AVP-independent mechanism for upregulating AQP-2 mRNA expression in renal collecting duct cells. (physiology.org)
Receptor3
- Previously we reported that extracellular nucleotides (ATP/UTP), acting through P(2y2) receptor in rat medullary collecting duct (mCD), produce and release PGE(2). (tripdatabase.com)
- Similar to other tetraspanins, CD9 generally does not function as a cell-surface receptor, but rather as an organizer of multimolecular complexes, including integrins, immunoglobulin superfamily members such as EWI-F and EWI-2, heparin-binding EGF-like growth factor, claudin-1, and other tetraspanins [ 10 ]. (nature.com)
- Synthetic peptides corresponding to ASGR2 (asialoglycoprotein receptor 2) The peptide sequence was selected from the N terminal of ASGR2. (novusbio.com)
Genes2
- In addition, the proline biosynthesis genes, Δ 1 -Pyrroline-5-Carboxylate Synthase 1 and 2 ( P5CS1 and P5CS2 ) were up-regulated in HvPIP2;5 overexpressing plants under salt and osmotic stresses, which coincided with increased levels of the osmoprotectant proline. (frontiersin.org)
- 5] "Identification of 33 rice aquaporin genes and analysis of their expression and function. (tcdb.org)
Cell membranes1
- Extensive research on the function of aquaporins have been implemented into many separate types of cell membranes. (proteopedia.org)
Expression of aquaporin1
- Suberoylanilide hydroxamic acid (SAHA) (a HDAC inhibitor) increases expression of aquaporin-3 in normal skin cells (keratinocytes). (wikipedia.org)
Function of aquaporin1
- Body water homeostasis is tightly regulated through the coordinated function of aquaporin (Aqp) that is expressed in the renal tubular cells. (asm.org)
Proteins4
- After 1 or 2 weeks of lithium treatment, we identified 6 and 74 proteins with altered abundance compared with controls, respectively. (jhu.edu)
- AQP11 is functionally distinct from other proteins of the aquaporin superfamily and could represent a new aquaporin subfamily [ PMID: 16650285 ]. (ebi.ac.uk)
- Aquaporins belong to major intrinsic proteins (MIPs) that are present from prokaryotes to plants and animals. (frontiersin.org)
- In the 1990s, he carried out seminal studies on aquaporins, a family of water channel proteins. (nih.gov)
Molecular2
- Molecular evolution of mammalian aquaporin-2. (uva.nl)
- Agre P, Kozono D. Aquaporin water channels: molecular mechanisms for human diseases. (proteopedia.org)
Urea transporter1
- Vasopressin regulates apical targeting of aquaporin-2 but not of UT1 urea transporter in renal collecting duct. (semanticscholar.org)
Antibodies3
- Are aquaporin 4 antibodies appear in any other context than Devic's syndrom? (msworld.org)
- Maintain the lyophilised/reconstituted antibodies frozen at -20°C for long term storage and refrigerated at 2-8°C for a shorter term. (osenses.com)
- Polysomnography is useful in patients with antibodies that are associated with sleep disorders, including those with the following antibodies CASPR2, DPPX, IgLON5, anti-Ma2, AQP4, and ANNA-2 antibodies. (medscape.com)
Glycerol2
- Aquaporin 7 facilitates water, glycerol and urea transport. (novusbio.com)
- A subgroup of aquaporins called aquaglycerporins allow the passage of small solutes such as glycerol, urea, and ammonia. (proteopedia.org)
Membranes2
- Aquaporin 2 is in kidney epithelial cells and usually lies dormant in intracellular vesicle membranes. (wikipedia.org)
- Samples: Rat kidney membranes (lane 1) and preincubated with a control peptide antigen (lane 2). (merckmillipore.com)
Intracellular3
- By using laser scanning confocal microscopy to monitor [Ca 2+ ] i and apical exocytosis in individual cells of inner medullary collecting duct, we have demonstrated that vasopressin also triggers intracellular Ca 2+ mobilization, which is coupled to apical exocytotic insertion of aquaporin-2. (elsevier.com)
- An Intracellular Matrix Metalloproteinase-2 Isoform Induces Tubular Regulated Necrosis: Implications for Acute Kidney Injury. (medworm.com)
- This generates an N-terminal truncated MMP-2 isoform (NTT-MMP-2) that is intracellular and associated with mitochondria. (medworm.com)
Vasopressin-induced1
- Role of renal aquaporins in escape from vasopressin-induced antidiuresis in rat. (semanticscholar.org)
Epithelial1
- Cultured renal epithelial cells rapidly downregulate expression of the vasopressin-regulated water channel aquaporin-2 (AQP-2). (semanticscholar.org)
Mammalian1
- AQP 11 and 12 appear to be more distantly related to the other mammalian aquaporins and aquaglyceroporins. (ebi.ac.uk)
Regulated by vasopressin1
- It is the only aquaporin regulated by vasopressin. (wikipedia.org)
Regulates the expression1
- Light regulates the expression and function of aquaporins, which are involved in water and solute transport. (mdpi.com)
Abundance1
- The circadian fluctuations in aquaporin transcript abundance suggest that aquaporin water channels play a role in these processes. (plantcell.org)
Human3
- A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2. (thermofisher.com)
- The antiserum was produced against synthesized peptide derived from human Aquaporin 2. (genetex.com)
- We recently cloned cDNA of the apical collecting duct water channel, aquaporin-2 (AQP-2), from rat and human kidney cDNA libraries ( 8 , 24 ). (physiology.org)
MRNA expression1
- Twelve hours of water deprivation produced severe dehydration in the homozygous Brattleboro rats, such that urinary osmolality increased from 200 to 649 mosmol/kgH 2 O. However, no increase in AQP-2 mRNA expression was observed after this dehydration, and the medullary tissue content and urinary excretion of AQP-2 also remained unchanged. (physiology.org)
Peptide2
- a peptide corresponding to the alpha subunits of Gi1/2 was much less potent . (ndif.org)
- Examples are provided by the synthesis of a medicinal peptide from ginseng as potential drug against diabetes [ 1 ] or production of plant lectins [ 2 ] in both cases in yeast. (hindawi.com)