Cells with the capacity to take up and decarboxylate the amine precursors DIHYDROXYPHENYLALANINE or 5-HYDROXYTRYPTOPHAN. This is a property of endocrine cells of neural and non-neural origin. APUDOMA is a general term collectively applied to tumors associated with APUD cells.
Symptoms of NAUSEA and VOMITING in pregnant women that usually occur in the morning during the first 2 to 3 months of PREGNANCY. Severe persistent vomiting during pregnancy is called HYPEREMESIS GRAVIDARUM.
A branch of biology dealing with the structure of organisms.
Facilities for the performance of services related to dental treatment but not done directly in the patient's mouth.
An optical disk storage system for computers on which data can be read or from which data can be retrieved but not entered or modified. A CD-ROM unit is almost identical to the compact disk playback device for home use.
Collections of illustrative plates, charts, etc., usually with explanatory captions.
One of the BIOLOGICAL SCIENCE DISCIPLINES concerned with the origin, structure, development, growth, function, genetics, and reproduction of animals, plants, and microorganisms.
Tumors of bone tissue or synovial or other soft tissue characterized by the presence of giant cells. The most common are giant cell tumor of tendon sheath and GIANT CELL TUMOR OF BONE.
A bone tumor composed of cellular spindle-cell stroma containing scattered multinucleated giant cells resembling osteoclasts. The tumors range from benign to frankly malignant lesions. The tumor occurs most frequently in an end of a long tubular bone in young adults. (From Dorland, 27th ed; Stedman, 25th ed)
Works containing information articles on subjects in every field of knowledge, usually arranged in alphabetical order, or a similar work limited to a special field or subject. (From The ALA Glossary of Library and Information Science, 1983)
A heterogeneous aggregate of at least three distinct histological types of lung cancer, including SQUAMOUS CELL CARCINOMA; ADENOCARCINOMA; and LARGE CELL CARCINOMA. They are dealt with collectively because of their shared treatment strategy.
Tumors or cancer of the LUNG.
A systemic autoimmune disorder that typically affects medium and large ARTERIES, usually leading to occlusive granulomatous vasculitis with transmural infiltrate containing multinucleated GIANT CELLS. The TEMPORAL ARTERY is commonly involved. This disorder appears primarily in people over the age of 50. Symptoms include FEVER; FATIGUE; HEADACHE; visual impairment; pain in the jaw and tongue; and aggravation of pain by cold temperatures. (From Adams et al., Principles of Neurology, 6th ed)
A malignant neoplasm made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases. It is a histological type of neoplasm but is often wrongly used as a synonym for "cancer." (From Dorland, 27th ed)
A medical discipline that is based on the philosophy that all body systems are interrelated and dependent upon one another for good health. This philosophy, developed in 1874 by Dr. Andrew Taylor Still, recognizes the concept of "wellness" and the importance of treating illness within the context of the whole body. Special attention is placed on the MUSCULOSKELETAL SYSTEM.
Licensed physicians trained in OSTEOPATHIC MEDICINE. An osteopathic physician, also known as D.O. (Doctor of Osteopathy), is able to perform surgery and prescribe medications.
Organizations which certify physicians and dentists as specialists in various fields of medical and dental practice.
The granting of a license to practice medicine.
A severe form of neonatal dwarfism with very short limbs. All cases have died at birth or later in the neonatal period.
Musculoskeletal manipulation based on the principles of OSTEOPATHIC MEDICINE developed in 1874 by Dr Andrew Taylor Still.
Educational programs for medical graduates entering a specialty. They include formal specialty training as well as academic work in the clinical and basic medical sciences, and may lead to board certification or an advanced medical degree.
Tissue that supports and binds other tissues. It consists of CONNECTIVE TISSUE CELLS embedded in a large amount of EXTRACELLULAR MATRIX.
An organ of digestion situated in the left upper quadrant of the abdomen between the termination of the ESOPHAGUS and the beginning of the DUODENUM.
The act and process of chewing and grinding food in the mouth.
Tumors or cancer of the STOMACH.
That part of the STOMACH close to the opening from ESOPHAGUS into the stomach (cardiac orifice), the ESOPHAGOGASTRIC JUNCTION. The cardia is so named because of its closeness to the HEART. Cardia is characterized by the lack of acid-forming cells (GASTRIC PARIETAL CELLS).
The portion of the GASTROINTESTINAL TRACT between the PYLORUS of the STOMACH and the ILEOCECAL VALVE of the LARGE INTESTINE. It is divisible into three portions: the DUODENUM, the JEJUNUM, and the ILEUM.
The muscular membranous segment between the PHARYNX and the STOMACH in the UPPER GASTROINTESTINAL TRACT.
The guidelines and policy statements set forth by the editor(s) or editorial board of a publication.
The profession of writing. Also the identity of the writer as the creator of a literary production.
A publication issued at stated, more or less regular, intervals.
"The business or profession of the commercial production and issuance of literature" (Webster's 3d). It includes the publisher, publication processes, editing and editors. Production may be by conventional printing methods or by electronic publishing.
The collection, writing, and editing of current interest material on topics related to biomedicine for presentation through the mass media, including newspapers, magazines, radio, or television, usually for a public audience such as health care consumers.
A quantitative measure of the frequency on average with which articles in a journal have been cited in a given period of time.
The evaluation by experts of the quality and pertinence of research or research proposals of other experts in the same field. Peer review is used by editors in deciding which submissions warrant publication, by granting agencies to determine which proposals should be funded, and by academic institutions in tenure decisions.

High activity of mitochondrial glycerol phosphate dehydrogenase in insulinomas and carcinoid and other tumors of the amine precursor uptake decarboxylation system. (1/22)

The activity of the mitochondrial glycerol phosphate dehydrogenase (EC 1.1.99.5), the enzyme unique to the glycerol phosphate hydrogen shuttle, was measured in normal human tissues and tumors and compared with the activity of succinate dehydrogenase, another enzyme that transfers electrons to ubiquinone at site II of the electron transport chain. Six of 7 insulinomas and 10 of 12 carcinoid tumors showed high glycerol phosphate dehydrogenase activity. The activity was also increased in 3 of 4 gastrinomas, 2 paraganglionomas, 1 of 4 thyroid nodules, and 1 parathyroid tumor. These tissues belong to the amine precursor uptake decarboxylation system. The activity of glycerol phosphate dehydrogenase was generally unremarkable in non-amine precursor uptake decarboxylation system tumors and in normal tissues studied. However, 1 of 2 breast carcinomas, 1 submandibular tumor, and 2 of 3 melanomas were enriched in glycerol phosphate dehydrogenase activity. In general, succinate dehydrogenase activity exceeded that of glycerol phosphate dehydrogenase in all tissues except some of the tissues in which glycerol phosphate dehydrogenase activity was high. Normal tissues, such as the pancreatic beta-cell, which aerobically metabolize glucose rapidly utilize the glycerol phosphate shuttle to oxidize the large amount of NADH formed from glucose metabolism in the cytosol. Whether this is the reason for the enriched activity of the glycerol phosphate dehydrogenase in certain amine precursor uptake decarboxylation system tumors is unknown.  (+info)

A survey of endocrine cells in the pancreas of the echidna (Tachyglossus aculeatus) with special reference to pancreatic motilin cells. (2/22)

Pancreatic endocrine cells were examined in a primitive egg-laying mammal, the echidna, using immunohistochemistry. Immunoreactive endocrine cells were observed using antisera to insulin, glucagon, somatostatin, avian pancreatic polypeptide and bovine pancreatic polypeptide. In addition, motilin-immunoreactive cells were identified in both the endocrine and exocrine pancreas of pouch-young and adult echidnas using three types of motilin antisera. Since the motilin-immunoreactive cells did not cross-react with any other pancreatic hormones tested, they are identified as an independent endocrine cell type.  (+info)

Production of calcitonin, adrenocorticotropic hormone, and beta-melanocyte-stimulating hormone in tumors derived from amine precursor uptake and decarboxylation cells. (3/22)

The tumor production of human calcitonin (CT) was examined by radioimmunoassay, and it was found that 50 of 85 (59%) tumor tissues collected at random contained immunoreactive CT. These tumors were grouped as to whether they were derived from the amine precursor uptake and decarboxylation (APUD) series. The group that was derived from APUD cells showed appreciable amounts of CT in 30 of 31 (97%) of these tumors or in 20 of 21 (95%) when the medullary carcinomas of the thyroid were excluded. However, of the non-APUD group of tumors only 20 of 54 (37%) were found to contain CT, so that the difference between these two groups was highly significant (p less than 0.001). Of the tumors with ectopic adrenocorticotropic hormone-melanocyte-stimulating hormone production, 12 of 14 were shown to contain CT. These data indicate that CT is a common product of the APUD tumors and that tumor production of CT is often associated with that of adrenocorticotropic hormone and beta-melanocyte-stimulating hormone.  (+info)

Sequential morphologic alterations in the bronchial epithelium of Syrian golden hamsters during N-nitrosomorpholine-induced pulmonary tumorigenesis. (4/22)

N-nitrosomorpholine (NM)-induced pulmonary carcinogenesis was examined by light and electron microscopy in a 20-week serial sacrifice study using Syrian golden hamsters. First to be observed were a proliferation of endocrine APUD cells and a formation of lamellated inclusion bodies in the cytoplasm of Clara cells. After continued NM treatment, APUD cells underwent squamous metaplasia and Clara cells invaded the pulmonary tissues adjacent to the bronchi. Lung tumors consisted of cells possessing numerous lamellated inclusion bodies in their cytoplasm and a few squamous metaplastic and APUD cells. The observed pathologic alterations closely resembled those found after treatment with N-diethylnitrosamine (DEN) and N-dibutylnitrosamine (DBN) but were completely different from the cellular reactions induced by polycyclic aromatic hydrocarbons. It is concluded that the observed alterations of APUD cells and Clara cells are specific to nitrosamines.  (+info)

Quantitative characteristics of the Feyrter (APUD) cells of the neonatal rabbit lung in normoxia and chronic hypoxia. (5/22)

Our studies show that the apparent number of Feyrter cells in the lung declines during the neonatal period in normoxic rabbits, and that in hypoxic animals a uniformly and significantly lower number of cells occurs as compared with the normoxic rabbits. There is some indication of degranulation of cells in the hypoxic groups. It is suggested that environmental and/or physiological factors associated with the start of extrauterine life, or lung development, may affect the apparent number and probable level of activity of these cells. These changes seem to be enhanced by hypoxia. Mast cells are scarce, and Feyrter cells are relatively more numerous along the airways. These cell types could possibly represent storage sites for 5-hydroxytryptamine, as suggested also by other investigators. Intraepithelial nerve fibres in bronchi and bronchioles were found but they were not limited to innervations of Feyrter cells or related cell bodies.  (+info)

Endocrine-like cells in the terminal bronchioles and saccules of human fetal lung: an ultrastructural study. (6/22)

An ultrastructural study of Kulschitsky cells was made on lung tissue from five human fetuses of gestational ages between 18 and 25 weeks. The cells were found to occur with relative frequency throughout the bronchi and bronchioles, as well as in the developing saccules. This report describes in detail the cells of the terminal bronchioles and saccules, where their long cytoplasmic processes weave through the epithelium and come into contact with intercellular spaces and the lumen. The cytoplasmic organelles have an orderly arrangement comparable to secreting cells. Dense core vesicles characterise the cytoplasm but clear vesicles and some with less dense, diffuse cores are also present, and may be seen outside the plasma membrane and in the interstitial spaces. The K-cells are usually colsely associated with capillaries or smooth muscle cells across the basement membrane. In addition, the rare occurrence of a small unmyelinated nerve fibre in the vicinity of a K-cell in a terminal bronchiole raises the possibility that the cells fulfill a type of 'mini receptor' role in addition to their probable vasoactive one. Evidence is given that K-cells divide in human fetal lung.  (+info)

Neuroendocrine differentiation antigen on human lung carcinoma and Kulchitski cells. (7/22)

In the normal lung, a subset of cells with a histological appearance consistent with that of Kulchitski cells are the only lung cells reacting with a monoclonal antibody (MOC-1) raised against a human small cell lung carcinoma-derived cell line. Outside the lung, a subset of normal endocrine cells (in the adrenal, thyroid, ovary, and pancreas) as well as neural cells (brain and peripheral Schwann cells) also express the antigen detected by MOC-1 (named MOC-1-related antigen). Some of these positively reacting cells are ectodermally derived, whereas others are of proven endodermal origin, indicating that the MOC-1-related antigen is not a cell lineage-specific antigen. Instead, the common expression of the antigen by cells with a neural, endocrine, or neuroendocrine function suggests that the antigen related to a neuroendocrine differentiation state of these cells. The presence of the MOC-1-related antigen on several non-lung tumors mostly paralleled its normal tissue distribution, indicating that the antigen is generally retained upon malignant transformation. In lung carcinoma, the antigen proves to be present on almost all small cell carcinomas tested. In addition, adenocarcinoma and mixed adenosquamous carcinoma could also express the antigen, whereas pure squamous cell carcinoma generally did not. This finding will be discussed in relation to a proposed "common stem cell" histogenesis of lung carcinoma.  (+info)

Pulmonary endocrine cells immunoreactive for calcitonin in the lungs of fetal and neonatal rats. (8/22)

Previous studies have shown that the size of the population of bronchopulmonary endocrine (Feyrter) cells appears to be greatest in fetal and neonatal life. This has led to the logical assumption that these cells are important during this period and undergo a subsequent decline in number thereafter. In this study endocrine cells containing calcitonin or a closely related cross reacting peptide have been demonstrated in the lungs of fetal and neonatal rats by immunoenzyme histochemistry. They appear first about three days before birth and their number, expressed as immunoreactive cells per cm2 of histological section, remains relatively constant for up to three weeks after birth. It has been shown previously in this department that endocrine cells immunoreactive for calcitonin are present in the lungs of the normal adult rat. Their number in these adult animals is closely similar to the numbers of cells in the lungs of the developing animals of the present study. It is suggested that, at least in the rat, bronchopulmonary endocrine cells immunoreactive for calcitonin have a role that is not confined merely to the period of transition from fetal to neonatal life.  (+info)

Carcinoid tumors are a type of neuroendocrine tumor that can occur in a number of locations. Carcinoid tumors arise from endocrine amine precursor uptake and decarboxylation (APUD) cells that can be found throughout the gastrointestinal tract as well as other organs (e.g. lung). In general, they are slow-growing tumors but are nevertheless capable of metastasizing.. ...
Bioactive compounds in wine : recent advances and perspectives | Apud, Giselle Raquel; Aredes-Fernández, Pedro Adrián; Rodriguez-Vaquero, María José; Stivala, María Gilda | download | B-OK. Download books for free. Find books
This cell line is aneuploid, will form colonies in soft agar and retains small cell carcinoma morphology and ultrastructure as well as APUD cell characteristics. The cells grow in aggregates, thus cell counts are not accurate.The cells stain positively for cytokeratins. The line can be adapted to grow in shaker flask or spinner flask systems. The N-myc gene is amplified, and there is expression of the mRNA and protein.C-myc mRNA, but not protein, is expressed at a low level.There is expression of c-myb, v-fes, v-fms, c-raf 1, Ha-ras, Ki-ras and N-ras mRNA ...
Scanty argyrophil cells are present in a substantial proportion of normal endometria, particularly during the secretory stage of the cycle. Argyrophil cells are also present in the various types of hyperplastic endometria and are found in more than half of endometrial adenocarcinomas. In some endometrial neoplasms they are present in abundance, but tumours rich in such cells do not have any features suggestive of a carcinoid tumour and are morphologically identical to adenocarcinomas of similar grade which are devoid of argyrophil cells. Endometrial adenocarcinomas containing argyrophil cells tend to be well differentiated and tend not to invade deeply into the myometrium. It is suggested that Müllerian epithelial stem cells possess a potentiality for differentiation into APUD cells.. ...
As in many other studies reported, rat was also used as a model in this study [1, 6, 8-10]. The advantages include easy manipulation, maintenance and adaptation to the objectives of the study. Other animals have been used, such as rabbits [7, 11, 12] or dogs [13].. This experimental study was based on investigations reported by Brighton (apud Christian) [14]; Burkitt, Young and Heath [15]; Hunter (apud Christian) [14]; and Lane and Davis (apud Christian) [14]. The surgically prepared bone cavity presented only one ruptured cortical, maintaining thus the reproducibility of a fixed fracture [16].. The metallic washers were attached to the bone structure with titanium screws. Biocompatibility of titanium with the spongeous medullary area has already been shown by Veeck, Puricelli and Souza [1]. Due to technical difficulties, the stainless steel washers were not protected against corrosion, differing thus from those used by Lemons and Natiella [17]. Martensitic stainless steel relates to the ...
Bilder vom 30.10.2011 Janssonius Van Waesberge( Familia), download powershell deep. BHI BH MED 8224 Real Colegio de Cirugí a de San Carlos( Madrid), and page. Amstelodami: apud Janssonio-Waesbergios, 1727), by Abraham Vater, download powershell deep dives. Janssonius Van Waesberge( Familia), Frederik Ruysch, and und. BHI BH MED 8222 Universidad Complutense( Alcalá de Henares)( download powershell deep dives generalities at HathiTrust) Joannis Jacobi Rau Epistola De inventoribus septi scroti, minute page password Fredericum Ruyschium, anatomiæ et order Authorship. Amstelaedami: apud Janssonio-Waesbergios, 1737), by Frederik Ruysch, Johann Jacob Rau, and talk. Lugduni Batavorum: apud Cornelium Haak, 1751), by Hermann Boerhaave, Cornelius Haak, Frederik Ruysch, and download powershell deep. New York, Appleton, 1916), by Walter Essex Wynter( download powershell licences at HathiTrust) Minutes of the General Council of Medical Education and Registration of the United Kingdom. download;, ...
A number of peptides, closely related in terms of their amino acid sequences, have been found to occur in the gastroenteropancreatic system on the one hand and in the brain on the other. A common range of peptides links the pituitary gland and the placenta and 4 groups of peptides, found in anuran c …
A chromophil biological cell is a cell which is easily stainable by absorbing chromium salts used in histology to increase the visual contrast of samples for microscopy. Chromophil cells are mostly hormone-producing cells containing so-called chromaffin granules. In these subcellular structures, amino acid precursors to certain hormones are accumulated and subsequently decarboxylated to the corresponding amines, for example epinephrine, norepinephrine, dopamine or serotonin. Chromophil cells therefore belong to the group of APUD (amine precursor uptake and decarboxylation) cells. These cells are scattered throughout the whole body, but particularly in glands such as the hypothalamus, hypophysis, thyroid, parathyroid and pancreas ...
Positron emission tomography (PET) supplies a range of labelled compounds to be used for the characterization of tumour biochemistry. Some of these have proved to be of value for clinical diagnosis, treatment follow-up, and clinical research. 18F-fluorodeoxyglucose PET scanning is now a widely accepted imaging approach in clinical oncology, reflecting increased expression of glucose transporters in cancerous tissue. This tracer, however, does not show sufficient uptake in well-differentiated tumours such as neuroendocrine tumours. Endocrine tumours have the unique characteristics of taking up and decarboxylating amine precursors. These so-called APUD characteristics offer highly specific targets for PET tracers. Using this approach, radiopharmaceuticals such as [11C]-5-hydroxytryptophan and [11C]-l-dihydroxyphenylalanine for localization of carcinoid and endocrine pancreatic tumours, 6-[18F]-fluorodopamine and [11C]-hydroxyephedrine for phaeochromocytomas, and [11C]-metomidate for adrenal ...
Unde Plato sufficientiori via download drupal sense acquaintance nothing direction object. Cum enim apud antiquos naturales poneretur ab pride thinking sentiment bottom apprehension certain nothing, ventriloquistic access day substratum omnia hypothesis, extraordinary dead nomenon obligation, testimony tamen nature; latitude shells perfectio a material treasure sight lessons, in rulership spring precipices existence; et 3um quaecumque daughter appetitum cause faith field. Unde secundum hoc download drupal multimedia parallel Substitution understands divinissimum prophecy effect experience materiam condition regard, heartless origin mutationis night a footing function.
1. T. J. Ritter and G. C. Denniston, Say No to Circumcision: 40 Compelling Reasons, 2nd ed. (Aptos, CA: Hourglass, 1996),6-20. 2. Incipit Libellus De Ecclesiasticis Disciplinis et Religione Christiana Collectus. Liber II.XC, XCI in Patrologiæ Cursus Completus, vol. 132 (Paris: Apud Garnier Fratres, Editores et J. P. Migne Successores, 1880), 301-302. 3. S. Grayzel, The Church and the Jews in the XIIth Century, vol. 2, ed. K. R. Stow (Detroit, MI: Wayne State University Press, 1989), 246-247. 4. See Note 10, 17-40. 5. M. F. Campbell, The Male Genital Tract and the Female Urethra, in Urology, eds. M. F. Campbell and J. H. Harrison, vol. 2, 3rd ed. (Philadelphia: W. B. Saunders, 1970), 1836. 6. See photographic series: J. A. Erickson, Three Zones of Penile Skin. In M. M. Lander, The Human Prepuce, in G. C. Denniston and M. F. Milos, eds., Sexual Mutilations: A Human Tragedy (New York: Plenum Press, 1997), 79-81. 7. M. Davenport, Problems with the Penis and Prepuce: Natural History of the ...
Romae, apud haeredes antonij, Bladij, Impressores Camerales: Anno. M.D. LXXVI (1576). Polydore Vergil (ca. 1470-1555), an Italian priest, spent much of his life in England. He is recognized for his history of England, a work that Shakespeare is known to have used as one of his sources. Vergil used critical analysis in his narration of historical events. His thesis that King Arthur was little more than fable, for instance, shocked contemporary readers.. It is his second published work, however, for which he was best known in his time. First printed in 1499, De rerum inventoribus (On Discovery), was a work unlike anything that had been published before. An inventory of historical firsts, it combined a wide array of subjects in an attempt to determine which individual or culture first invented things such as the alphabet, astronomy, magic, printing, libraries, hunting, festivals, writing, painting, weaponry and religion. Vergil culled much of his work from a wide range of ancient and contemporary ...
ted the poet to his court at Alexandria; but Menander seems to have declined the proffered honour. (Plin. Nat. 7.29. s. 31; Alciphr. Epist. 2.3, 4.) Suidas mentions some letters to Ptolemy as among the works of Menander. The time of his death is differently stated. The same inscription, which gives the date of his birth, adds that he died at the age of fifty-two years, in the archonship of Philippus, in the 32nd year of Ptolemy Soter. Clinton shows that these statements refer to the year B. C. 292-1 (F. H vol. ii. p. xv. and sub ann. 342, 291); but, to make up the fifty-two years, we must reckon in both extremes, 342 and 291. The date is confirmed by Eusebius (Chron.); by the anonymous writer on comedy (p. xii.), who adds that Menander died at Athens; by Apollodorus (apud Aul. Gel. 17.4); and by Aulus Gellius (17.21). Respecting the manner of his death, all that we know is that an old commentator on Ovid applies the line (Ibis, 593) Comicus ut medius periit dum nabat in undis to ...
In accordance with Schall & Struchiner (2005) apud Thiengo; Oliveira & Rodrigues (2005, P. 69): … For being the AIDS a transmissible illness e, until the moment, incurable, whose indices come increasing in the entire world, it must be considered that the effective components for its control and prevention are the information and the education. Of this form, one becomes essential to think about the AIDS as an illness each more present time in the institutions of health, being indispensable to the professionals of health, particularly to the nurses to make use of knowledge and pedagogical abilities in activities with sights to the education, the control and the prevention of the transmission of the HIV. Thus, the educational alternatives with sights to its prevention must be pautadas in orientaes whose essence is the valuation of the life and the construction of the alternatives of prevention in a freedom climate, responsibility and solidarity human being. According to Breton & Camba (2006, P. ...
terebinth, Original French: Terebinthe, Modern French: Terebinthe, Among the plants that, like Pantagruelion, have two sexes. Notes terebinth Terebinto [Pistacia terebinthus L.] Laguna, Andres (ca. 1511 - 1559), Annotationes in Dioscoridem Anazarbeum … iuxta vetustissimorum codicum fidem elaboratae.. Lyon: Apud Gulielmum Rovillium, 1554. Smithsonian Libraries terebinth The terebinth has a male and a female form.…
A. An assembly for consultation, a council (in concreto; on the contrary consilium signifies the counsel in abstracto that is taken in such an assembly. The meanings, however, often pass over to each other; hence in MSS. and edd. a freq. confusion of the two words; cf. consilium), Caes. B. G. 1, 30 fin.; cf. id. ib. 7, 1: (opiniones), quae in senatu, quae apud populum, quae in omni coetu concilioque proferendae sunt, Cic. Fin. 2, 24, 77: inire, Plaut. Capt. 3, 1, 33: habere, id. Mil. 3, 1, 3: convocare, Caes. B. G. 1, 40; 2, 10; 3, 3: vocare, Verg. A. 10, 2: cogere, id. ib. 11, 304: dimittere, Caes. B. G. 1, 18; 1, 33 al.; Cic. Leg. 2, 12, 31 al.: transferre Lutetiam, Caes. B. G. 6, 3: in posterum diem differre, Curt. 6, 11, 9: dare legatis, Liv. 43, 17, 7: indicere, id. 1, 50, 4: constituere diem concilio, Caes. B. G. 1, 30: Messene ab Achaeis, quod concilii eorum recusaret esse, oppugnari coepta est, i. e. a member of the Achaian league, Liv. 36, 31, 1: concilio ...
R. W. Eyton, A Key to Domesday: showing the method and exactitude of its mensuration, and the precise meaning of its more usual formulae ; the subject being specially exemplified by an analysis and digest of the Dorset survey. Londinii: Taylor, 1878 Textus apud archive.org ...
suauis homo ‥ ~um paucum ENN. Ann. 246; quid opust ~is? libertatem tibi ego ‥ dabo, si impetras PL. Mil. 1213; formam ‥ ~is depinxti probe Poen. 1114; stultus es qui facta infecta facere ~is postules Truc. 730; hoc age: sati iam ~orumst TER. Ph. 436; comperce ~is uelitare: ad rem redi TURP. com. 145; rem ~is quam maxime ante oculos eius, apud quem dicitur, ponimus CIC. Inv. 1.104; placet tibi nos pugnare ~is? Caec. 81; Gallorum animos ~is confirmauit CAES. Gal. 1.33.1; monuit ‥ mitibus ~is legatos B. Alex. 70.2; longa ducere ~a mora PROP. 1.10.6; bucina cogebat priscos ad ~a Quiritis 4.1.13; uocis ~orumque quantum uoletis ingerent LIV. 3.68.4; cum diu certatum ~is esset 27.11.12; saepe fuit breuior quam mea ~a dies OV. Pont. 2.4.12; fuisse Pomponium ‥ ~is rudem VELL. 2.9.6; in hac causa etiam Ciceronem ~a deficient SEN. Suas. 6.1; non ~a in funere primo, non lacrimas habet STAT. Theb. 5.593; inter magna rerum ~orumque ludibria SUET. Vit. 17.1; GEL. 17.5.14; (poet.) columbae, quarum ...
Samuel Kline Cohn and Steven Epstein, view В кабинете детского. David Herlihy, Christiane Klapisch-Zuber, Anthony Molho, Roberto Barducci, Gabriella Battista, Francesco Donnini, Lisa M. Kreutz, Stephen Weinberger, Bruce L. Venarde, James Buchanan Given, Maureen C. Heraldry in America( Philadelphia: Dept. The Man of the North and the view of the South: or, The manifestation of Integrative New York: F. De Viribus Electricitatis in Motu Musculari Commentarius; Cum Joannis Aldini Dissertatione et Notis; Accesserunt Epistolae t Animalis Electricitatis Theoriam Pertinentes( in Latin; Modena: Apud Societatem Typographicam, 1792), by Luigi Galvani, device. Der Weg der Kultur( in able; Leipzig-Gaschwitz: Dü rr view В кабинете Weber, 1920), by R. The Danger of Premature Internment, small from 13-month hepatocellular receptors of %s Who are been After imaging Laid Out for Dead, and of studies Entombed Alive, for Want of taking Properly Examined technically to Interment( London: ...
his accessit eiusdem apologia aduerses Amathum Lusithanum, quin & censura in eiusdem enarrationes Más detalles PUBLICACIÓN Ludguni Apud Gabrielem Coterium, 1563 DESCR. FÍSICA [11], [2] bl., [837], [3] bl., 69 p. : il., grab. calc. ; 4o (23 cm) NOTA Segunda parte con port. y pag. propias NOTA A PUBLIC. Marca tip en las dos port. Al fin de la segunda parte: Lugduni : Excudebat Ioannes dOgerolles, M.D.LXIII DESCR. FÍSICA Sign.: [Ast.]-3[Ast.]8, 4[Ast.]2, [Alfa]-[gamma]8, [Delta]6,... ...
Buckley, que viveu 32 anos entre os Wathaurong no início do séc. XIX, descreve a existência de feuds, batalhas campais, massacres na forma de raids nocturnos, o medo constante de ataques, a necessidade de alianças e traições dos aliados (Leblanc e Register, 2004, p. 114-115 e 122-123). Entre os Murngin do Norte da Austrália, 28% das mortes de homens adultos deviam-se a baixas no campo de batalha (Warner apud Harris, 2004, p. 426 ...
1] Quod quaeris a me liquebat mihi - sic rem edidiceram - per se; sed diu non retemptavi memoriam meam, itaque non facile me sequitur. Quod evenit libris situ cohaerentibus, hoc evenisse mihi sentio: explicandus est animus et quaecumque apud illum deposita sunt subinde excuti debent, ut parata sint quotiens usus exegerit. Ergo hoc in praesentia differamus; multum enim operae, multum diligentiae poscit. Cum primum longiorem eodem loco speravero moram, tunc istud in manus sumam. [2] Quaedam enim sunt quae possis et in cisio scribere, quaedam lectum et otium et secretum desiderant. Nihilominus his quoque occupatis diebus agatur aliquid et quidem totis. Numquam enim non succedent occupationes novae: serimus illas, itaque ex una exeunt plures. Deinde ipsi nobis dilationem damus: cum hoc peregero, toto animo incumbam et si hanc rem molestam composuero, studio me dabo. [3] Non cum vacaveris philosophandum est, sed ut philosopheris vacandum est; omnia alia neglegenda ut huic assideamus, cui nullum ...
Thomas W. Weickert, Terry E. Goldberg, Joseph H. Callicott, Qiang Chen, Jose A. Apud, Sumitra Das, Brad J. Zoltick, Michael F. Egan, Martijn Meeter, Catherine Myers, Mark A. Gluck, Daniel R. Weinberger and Venkata S. Mattay ...
Part of the book: Ruysch, Frederik, 1638-1731. Thesaurus anatomicus primus[-decimus] = Het eerste[-tiende] anatomisch cabinet ... Amstelædami [Amsterdam]: Apud Joannem Wolters, 1701-1716.. ...
Part of the book: Guidi, Guido, ca. 1500-1569. Opera omnia; siue, Ars medicinalis, in qua cuncta quæ ad humani corporis valetudinem præsentem tuendam, & absentem reuocandam pertinent, methodo exactissima explicantur. Quæ per Vidum Vidium iuniorem ... recognita, ac multis, quæ ad eam perficiendam desiderabantur, partibus aucta, diuque expetita, nunc primum in Germania tota simul luci data, tribusque tomis ... comprehensa. Cum indicibus selectiorum rerum accuratissimis. Francofurti ad Moenum [Frankfurt am Main]: Typis & sumptibus Wechelianorum, apud D. & D. Aubrios & C. Schleichium, 1626.. ...
Lutetiae Parisiorum : apud Guillelmum Cavelier ..., 1740), by Jean Astruc, Francisco Viñals y Torrero, Marcos Viñals y Rubio, ant. pos. BHI BH MED 11314 Macquer, Antonio Hernández Morejón, Guillaume Cavelier, ant. pos. BHI BH MED 11255 ; BHI BH MED 11256 Universidad Complutense (Alcalá de Henares), and ant. pos. BHI BH MED 11255 ; BHI BH MED 11256 Real Colegio de Cirugía de San Carlos (Madrid) (page images at HathiTrust ...
XIX.17. […] Ita etiam terrena civitas, quae non vivit ex fide, terrenam pacem appetit in eoque defigit imperandi oboediendique concordiam civium, ut sit eis de rebus ad mortalem vitam pertinentibus humanarum quaedam compositio voluntatum. Civitas autem caelestis vel potius pars eius, quae in hac mortalitate peregrinatur et vivit ex fide, etiam ista pace necesse est utatur, donec ipsa, cui talis pax necessaria est, mortalitas transeat; ac per hoc, dum apud terrenam civitatem velut captivam vitam suae peregrinationis agit, iam promissione redemptionis et dono spiritali tamquam pignore accepto legibus terrenae civitatis, quibus haec administrantur, quae sustentandae mortali vitae accommodata sunt, obtemperare non dubitat, ut, quoniam communis est ipsa mortalitas, servetur in rebus ad eam pertinentibus inter civitatem utramque concordia.[…] Haec ergo caelestis civitas dum peregrinatur in terra, ex omnibus gentibus cives evocat atque in omnibus linguis peregrinam colligit societatem, non curans ...
ObjectiveTo investigate pathologic fibrosis and connective tissue matrix in left ventricular hypertrophy due to chronic arterial hypertension in humans.Design and methodsSeventeen human hearts were studied. Group 1 consisted of control hearts (four hearts, weighing 280 ± 40 g each), from subjects wh
Case-control study comparing overall survival and disease free survival for patients with squamous cell carcinoma of the anus (ASCC) and transitional clocacogenic carcinoma (CCA). Material and methods: 450 patients were supported between January 2001 and December 2014, cancer of the anal canal. 15 patients with CCA were selected and matched (1 for 1) by age, sex, tumor stage (clinical, radiological, and histological) and HIV infection and HPV status in patients group of ASCC. Overall survival and disease free survival in both groups were studied. After initial treatment, the persistence of the lesion histologically proven before 6 months after treatment was defined as a residual disease (MR), the occurrence of a local recurrence was defined as a lesion histologically proved after 6 months of starting treatment. Statistical analysis was done using the Chi 2 test and the Student test, and survival curves were determined using the Kaplan-Meier. Results: There were 26 women, median age was 67.5 (55-83)
BioMed Research International is a peer-reviewed, Open Access journal that publishes original research articles, review articles, and clinical studies covering a wide range of subjects in life sciences and medicine. The journal is divided into 55 subject areas.
1. What do you think the main job of moderator is?. I think the main job of being a moderator is to be an example for other users and moderate and lead the site. A lot of times when a moderator leaves his post as moderator for some reason, there always seem to be a very sad feeling through that community for a few days as they will miss that user as moderator. Why? Because that user has left such an impact on the community through his actions in that community and being such an amazing role model for newer users to follow.. 2. Do you have any previous experience as a moderator?. No. Though I have participated in multiple betas and have been a very active users in lots of them, I refused to join as a moderator as I was young and quite new to SE at a time (I am only around a year and two months old as a member).. 3. Our site is a very new one. We can expect a lot of posts that are broad, but are about practical problems faced when learning a language. What is your opinions on such ...
1. What do you think the main job of moderator is?. I think the main job of being a moderator is to be an example for other users and moderate and lead the site. A lot of times when a moderator leaves his post as moderator for some reason, there always seem to be a very sad feeling through that community for a few days as they will miss that user as moderator. Why? Because that user has left such an impact on the community through his actions in that community and being such an amazing role model for newer users to follow.. 2. Do you have any previous experience as a moderator?. No. Though I have participated in multiple betas and have been a very active users in lots of them, I refused to join as a moderator as I was young and quite new to SE at a time (I am only around a year and nine months old as a member).. 3. Our site is a very new one. We can expect a lot of posts that are broad, but are about practical problems faced when learning a language. What is your opinions on such ...
Small cell carcinomas (SCC) commonly arise in the respiratory tract; however, it is not uncommon for these cells to arise in nonpulmonary sites, as extrapulmonary small cell carcinoma (EPSCC). Small cell carcinoma is a distinct clinical and pathologic entity that arises from cells of the amine precursor uptake and decarboxylation (APUD) system.
Small cell carcinomas (SCC) commonly arise in the respiratory tract; however, it is not uncommon for these cells to arise in nonpulmonary sites, as extrapulmonary small cell carcinoma (EPSCC). Small cell carcinoma is a distinct clinical and pathologic entity that arises from cells of the amine precursor uptake and decarboxylation (APUD) system.
Metformins Therapeutic Action in the Treatment of Diabetes Does Not Involve Inhibition of Mitochondrial Glycerol Phosphate Dehydrogenase
1. Lawrence B, Gustafsson BI, Chan A, Svejda B, Kidd M, Modlin IM. The epidemiology of gastroenteropancreatic neuroendocrine tumors. Endocrinol Metab Clin North Am. 2011;40:1-18 2. Modlin IM, Oberg K, Chung DC, Jensen RT, de Herder WW, Thakker RV. et al. Gastroenteropancreatic neuroendocrine tumours. Lancet Oncol. 2008;9:61-72 3. Pearse AG. The cytochemistry and ultrastructure of polypeptide hormone-producing cells of the APUD series and the embryologic, physiologic and pathologic implications of the concept. J Histochem Cytochem. 1969;17:303-13 4. Reubi JC, Waser B. Concomitant expression of several peptide receptors in neuroendocrine tumours: molecular basis for in vivo multireceptor tumour targeting. Eur J Nucl Med Mol Imaging. 2003;30:781-93 5. Lee DY, Li KC. Molecular theranostics: a primer for the imaging professional. AJR Am J Roentgenol. 2011;197:318-24 6. Krenning EP, Bakker WH, Breeman WA, Koper JW, Kooij PP, Ausema L. et al. Localisation of endocrine-related tumours with ...
Quid ergo dicemus invenisse Abraham patrem nostrum secundum carnem? Si enim Abraham ex operibus justificatus est, habet gloriam, sed non apud Deum.
Yellow, cancerous tumors of hormone-making cells in the gastrointestinal tract (specifically, they are classed as neuroendocrine or amine precursor uptake and decarboxylation tumors). They produce excess endocrines such as kallikrein (an activator of bradykinin release) and serotonin. These tumors can be found in the intestine, stomach, or sometimes on the liver. In later stages, this type of cancer causes symptoms such as diarrhea, wheezing, heart murmurs, enlarged liver, and a dusky appearance to the skin. Carcinoids can be diagnosed with a urine test or with a CAT scan ...
Chlorothiazide decreases plasma volume, heart size, and cardiac output. The oligemia stimulates vasomotor tone; this tends to maintain arterial pressure because chronic arterial hypertension is characteristically self-sustaining and homeostatic. This oligemic stimulation of vasomotor tone results in increased sensitivity to the antihypertensive effect of drugs depressing or blocking vasomotor function.. ...
SP-303, a large proanthocyanidin oligomer isolated from the latex of the plant species Croton lechleri (Eupborbiaceae) has demonstrated broad activity against a variety of DNA and RNA viruses. In cell culture, SP-303 exhibits potent activity against isolates and laboratory strains of respiratory syncytial virus (RSV), influenza A virus (FLU-A) and parainfluenza virus (PIV). Parallel assays of SP-303 and ribavirin showed comparable activity against these viruses. SP-303 also exhibits significant inhibitory activity against herpesvirus (HSV) types 1 and 2, including herpesviruses resistant to acyclovir and foscarnet. Inhibition was also observed against hepatitis A and B viruses. The antiviral mechanism of SP-303 seems to derive from its direct binding to components of the viral envelope, resulting in inhibition of viral attachment and penetration of the plasma membrane. Antiviral effects of SP-303 were measured by three distinct methods: CPE, MTT and precursor uptake/incorporation. Cytotoxicity endpoints
N-diaminophosphinothioylbutan-1-amine 94317-64-3 Precursor and Downstream products, N-diaminophosphinothioylbutan-1-amine Precursor products, N-diaminophosphinothioylbutan-1-amine Downstream products ect.
5-Isopropylpyridin-2-amine 603310-75-4 Precursor and Downstream products, 5-Isopropylpyridin-2-amine Precursor products, 5-Isopropylpyridin-2-amine Downstream products ect.
BACKGROUND/AIMS: In previous studies we found strong evidence for the existence and activation in human liver of putative progenitor cells resembling oval cells in rat liver. In view of the known role of rat oval cells in regeneration and hepatocarcinogenesis, we investigated a possible correlation between human putative progenitor cells and different types of dysplastic foci. METHODS: We determined the immunohistochemical phenotype of dysplastic foci found in 20 cirrhotic liver explants of various etiology, using specific antibodies against hepatocyte-type cytokeratin (CK) 8 and CK18, bile duct-type CK7 and CK19, chromogranin-A (chrom-A) and rat oval cell marker OV-6. RESULTS: All 12 foci of large cell dysplasia had a phenotype similar to that of surrounding parenchyma. Oncocytic foci showed a strong cytoplasmic staining for CK7. Three out of six of these foci contained progenitor cells, which are small cells immunoreactive for CK18, CK7, CK19, OV-6, chrom-A and stained more intensely for CK8 ...
Blattmann, Annette et al., The formation of pores in the basal lamina of regenerated renal tubules Biomaterials (2008) In this assay they looked at the basal aspects of renal tubules generated at the Interphase of an artificial interstitium in order to gain more knowledge about the generation of renal tubules. They took progenitor cells from neonatal rabbit kidney and put them inside a specific tissue holder that was covered by polyester fleece. They found tissue-specific antibodies that showed that the tubes were completely covered by a basal lamina. The matrix that was formed had three categories of pores which were widely distributed. The pores were also found in collections of duct tubules of the neonatal rabbit kidney. ...
Spontaneous intracerebral hemorrhage (ICH), defined as nontraumatic bleeding into the brain parenchyma, is the second most common subtype of stroke, with 5.3 million cases and over 3 million deaths reported worldwide in 2010. Case fatality is extremely high (reaching approximately 60 % at 1 year post event). Only 20 % of patients who survive are independent within 6 months. Factors such as chronic hypertension, cerebral amyloid angiopathy, and anticoagulation are commonly associated with ICH. Chronic arterial hypertension represents the major risk factor for bleeding ...
NE differentiation in pancreatic carcinomas has been reported in various studies using IHC (13, 14, 15) . However, the expression of PGP9.5 and its relation to other NE markers have not been studied in pancreatic cancer to date. In this study, CGA was used as a marker for NE differentiation because it has been demonstrated to be a well-characterized marker for NE differentiation (16) . We found that tumor cells immunoreactive to CGA monoclonal antibody accounted for ,1% of the tumor cell population. On the other hand, PGP9.5 was expressed in 26 of 69 (37.7%) pancreatic cancers. These results suggested that the expression of PGP9.5 in pancreatic cancer is independent of NE differentiation.. Subsequently, we investigated a possible correlation of PGP9.5 status with clinicopathological features. Although PGP9.5 expression was not associated with tumor histology or the extent of the tumor, pancreatic cancer patients with PGP9.5 expression had significantly shorter survival times than those without ...
sco:SCO4774 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] , (RefSeq) SCD63.06; glycerol phosphate dehydrogenase (A) MRTATLGPAQRAESLAAMAERELDVLVVGAGVVGAGTALDAVTRGLSVGLVEARDWASGT SSRSSKLIHGGLRYLEMLDFVLVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY AGSGVALYDAMSMARGHGRGLPLHRHLSRRHALRVAPALKKDALVGALQYYDAQMDDARF VATLVRTAAAYGAKVANRARVTSFLREGERVVGARVQDVEAGGEYEVRAKQVVNATGVWT DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD TDWDLDKAHPAASSADIDYLLEHVNSVLSVPLTRDDVEGVYAGLRPLLAGESDATSKLSR EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDLRVADCVTEETPLLGAEGYHAQ WNARARIAARTGLHVVRVEHLLNRYGSLTEELLELVAADPSLGEPLTGADDYLRAEVVYA ASHEGARHLDDVLTRRTRISIETFDRGTRCAREAAELMAPVLGWDKGQVEREIEHYEKRV EAERESQRQPDDLTADAARLGAPDIAAR ...
TY - JOUR. T1 - Disc1 Point Mutations in Mice Affect Development of the Cerebral Cortex. AU - Lee, F. H. F.. AU - Fadel, M. P.. AU - Preston-Maher, K.. AU - Cordes, S. P.. AU - Clapcote, S. J.. AU - Price, D. J.. AU - Roder, J. C.. AU - Wong, A. H. C.. PY - 2011. Y1 - 2011. N2 - Glypicans are essential modulators of cell signalling during embryogenesis. Little is known about their functions in brain development. We show here that mouse glypicans (gpc-1 to gpc-6) are differentially expressed in embryonic brains during key morphogenetic events. In gastrulating embryos, gpc-4 is the only glypican expressed in anterior visceral endoderm. During neural tube closure, gpc-4 transcripts are restricted to the anterior neural ridge and telencephalon. At this stage, gpc-1 expression shifts from trunk and head mesenchyme to neural tube. Gpc-3 mRNA appears across the ventral neural tube, then in the lamina terminalis and hypothalamus. Gpc-2 and gpc-6 transcripts are in all brain compartments. Gpc-5 is found ...
Carcinoembryonic antigen (CEA) is a glycoprotein, which was first identified in patients with colonic carcinoma and in epithelial tumours of endodermal origin (gastrointestinal tract) by Gold and Freedman (1). The CEA molecule is quite heterogeneous due to the carbohydrate contents (50-60%) and depending on the purification procedure employed. It is soluble in perchloric acid and has a molecular weight of about 175.000-200.000 Daltons (2). Immunological and genetic characterization of CEA has identified a family of CEA-like molecules sharing common antigenic determinants. The most relevant CEA-like molecule is NCA (non-specific cross-reacting antigen) synthesized both by normal and pathological tissues. The problem of cross-reacting CEA-like molecules when assaying CEA is possible to overcome by the use of monoclonal antibodies. The CanAg CEA EIA is based on two mouse monoclonal antibodies against the Gold epitopes IV and V (3, 4 ...
The adult kidney plays a central role in erythropoiesis and is the main source of erythropoietin (EPO), an oxygen-sensitive glycoprotein that is essential for red blood cell production. Decreases of renal pO2 promote hypoxia-inducible factor 2-mediated (HIF-2-mediated) induction of EPO in peritubular interstitial fibroblast-like cells, which serve as the cellular site of EPO synthesis in the kidney. It is not clear whether HIF signaling in other renal cell types also contributes to the regulation of EPO production. Here, we used a genetic approach in mice to investigate the role of renal epithelial HIF in erythropoiesis. Specifically, we found that HIF activation in the proximal nephron via induced inactivation of the von Hippel-Lindau tumor suppressor, which targets the HIF-α subunit for proteasomal degradation, led to rapid development of hypoproliferative anemia that was associated with a reduction in the number of EPO-producing renal interstitial cells. Moreover, suppression of renal EPO ...
The adult kidney plays a central role in erythropoiesis and is the main source of erythropoietin (EPO), an oxygen-sensitive glycoprotein that is essential for red blood cell production. Decreases of renal pO2 promote hypoxia-inducible factor 2-mediated (HIF-2-mediated) induction of EPO in peritubular interstitial fibroblast-like cells, which serve as the cellular site of EPO synthesis in the kidney. It is not clear whether HIF signaling in other renal cell types also contributes to the regulation of EPO production. Here, we used a genetic approach in mice to investigate the role of renal epithelial HIF in erythropoiesis. Specifically, we found that HIF activation in the proximal nephron via induced inactivation of the von Hippel-Lindau tumor suppressor, which targets the HIF-α subunit for proteasomal degradation, led to rapid development of hypoproliferative anemia that was associated with a reduction in the number of EPO-producing renal interstitial cells. Moreover, suppression of renal EPO ...
The terminal bronchioles are a continuation of the bronchi and are the last divisions of the conducting airways. Gross Anatomy Terminal bronchioles are confusingly named, as they are not the final branches but rather the distal bronchioles th...
The vertebrate forebrain is formed at the rostral end of the neural plate under the regulation of local and specific signals emanating from both the endomesoderm and neuroectoderm. The development of the rostral and ventral forebrain in particular was difficult to study, mainly because no specific markers are available to date. Here, we report the identification of Vax1, a novel homeobox-containing gene identified in mouse, Xenopus and human. It is closely related to members of the Not and Emx gene families, all of which are required for the formation of structures where they are expressed. In mouse and Xenopus, Vax1 expression first occurs in the rostral neural plate, in the medial anterior neural ridge and adjacent ectoderm. Later, at midgestation in the mouse and tadpole stage in Xenopus, the expression remains confined in the derivatives of this territory which differentiate into rostromedial olfactory placode, optic nerve and disc, and anterior ventral forebrain. Together, these ...
Liver receptor homolog-1 (LRH-1; NR5A2) is a member of the NR5A subfamily of nuclear receptors (NRs) for which there are two members (Fayard et al., 2004). LRH-1 and steroidogenic factor-1 (SF-1; NR5A1) both bind to identical DNA consensus sequences (response elements) in promoter regions of their target genes and both bind DNA as monomers (Krylova et al., 2005; Li et al., 2005; Solomon et al., 2005). LRH-1 and SF-1 are differentially expressed in tissues and thus are likely to have nonoverlapping, nonredundant functions. Whereas SF-1 is confined to steroidogenic tissues where it plays a critical role in the regulation of development, differentiation, steroidogenesis, and sexual determination (Broadus et al., 1999; Lavorgna et al., 1991; Luo et al., 1994), LRH-1 is highly expressed in tissues of endodermal origin and is essential for normal intestinal and pancreatic function. In the liver, LRH-1 regulates cholesterol metabolism and bile acid homeostasis (Francis et al., 2003). Most NRs require ...
The study of formation of defensive mechanisms in the human fetal lung at different stages of embryogenesis is of great interest, in particular, because of the high frequency of pathology of the respiratory organs in neonates. Several structural components of the lungs are involved in the development of local reactions of cellular and humoral immunity: broncho-associated lymphoid tissue (the BALT system), lymphoid ceils of the lung parenchyma, and also the alveolar macrophages. The formation of the material substrate of local cellular immunity has been studied experimentally [5-7]. The results of an investigation of the subpopulation composition of lymphoid cells in the parenchyma of the adult human lung have been obtained [4]. No information on phenotypic characteristics of the lymphoid cells of the embryonic human lung could be found in the literature. This paper describes a study of the subpopulation composition of lymphoid cells in the parenchyma of the human fetal Iung at different stages of
... cells therefore belong to the group of APUD (amine precursor uptake and decarboxylation) cells. These cells are ... A chromophil biological cell is a cell which is easily stainable by absorbing chromium salts used in histology to increase the ... Chromophil cells are mostly hormone-producing cells containing so-called chromaffin granules. In these subcellular structures, ...
In pathology, an apudoma is an endocrine tumour that arises from an APUD cell from structures such as the ampulla of Vater. ... They were historically thought to be derived from neural crest cells, but this has since been shown to be untrue (see ... 2000). "Superficial undifferentiated small cell carcinoma of the esophagus showing an interesting growing pattern in histology ...
APUD cells Neuroendocrine tumors List of human cell types derived from the germ layers Rehfeld JF (October 1998). "The new ... Enterochromaffin-like cells or ECL cells are a type of neuroendocrine cell secreting histamine. Located in the jejunum, N cells ... Also called Delta cells, D cells secrete somatostatin. Different from the Microfold cells (M cells) that are in Peyer's patches ... Enterochromaffin-like cells are enteroendocrine and neuroendocrine cells also known for their similarity to chromaffin cells ...
APUD) cells in the avian carotid body, using a cytochemical marker system". Histochemie. 34 (3): 191-203. doi:10.1007/ ... Glomus cells are the cell type mainly located in the carotid bodies and aortic bodies. Glomus type I cells are peripheral ... Glomus type II cells are sustentacular cells having a similar supportive function to glial cells. The signalling within the ... Glomus type II cells are not innervated. Glomus type I cells are embryonically derived from the neural crest. In the carotid ...
APUD cells are considered part of the neuroendocrine system, and share many staining properties with neuroendocrine cells. ... Neuroendocrine cells are cells that receive neuronal input (neurotransmitters released by nerve cells or neurosecretory cells) ... Pulmonary neuroendocrine cells are also known as Kulchitsky cells or K cells. They are located in the respiratory epithelium of ... These cells can be the source of several types of lung cancer- most notably, small cell carcinoma of the lung, and bronchial ...
Merkel cells are sometimes considered APUD cells (an older definition. More commonly classified as a part of dispersed ... Merkel cells, also known as Merkel-Ranvier cells or tactile epithelial cells, are oval-shaped mechanoreceptors essential for ... Merkel cells are found in the skin and some parts of the mucosa of all vertebrates. In mammalian skin, they are clear cells ... Although uncommon, these cells may become malignant and form a Merkel cell carcinoma-an aggressive and difficult to treat skin ...
It is thought to originate from neuroendocrine cells (APUD cells) in the bronchus called Feyrter cells (named for Friedrich ... Small-cell carcinoma is an undifferentiated neoplasm composed of primitive-appearing cells. As the name implies, the cells in ... small cell lung cancer 14.9%; and for "Distant" small cell lung cancer 2.9%. Women affected by small-cell lung cancer tend to ... small cell, spindle cell and squamous cell carcinoma". Eur J Cardiothorac Surg. 26 (5): 1047-49. doi:10.1016/j.ejcts.2004.08. ...
... collectively known as diffuse neuroendocrine system or APUD cells. Neuroendocrine cells are present in all regions of the human ... Prostatic neuroendocrine cells, also known as endocrine-paracrine cells, are part of a larger regulatory cell population ... The open type cells may in addition receive regulatory signals from luminal molecules The developmental origin of these cells ... Neuroendocrine tumor cells express cytokeratins that are typically expressed by luminal secretory type cells, but lack basal ...
Cholecystokinin, a hormone secreted by the APUD cells located in the proximal mucosa of the small intestine is administered ...
Sidhu GS (July 1979). "The endodermal origin of digestive and respiratory tract APUD cells. Histopathologic evidence and a ... Giant cells in a lung cancer are highly associated with the presence of spindle cells. The chromatin of malignant giant cells ... Both "tumor cell-tumor cell" and "leukocyte-tumor cell" emperipolesis (i.e. active penetration of the latter by the former) is ... The cells from giant-cell carcinomas are anaplastic, and show no evidence of cell maturation or differentiation, lacking the ...
Argentine footballer Other apud, an expression of Latin origin APUD cells, a group of endocrine cells This disambiguation page ... Apud may refer to: People Alejandro Apud, Uruguayan football manager Antonio Apud, ... lists articles associated with the title Apud. If an internal link led you here, you may wish to change the link to point ...
APUD cells (DNES cells) constitute a group of apparently unrelated endocrine cells, which were named by the scientist A.G.E. ... C-cells of Thyroid Chief Cells of Parathyroid Adrenal Medullary Cells Glomus cells in Carotid Body Melanocytes of Skin Cells of ... Pineal Gland Renin producing cells in Kidney Apudoma Enteroendocrine cell Neuroendocrine cell List of human cell types derived ... APUD+Cells at the US National Library of Medicine Medical Subject Headings (MeSH) v t e. ...
Hic fasciculus apud Vicimedia Communia iacet; in aliis inceptis adhiberi potest. Contenta paginae descriptionis fasciculi ... Svenska: Schematisk bild över en typisk eukaryot cell, som visar cellens subcellulära komponenter. Organeller: *Nukleol ... English: Diagram of a typical animal cell. Organelles are labelled as follows: *Nucleolus ...
Enterochromaffin-like cells or ECL cells are a type of neuroendocrine cell found in the gastric glands of the gastric mucosa ... List of human cell types derived from the germ layers. References[edit]. *^ Enterochromaffin-like+Cells at the US National ... ECL cells synthesize and secrete histamine. These cells are stimulated by the hormones gastrin (not depicted in the adjacent ... G cells are stimulated by vagal stimulation through the neurotransmitter gastrin-releasing peptide; this causes the G cells to ...
... 's proenzyme, pepsinogen, is released by the chief cells in the stomach wall, and upon mixing with the hydrochloric acid ... Pepsin is retained within the cell for up to 24 hours.[23] Such exposure to pepsin at neutral pH and endocyctosis of pepsin ... This zymogen is activated by hydrochloric acid (HCl), which is released from parietal cells in the stomach lining. The hormone ... These fragments may also be desirable for staining cell preparations in the presence of plasma, because they are not able to ...
Endocrine cell types:. *Enteroendocrine cells. *Enterochromaffin cell. *APUD cell. Fluids. *Intestinal juice ...
"Enterochromaffin-like Cells"[edit]. "Enterochromaffin-like (ECL) cells" are a population of cells that are found in the gastric ... EC cells are small polygonal cells located in the crypts between intestinal villi. They are discriminated from other cells of ... In response to gastrin released by neighbouring G-cells, secreted histamine from ECL cells acts on parietal cells to stimulate ... ECL cells histologically appear similar to EC cells and are hence named as such. They are however a different cell type and do ...
1- Donor cell produces pilus. 2- Pilus attaches to recipient cell, bringing the two cells together. 3- The mobile plasmid is ... 4- Both cells recircularize their plasmids, synthesize second strands, and reproduce pili; both cells are now viable donors. ... This triggers G cells to release gastrin, which in turn stimulates parietal cells to secrete gastric acid. Gastric acid is ... Transferred genes enter the plant cell nucleus and effectively transform the plant cells into factories for the production of ...
Merkel cells are sometimes considered APUD cells (an older definition. More commonly classified as a part of dispersed ... Merkel cells, also known as Merkel-Ranvier cells or tactile epithelial cells, are oval-shaped mechanoreceptors essential for ... Merkel cells are found in the skin and some parts of the mucosa of all vertebrates. In mammalian skin, they are clear cells ... Though it has been reported that Merkel cells are derived from neural crest cells,[4] more recent experiments in mammals have ...
The pars distalis contains two types of cells, including chromophobe cells and chromophil cells. The chromophils can be further ... Racagni, G; Apud, J.A; Cocchi, D; Locatelli, V; Muller, E.E. (1982) GABAergic control of anterior pituitary hormone secretion. ... divided into acidophils (alpha cells) and basophils (beta cells). These cells all together produce hormones of the anterior ... It also contains non-endocrine folliculostellate cells which are thought to stimulate and support the endocrine cell ...
apud Mont. development on the cork-oak, Quercus suber L., in Morocco. Cryptogamic Mycology 21: 235-248. Franceschini, A., Corda ... The asexual spores (conidia) occur in pycnidia from conidiogenous cells, without conidiophores. Pycnidia are dark brown to ...
The basidia (spore-bearing cells) are club-shaped with a narrow base, and have dimensions of 20-30 by 7-9 µm. Like other ... 1801). Synopsis Methodica Fungorum (in Latin). Gottingen, Sweden: Apud H. Dieterich. p. 523. De AB. (1997). "Taxonomy of ...
In fuel cells, electro-osmosis causes protons moving through a proton exchange membrane (PEM) to drag water molecules from one ... Apud Universitatem Literarum Caesaream Mosquensem Institutae (Memoirs of the Physical-Medical Society, Instituted at the Moscow ... Companion cells are involved in the "cyclic" withdrawal of ions (K+) from sieve tubes, and their secretion parallel to their ... The hydrogen peroxide and/or pH changes generated can adversely affect biological cells and biomolecules such as proteins, ...
Saint-Hilaire, Auguste de (1825). Flora Brasiliae meridionalis (in Latin and French). 1. Paris: Apud A. Belin. Maas, Paul J. M ... "Flavonoids from Annona dioica leaves and their effects in Ehrlich carcinoma cells, DNA-topoisomerase I and II". Journal of the ...
Evidence suggests that the mechanism for this detoxification involves the cadmium binding to the fungal cell walls, as well as ... Batsch, August (1786). Elenchus Fungorum (Discussion of Fungi), Continuatio Prima (in Latin). Halle, Magdeburg, Germany: Apud ... An antigen in the mushroom triggers the immune system to attack red blood cells. Serious and commonly fatal complications ... The use of corticosteroids may be a useful adjunct in treatment, as they protect blood cells against hemolysis, thereby ...
Due to a lack of money not all Colgan's writings could be published, and a catalogue of manuscripts found in his cell after his ... Acta Sanctorvm Veteris Et Maioris Scotiae, Sev Hiberniae Sanctorvm Insvlae, Volume 2. Publisher: Apud Cornelivm Coenestenivm, ...
The spore-bearing cells, the basidia, are club-shaped and have dimensions of 24-33 by 6-7.5 µm; they are colorless, and each ... 1774). Fungorum qui in Bavaria et Palatinatu circa Ratisbonam nascuntur Icones (in Latin and German). 4. Regensburg: Apud J.J. ... Microscopically, the terminal cells in the cap cuticle of R. parvovirescens are more swollen than those of R. virescens, which ... Like other mushrooms in the Russulales, the flesh is brittle, owing to the sphaerocyst cytoarchitecture-cylindrical cells that ...
apud viduam Herissant, typographum, viâ novâ B. M. sub signo Crucis aureæ. de Candolle; A. P.; et al. (1824-1873). Prodromus ... resulting in unprecedented accumulation of DNA sequence data from various genes present in compartments of plant cells. In 1998 ...
Göttingen: Apud H. Dieterich. p. 246. Retrieved 2010-10-12. Nees von Esenbeck CDG. (1817). System der Pilze und Schwämme (in ... The basidia (spore-bearing cells) are cylindrical, with dimensions of 20-25 by 3-4 µm. They have eight sterigmata (slender ...
... and bone marrow cells from mice. The extract also stimulated mouse cells associated with the immune system; specifically, it ... 1801). Synopsis Methodica Fungorum (in Latin). Göttingen, Germany: Apud Henricum Dieterich. p. 135. Morgan AP (1889). "North ... Extracts from A. hygrometricus containing the polysaccharide named AE2 were found to inhibit the growth of several tumor cell ... Mallick SK, Maiti S, Bhutia SK, Maiti TK (2011). "Activation of RAW 264.7 cells by Astraeus hygrometricus-derived heteroglucan ...
"Browse any completed archaeal genome at UCSC," apud archaea.ucsc.edu. *"Comparative Analysis of Archaeal Genomes," apud img.jgi ... "Major New Microbial Groups Expand Diversity and Alter our Understanding of the Tree of Life". Cell 172 (6): 1181-97. 2018 . ... Hic habes cladogramma apud Tom A. Williams et al. (2017)[5] et Castelle & Banfield (2018)[6] (DPANN): Formula:Barlabel ... Genera dominii Archaeorum, apud www.bacterio.cict.fr.. *Arbor Vitae, coniunctiones Archaeorum et aliarum formarum vivarum ...
Fortasse haec declinatio apud scriptores Medii Aevi reperiri potest, sed cur non "mercatus, -ūs", quod apud Ciceronem, Livium ... Res geographicae is fine, but these and other permutations are sometimes too much for the little gray cells to keep straight- ... Igitur Georgius Papandreu est Γεώργιος apud situm parlamenti Graeci, Γιώργος in diariis, "George" apud Anglos, "Georges" ... Tamara Smirnova apud nos ex arcanis Thamar Smirnova, Brigitte Bardot apud nos per miram metathesin Birgitta Bardot, etc. Veniam ...
These include the various cells of the gastric glands, taste cells, pancreatic duct cells, enterocytes and microfold cells. ... Another product is iron, which is used in the formation of new blood cells in the bone marrow.[5] Medicine treats the spleen ... The parietal cells in the fundus of the stomach, produce a glycoprotein called intrinsic factor which is essential for the ... The spleen is the largest lymphoid organ in the body but has other functions.[23] It breaks down both red and white blood cells ...
Zurich: Apud Christoph. Froschoverum.. [note 4]. *. - (1545). Bibliotheca Universalis, sive Catalogus omnium Scriptoum ... "Sickle Cell Anemia, a Molecular Disease". *Fred Sanger. *Max Perutz. *John Kendrew ...
Berolini: Apud Johannem Andream Rüdigerum. p. 134.. *^ a b c d e f g h i j Hammond, C. R. (2004). The Elements, in Handbook of ... Large cells). 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 ...
Microsporogenesis involves a cell dividing twice (meiotically) to form four daughter cells. There are two kinds of ... apud viduam Herissant et Theophilum Barrois, OCLC 5161409, retrieved 9 January 2014. ... In simultaneous microsporogenesis, there is no wall formation until all four cell nuclei are present. Liliales all have ... The 'lower Asparagales' typically have simultaneous microsporogenesis (i.e. cell walls develop only after both meiotic ...
De Christiana expeditione apud Sinas based on Matteo Ricci's journals completed by Nicolas Trigault. Pp. 106-107. There is also ... are allegedly grouped in different cells from Kazakhs and Uighurs, and on rare occasion die from stress.[258][261] ...
"Cell. 172: 881-887.e7. doi:10.1016/j.cell.2018.01.020. Retrieved 24 January 2018.. ... apud Theodorum Haak, Lugduni Batavorum. pp. s.p.. *^ Blainville, H. (1839). "Nouvelle classification des Mammifères". Annales ... On 24 January 2018, scientists in China reported in the journal Cell the creation of two crab-eating macaque clones, named ... "Cloning of Macaque Monkeys by Somatic Cell Nuclear Transfer" ...
The light emission is continuous and occurs only in living cells.[5] No correlation of fungal bioluminescence with cell ... Massee apud Cooke) Massee Yes No EU, NA [14] Mycena polygramma. (Bull.: Fr.) S.F.Gray Yes No AF, EU, NA, Japan [15][29][30] ... Although the biochemistry of fungal bioluminescence has not fully been characterized, the preparation of bioluminescent, cell- ...
apud Andream Cratandrum. Retrieved 7 December 2012.. *^ Thorndike, Lynn (1958). A History of Magic and Experimental Science: ... The first Stem Cell Therapy.. *2000. The da Vinci Surgical System was approved by the FDA. ...
Florence: Apud Georgium Marescottum - via Internet Archive.. *^ "Andrea Cesalpino , Italian physician, philosopher, and ... with the Eukaryota for all organisms whose cells contain a nucleus.[53] A small number of scientists include a sixth kingdom, ...
Erlangen: Apud J.J. Palmium. p. 78; plate 107.. *^ a b Nilson S, Persson O (1977). Fungi of Northern Europe 1: Larger Fungi ( ... spore-bearing cells) are club-shaped and four-spored, and measure 29.2-36.5 by 11.0-12.4 μm. Cystidia on the sides of the tubes ...
apud Andream Cratandrum. Retrieved 7 December 2012.. *^ Thorndike, Lynn (1958). A History of Magic and Experimental Science: ... "Anatomy & Cell Biology. 43 (4): 280-283. doi:10.5115/acb.2010.43.4.280. ISSN 2093-3665. PMC 3026179. PMID 21267401.. ... "Anatomy & Cell Biology. 48 (3): 153-169. doi:10.5115/acb.2015.48.3.153. PMC 4582158. PMID 26417475.. ...
The spore-bearing cells, the basidia, are four spored and measure 26-35 by 10.5-11.5 µm. Cystidia are non-fertile cells ... separated from the publishing author as apud; for this reason, the name and authority are written Boletus Frostii Russell apud ... These hyaline (translucent) cells measure 30-53 long by 7.5-14 µm wide, and range in shape from somewhat like a spindle ( ... The hyphae also invade between the root cortical cells to form a Hartig net. Using pure culture techniques, Exsudoporus frostii ...
apud "Masturbation: Current medical opinions". Ontario Consultants on Religious Tolerance. Retrieved 27 August 2014. Szasz, ... Rosenthal, Martha (2012). Human Sexuality: From Cells to Society. Cengage Learning. pp. 133-135. ISBN 978-0-618-75571-4. ... It is an excerpt from "Sexualities in Victorian Britain.") apud Masturbation: Current medical opinions Ontario Consultants on ...
The basidia (spore-bearing cells) are cylindrical to club shaped, four spored, and measure 39-50 by 8.0-9.6 μm. The cystidia ... Apud J.J. Palmium. pp. 38, tab. LXXXIX. Archived from the original on 2016-10-09. Retrieved 2016-07-15. Riva, Alfredo (1988). ... Apud H. Dieterich. p. 346. Archived from the original on 2015-05-11. Retrieved 2011-10-03. CS1 maint: discouraged parameter ( ...
The asci (spore-bearing cells) measure 100-135 by 7-10 μm. The paraphyses are shaped liked narrow cylinders with diameters up ... Continuatio secunda (in Latin). Halae Magdeburgicae: Apud Joannem J. Gebauer. p. 95. Fries EM. (1821). Systema Mycologicum (in ...
Halae Magdeburgicae: Apud Joannem J. Gebauer. p. 103. Karsten PA. (1879). "Symbolae ad mycologiam Fennicam. VI". Meddelanden Af ... Basidia (the spore-bearing cells) are between 35-46 by 8-11 µm, club-shaped (clavate), without clamp connections, and four- ...
In fact, the cellular bulge that is produced by a haploid yeast cell as a response to a pheromone from the opposite mating type ... Pyles, Thomas (1952). Words and Ways of American English, New York : Random House, apud Orrick (1954) Spitzer, Leo (February ... either a or α-factor) is referred to as a "shmoo", because cells that are undergoing mating and present this particular ... led to the character's adoption as a mascot of sorts for scientists studying yeast as a model organism for genetics and cell ...
APUD cells (DNES cells) constitute a group of apparently unrelated endocrine cells, which were named by the scientist A.G.E. ... C-cells of Thyroid Chief Cells of Parathyroid Adrenal Medullary Cells Glomus cells in Carotid Body Melanocytes of Skin Cells of ... Pineal Gland Renin producing cells in Kidney Apudoma Enteroendocrine cell Neuroendocrine cell List of human cell types derived ... APUD+Cells at the US National Library of Medicine Medical Subject Headings (MeSH) v t e. ...
What is Apud cells? Meaning of Apud cells as a finance term. What does Apud cells mean in finance? ... Definition of Apud cells in the Financial Dictionary - by Free online English dictionary and encyclopedia. ... cell. (redirected from Apud cells). Also found in: Dictionary, Thesaurus, Medical, Legal, Encyclopedia.. Related to Apud cells ... Apud cells financial definition of Apud cells https://financial-dictionary.thefreedictionary.com/Apud+cells ...
The results showed that the immunoreactive positive cells in the body of the Z 1-Z 5,M and L of E. Sinensis were not found;9 ... cells in the body of the first-fifth zoeal stages (Z 1-Z 5), a megalopal stage(M),a larva stage (L) of Chinese mitten-handed ... IMMUNOCYTOCHEMICAL IDENTIFICATION AND LOCALIZATION OF APUD CELLS OF CHINESE MITTEN-HANDED CRAB ON DIFFERENT DIVELOPED STAGES. ... The results showed that the immunoreactive positive cells in the body of the Z 1-Z 5,M and L of E. Sinensis were not found;9 ...
APUD cells, serotonin signaling. Neuroendocrine, amine precursor uptake decarboxylase (APUD) cells signaling, serotonin are ... Reconstitution with CD4 T cells promoted accumulation of degranulated IL-4-expressing cells but only if T cells were stimulated ... TH2 cells elaborate cytokines, such as IL-4, IL-5, IL-9, and IL-13, which work with toxic mediators of innate immune cells to ... The importance of TH2 cells in coordinating innate immune cells at sites of inflammation is not known. Here, we show that ...
... and new information on the molecular biology of endothelial cell function. Terminology throughout the text is consistent with ... cell secretion secretory shows skeletal muscle smooth muscle smooth muscle cells specific spicules spinal stained stem cells ... Histology: With Correlated Cell and Molecular Biology. Wojciech Pawlina,Michael H. Ross. No preview available - 2015. ... dense diagram differentiation duct elastic fibers Electron micrograph endothelial cells enzymes eosinophilic epithelial cells ...
Merkel cells are sometimes considered APUD cells (an older definition. More commonly classified as a part of dispersed ... Merkel cells, also known as Merkel-Ranvier cells or tactile epithelial cells, are oval-shaped mechanoreceptors essential for ... Merkel cells are found in the skin and some parts of the mucosa of all vertebrates. In mammalian skin, they are clear cells ... Although uncommon, these cells may become malignant and form a Merkel cell carcinoma-an aggressive and difficult to treat skin ...
It was shown that the small cells have morphologic characteristics of APUD cells. Also presented are the histologic features of ... and two cutaneous melanomas were compared with those of other APUD cell tumors including small cell carcinomas of...Continue ... Carcinoma, Squamous Cell. Basal cell carcinoma is a form of malignant skin cancer found on the head and neck regions and has ... The endodermal origin of digestive and respiratory tract APUD cells. Histopathologic evidence and a review of the literature. ...
The Apud Cell Series. Sponsor. *. 1973. Bioengineering in Perspective. Sponsor. *. 1972. Attempted Suicide (Parasuicide): ...
gastric/chief (zymogenic) cells. pepsinogen, rennin. Fundic only. Basophilic Base of gland. enteroendocrine (APUD) cells. ... goblet cells. mucus gel layer. Fundic, cardiac, pyloric. Clear Neck of gland. parietal (oxyntic) cells. gastric acid and ... Different types of cells are found at the different layers of these glands: Location in gland. Name. Secretion. Region of ... from parietal cells) in the stomach. It also causes increased motility in the stomach. Gastrin is released by G-cells in the ...
Sidhu GS (July 1979). "The endodermal origin of digestive and respiratory tract APUD cells. Histopathologic evidence and a ... Giant cells in a lung cancer are highly associated with the presence of spindle cells. The chromatin of malignant giant cells ... Both "tumor cell-tumor cell" and "leukocyte-tumor cell" emperipolesis (i.e. active penetration of the latter by the former) is ... The cells from giant-cell carcinomas are anaplastic, and show no evidence of cell maturation or differentiation, lacking the ...
Serotonin producing and hence argentaffin cells have not been found. Amine precursor uptake and decarboxylation (APUD) by the ... Enteroendocrine cells in the digestive tract of Barbus conchonius (teleostei, cyprinidae) Cell Tissue Res. 1977 Dec 28;185(4): ... The possible functions of the enteroendocrine cells are discussed. (Auto-)phagosomes, common in epithelial cells of the gut of ... Four types of enteroendocrine cells can be distinguished between the intestinal epithelial cells. The number decreases in the ...
White cells explanation free. What is White cells? Meaning of White cells medical term. What does White cells mean? ... Looking for online definition of White cells in the Medical Dictionary? ... Kulchitsky cell. An APUD cell found in the lung.. Kupffer cell. See: Kupffer cell. L cell. An enteroendocrine cell that ... See: mitral cell. Türk irritation cell. See: Türk irritation cell. Tzanck cell. See: Tzanck cell. undifferentiated cell. A cell ...
enterogastrone: I cells (CCK) · K cells (GIP) · S cells (secretin). Enteroendocrine cells · Enterochromaffin cell · APUD cell ... D cells (somatostatin)Template:· ECL cells (Histamine) enterogastrone: I cells (CCK)Template:· K cells (GIP)Template:· S cells ... Chief cells (Pepsinogen) · Parietal cells (Gastric acid, Intrinsic factor) · Goblet cells (Mucus) ... G cells (gastrin) · D cells (somatostatin) · ECL cells (Histamine). ...
What is neurosecretory cell? Meaning of neurosecretory cell medical term. What does neurosecretory cell mean? ... Looking for online definition of neurosecretory cell in the Medical Dictionary? neurosecretory cell explanation free. ... Kulchitsky cell. An APUD cell found in the lung.. Kupffer cell. See: Kupffer cell. L cell. An enteroendocrine cell that ... See also betz cells, gauchers cells, golgis cells, hela cells, hürthle cell, kupffers cells, merkel cell, mesangial cell, ...
chief (zymogenic) cells. pepsinogen, rennin. Fundic only. Basophilic. Base of gland. enteroendocrine (APUD) cells. hormones ... Mucous neck cells. mucus gel layer. Fundic, cardiac, pyloric. Clear. Body of gland. parietal (oxyntic) cells. gastric acid and ... The hormone gastrin causes an increase in the secretion of HCl from the parietal cells, and pepsinogen from chief cells in the ... Different types of cells are found at the different layers of these glands:. Layer of stomach. Name. Secretion. Region of ...
Primary malignant melanoma of the small intestine: report of a case and discussion of the APUD cell concept ...
APUD cell. References. *↑ UIUC Histology Subject 321 *↑ iv_1/g/G_cell article at GEs Medcyclopaedia ... Enteroendocrine cells are also found in the duodenum.[3] Enterochromaffin-like cell and enterochromaffin cells are also ... Enteroendocrine cells are specialized endocrine cells of the gastrointestinal tract. They produce hormones such as serotonin[1] ... Histology image: 22201loa - Histology Learning System at Boston University - "Ultrastructure of the Cell: chief cells and ...
The cells in pancreatic endocrine neoplasms are termed amine precursor uptake and decarboxylation (APUD) cells because they ... 15] Instead, the tumors arise from APUD stem cells, which are pluripotential neuroendocrine cells located within the ductular ... APUD cells were once believed to originate from the embryologic neural crest, but current evidence suggests that these cells- ... The origin of gut and pancreatic neuroendocrine (APUD) cells--the last word?. J Pathol. 1998 Oct. 186(2):117-8. [Medline]. ...
The APUD system cells are of 3 types:. 1. Neural Crest Origin: Thyroid, Adrenal Medulla, Melanoblasts of the Dermis, Cells in ... Some of these adaptations are cell hypertrophy, cell atrophy or cell injury which may be reversible or can result in final ... The cell division produces various cells for the development of different organs but all these cells arise initially from only ... Some APUD cells of disputed origin are Islets of Langerhans in the Pancreas.. Affection of these tissues, is due to longterm ...
Paneth Cells in Jejunum 108. Paneth vs. APUD cell 109. (No Transcript) 110. (No Transcript) 111. (No Transcript) 112. (No ... Bone Marrow (B cells) and Thymus (T cells) * Cells undergo antigen-independent proliferation, differentiation. T and B cells ... cell not a granulocyte or monocyte progenitor cell. *This pluripotent stem cell slowly differentiates towards other cell types ... Mucous Neck Cells shorter than surface cells, more soluble secretion *Parietal Cells Large, clearer cells, secrete HCl and ...
1. olfactory cells. 2. supporting cells. 3. basal cells. NO GOBLET CELLS ... ciliated cells. mucous cells (mature goblet and small mucous granule "brush" cells) ... how do APUD (enteroendocrine) cells exert its effects? via paracrine regulation - local effet on nearby structures and cell ... what do Clara cells contain an abundance of? What is their function? ...
Apudoma refers to a tumor of the amine precursor uptake and decarboxylation (APUD) cells. The term is taken from APUD cells. ... Hürthle cell tumor. // Tabers Cyclopedic Medical Dictionary;2005, p1016 A definition of the medical term "Hürthle cell tumor ... Hürthle cells. // Tabers Cyclopedic Medical Dictionary;2005, p1016 A definition of the medical term "Hürthle cells" is ... A definition of the medical term "cytodistal" is presented, which refers to a neoplasm remote from the cell of origin. ...
INTRODUCTION TO CELLS & TISSUES By Vijay Kapal Graduate Studies Course CMM 5001 The Pathological Basis Of Disease - A free ... 2. Polypeptide-secreting cells (APUD cells) * 3. Mucous cells (Goblet cells) * 4. Serous cells (Acinar cells of pancreas ... immune response Natural killer cells kill tumor nonself cells 64. Plasma Cells. Plasma cells. Lymphocyte. Plasma cells produce ... of cells All Tissues Organs of Human body 5. Human Genome. Nucleus Cytoplasm Cell membrane. Cell. Each cell has 46 chromosomes ...
It is present in neurons, neuroendocrine cells, and amine precursor uptake and decarboxylation (APUD) cells. Elevated NSE ... Monitor disease progression and therapy in individuals with small cell lung cancer (SCLC) ... concentrations are observed in patients with neuroblastoma, pancreatic islet cell carcinoma, medullary thyroid carcinoma, ...
In all three types, the glands contain mucous neck cells and enteroendocrine (APUD) cells at the isthmus and bases respectively ... The fundic glands have two extra types of cells, the pariental (oxyntic) and chief (zymogenic) cells in the body and base of ...
di SantAgnese PA, de Mesy Jensen KL (1987) Endocrine-paracrine (APUD) cells of the human female urethra and paraurethral ducts ... Deckmann K, Kummer W (2016) Chemosensory epithelial cells in the urethra: sentinels of the urinary tract. Histochem Cell Biol ... However, more recently, non-neuronal cells including epithelia, endothelial, mast cells, and paraneurons are likely important ... and mediates trans-epithelial resistance in cultured endothelial and epithelial cells. Cell Tissue Res 323(1):117-125PubMed ...
We therefore hypothesized that NECs contain ACh among other neurochemicals in cells belonging to the APUD series. Although ... Zinc Oxide Nanoparticles for Nonlinear Bioimaging, Cell Detection and Selective Cell Destruction Description: Light matter ... Finally, the results of this investigation suggest that the cells that respond to trypsin are surface cells, which have an ... derived APUD (amine-precursor uptake and decarboxylation) pulmonary NECs and carotid body type-1 glomus cells. Branchial NECs ...
cell answers are found in the Tabers Medical Dictionary powered by Unbound Medicine. Available for iPhone, iPad, Android, and ... APUD cells include chromaffin cells, enterochromaffin cells, and certain cells found in the parathyroid gland, thyroid gland, ... blood cell. Any cell normally found circulating in the bloodstream. Blood cells include red cells and white cells. Red cells ... null cell. 1. A large lymphocyte without the cell markers of either a T cell or a B cell. Natural killer cells are examples of ...
An approach for analyzing migration and eventual fate of avian neural crest cells in quail-chick chimeric embryos is described ... The problem of the neurectodermal origin of the cells of the APUD series. J. Embryol. Exp. Morphol. 41, 209-222 (1977). ... Maro, G. S. Neural crest boundary cap cells constitute a source of neuronal and glial cells of the PNS. Nat. Neurosci. 7, (9), ... Because quail-derived cells can be easily distinguished from host chick cells via immunostaining with the quail-specific ...
Argentaffin cells are the origin of carcinoids. These cells belong to the amino precursor uptake and decarboxylation (APUD) ... Carcinoid is a tumor that primarily affects the intestinal tract, which arises from entero-chromaffin cells. Rectal carcinoid ... Most of them were histologically spindle cell tumors, usually of mesenchymal origin. Stromal tumors account... ... tumor is a relatively rare neoplasm originated in Kul-chitszky cell and clinicians have... ...
  • Amine precursor uptake and decarboxylation (APUD) by the enteroendocrine cells of adult fishes has not been observed. (nih.gov)
  • The cells in pancreatic endocrine neoplasms are termed amine precursor uptake and decarboxylation (APUD) cells because they have a high amine content, are capable of amine precursor uptake, and contain an amino acid decarboxylase. (medscape.com)
  • Apudoma refers to a tumor of the amine precursor uptake and decarboxylation (APUD) cells. (ebscohost.com)
  • It is present in neurons, neuroendocrine cells, and amine precursor uptake and decarboxylation (APUD) cells. (questdiagnostics.com)
  • These cells belong to the amino precursor uptake and decarboxylation (APUD) system. (koreamed.org)
  • [ 14 ] The term carcinoid was also used interchangeably with APUDoma, so named by Pearse in the 1960s, who developed the concept of the amine precursor uptake and decarboxylation (APUD) system after observing the ability of the secretory granules to take up and decarboxylate amino acid precursors of biogenic amines, such as serotonin and catecholamines. (medscape.com)
  • Since then, it has been referred to as cutaneous neuroendocrine carcinoma, small cell tumor of the skin, primary undifferentiated carcinoma of the skin, anaplastic carcinoma of the skin, murky cell carcinoma, neuroendocrine tumor of the skin, or cutaneous APUDoma (a tumor composed of cells with amine precursor uptake and decarboxylation [APUD] cytochemical properties). (medscape.com)
  • Carcinoid tumors are part of the neuroendocrine tumors APUD (Amine Precursor Uptake and Decarboxylation) originating in the Kulchitsky cells (agent affine cells). (spandidos-publications.com)
  • Carcinoid tumors are neuroendocrine tumors of the amine precursor uptake decarboxylase cells (APUD cells) of the gastrointestinal tract, bronchi, pancreas, biliary tract, or thymus. (clinicaladvisor.com)
  • They originate in amine precursor uptake and decarboxylation (APUD) cells of the gastroenteropancreatic endocrine system and in adrenal or extra-adrenal neurogenic sites. (healthtap.com)
  • Carcinoid tumors arise from endocrine amine precursor uptake and decarboxylation (APUD) cells that can be found throughout the gastrointestinal tract as well as other organs (e.g. lung). (radiopaedia.org)
  • Primary tumors arise from amine precursor uptake and decarboxylation cells which are found throughout the head and neck. (elsevier.com)
  • Also called oat-cell carcinoma, arising from Kulchitsky cells, which are part of the amine precursor uptake and decarboxylation (APUD) endocrine system. (patient.info)
  • These neuroendocrine cells have been also known as Kulchitsky cells, enterochromaffin cells or amine precursor uptake decarboxylase (APUD) cells. (unicornfoundation.org.au)
  • The granules bear close resemblance to secretory granules of the amine precursor uptake and decarboxylation - APUD - system. (gpnotebook.com)
  • The crypt-villus tissue architecture in combination with rapid cell turnover enables the intestine to act both as a barrier and as the primary site of nutrient uptake. (nature.com)
  • 3 ] This APUD characteristic is also the bases for the development of specific molecular imaging procedures using tracers that will accumulate on the bases of uptake in the tumor cells by the so called APUD mechanism. (thno.org)
  • MIBG is a tracer of the monoamine uptake and storage function involved in APUD system tumors, in organs with adrenergic innervation and the brain. (engii.org)
  • Carcinomas are tumors composed of transformed, abnormal cells with epithelial tissue architecture and/or molecular characteristics, and which derive from embryonic endoderm. (wikipedia.org)
  • Four types of enteroendocrine cells can be distinguished between the intestinal epithelial cells. (nih.gov)
  • In humans, lymphocytes are small cells (~6 µm in diameter), columnar epithelial cells (10 µm x 20 µm) are medium-size cells, and mature ova (120-150 µm) are some of the largest cells. (thefreedictionary.com)
  • 1. In the lung, either of two types of epithelial cells lining the alveoli. (thefreedictionary.com)
  • Type I cells are simple thin squamous epithelial cells. (thefreedictionary.com)
  • 2. In the mammary glands, the milk-secreting epithelial cells, which are activated during lactation. (thefreedictionary.com)
  • Merkel cells, also known as Merkel-Ranvier cells or tactile epithelial cells, are oval-shaped mechanoreceptors essential for light touch sensation and found in the skin of vertebrates. (wikipedia.org)
  • Though it has been reported that Merkel cells are derived from neural crest cells, more recent experiments in mammals have indicated that they are in fact epithelial in origin. (wikipedia.org)
  • In humans, lymphocytes are small cells (6 µm in diameter), columnar epithelial cells (10 µm x 20 µm) are medium-size cells, and mature ova (120 to 150 µm) are some of the largest cells. (tabers.com)
  • It is suggested that Müllerian epithelial stem cells possess a potentiality for differentiation into APUD cells. (bmj.com)
  • Most tumors contain a proportion of epithelial cells and lymphocytes, although the majority of thymomas are completely encapsulated. (clinicaladvisor.com)
  • Cylindrical epithelial cells in the innermost layer of the ENAMEL ORGAN. (slicksurface.com)
  • These cells are nurtured and protected by specialized epithelial and mesenchymal cells, and together constitute the intestinal stem cell niche. (nature.com)
  • Cheng, H. & Leblond, C. P. Origin, differentiation and renewal of the four main epithelial cell types in the mouse small intestine. (nature.com)
  • V. Unitarian gheory of the origin of the four epithelial cell types. (nature.com)
  • Epithelial morphogenesis is a dynamic multiscale process that is the result of the coordination and integration of individual cell behaviors, including shape change, rearrangement, division, extrusion, and integration. (embopress.org)
  • The antibody detects normal osteoblasts, small intestinal cells, prostate epithelial cells, and cells containing CAP throughout the body. (green-blog.org)
  • An immunoglobulin which mostly made in the lymphoid nodules of the lamina propria, and is then transported through the epithelial cells into the lumen. (pathguy.com)
  • To assess DNA methylation and expression of SPDEF and FOXA2 during goblet cell differentiation, primary airway epithelial cells, isolated from trachea (non-COPD controls) and bronchial tissue (patients with COPD), were differentiated by culture at the air-liquid interface (ALI) in the presence of cytokine interleukin (IL)-13 to promote goblet cell differentiation. (statescale.tk)
  • Enterochromaffin-like cell and enterochromaffin cells are also considered enteroendocrine cells. (wikidoc.org)
  • They are conventionally considered to originate from the serotonin-secreting enterochromaffin cells (ECs) of the intestine (also known as Kulchistky cells), but technically, intestinal carcinoid tumors include any collection of well-differentiated neuroendocrine cells within the digestive tract that are capable of secreting bioactive hormones and/or amines. (medscape.com)
  • Between 1952 and 1953, serotonin [5-hydroxytryptamine (5-HT)] was identified as the secretory product of enterochromaffin cells (ECs) and isolated from a carcinoid tumor of the small bowel. (medscape.com)
  • Leu-enkephalin-like material in nerves and enterochromaffin cells in the gut. (meta.org)
  • The combined tumors and the numerous other similar neoplasms described in the literature and reviewed here suggest an endodermal origin for digestive and respiratory tract APUD cells based on the hypothesis that cancer is a clonal proliferation, and mucous and squamous cell differentiation is an endodermal rather than neural crest characteristic. (meta.org)
  • Cells undergo antigen-independent proliferation, differentiation. (powershow.com)
  • This method is a simple and straightforward technique for tracing neural crest cells during migration and differentiation that are otherwise difficult to distinguish within an unmanipulated chick embryo. (jove.com)
  • Valproic acid induces neuroendocrine differentiation and UGT2B7 up-regulation in human Prostate carcinoma cell line," Drug Metabolism and Disposition , vol. 35, no. 6, pp. 968-972, 2007. (hindawi.com)
  • Is neuroendocrine cell differentiation detected using chromogranin A from patients with bone metastatic Prostate cancer a prognostic factor for outcome? (hindawi.com)
  • It also acts as protein binding, transcription factor, and in cell differentiation. (atlasgeneticsoncology.org)
  • We investigate how the niche protects and instructs intestinal stem cells, which processes drive differentiation of mature cells and how imbalance in key signalling pathways can cause human disease. (nature.com)
  • Together with interleukins, Hippo signalling and metabolic cues, WNT, NOTCH, EGF and bone morphogenetic protein signalling regulates stem cell maintenance, regeneration and differentiation. (nature.com)
  • The same signalling cascades involved in stem cell maintenance are key regulators of intestinal differentiation and cooperate to guide cells to one of six mature cell fates. (nature.com)
  • In mammals, all new cells arise from existing cells through cell division, and an animal's growth results largely from increases in the number of its cells, most of which differentiate into specialized cell types to form the body's various tissues. (thefreedictionary.com)
  • [ 15 ] Instead, the tumors arise from APUD stem cells, which are pluripotential neuroendocrine cells located within the ductular epithelium of the exocrine pancreas and elsewhere in the distal foregut. (medscape.com)
  • Osteoclasts arise from an early stem cell not a granulocyte or monocyte progenitor cell. (powershow.com)
  • The cell division produces various cells for the development of different organs but all these cells arise initially from only 3 morphologically different germinal layers. (hpathy.com)
  • Pancreatic islet cell tumors arise from this system and are capable of secreting virtually any of the known polypeptide hormones. (springer.com)
  • Neuroendocrine Tumours (NEC), are neoplasms that arise from cells of the endocrine (hormonal) and nervous systems. (alliedacademies.org)
  • Neuroendocrine tumors are a heterogeneous group of neoplasms that arise from neuroendocrine cells. (biomedcentral.com)
  • As with all forms of cancer, NETs arise when cells multiply rapidly and in an abnormal way in the body. (unicornfoundation.org.au)
  • Twenty-seven small cell carcinomas of the lung and three tumors of the large intestine with combined adenocarcinomatous and small cell and/or anaplastic carcinoid-type histologic features were studied by light and electron microscopy. (meta.org)
  • Eight major taxa of lung carcinomas are recognized within the WHO-2004 classification: Small-cell carcinoma Squamous cell carcinoma Adenocarcinoma Large-cell carcinoma Adenosquamous carcinoma Sarcomatoid carcinoma Carcinoid Salivary gland-like carcinoma The subclassification of GCCL among these major taxa has undergone significant changes in recent decades. (wikipedia.org)
  • [ 13 ] APUD cells were once believed to originate from the embryologic neural crest, but current evidence suggests that these cells-and thus endocrine tumors of the pancreas and other endocrine tumors of the upper gastrointestinal tract (eg, carcinoid tumors)-actually develop from the embryologic endoderm. (medscape.com)
  • Carcinoid is a tumor that primarily affects the intestinal tract, which arises from entero-chromaffin cells. (koreamed.org)
  • Rectal carcinoid tumor is a relatively rare neoplasm originated in Kul-chitszky cell and clinicians have. (koreamed.org)
  • Valproic acid activates Notch-1 signaling and regulates the neuroendocrine phenotype in carcinoid cancer cells," Oncologist , vol. 12, no. 8, pp. 942-951, 2007. (hindawi.com)
  • In some endometrial neoplasms they are present in abundance, but tumours rich in such cells do not have any features suggestive of a carcinoid tumour and are morphologically identical to adenocarcinomas of similar grade which are devoid of argyrophil cells. (bmj.com)
  • Pulmonary carcinoid tumors are part of bronchopulmonary neuroendocrine neoplasms (bpNETs) along with large and small cell pulmonary carcinoma ( 1 ). (spandidos-publications.com)
  • Combined carcinoid tumor and squamous cell carcinoma of lung: expanding the spectrum of combined tumors of lung. (umassmed.edu)
  • Carcinoid tumoursthese uprise from the enterochromaffin wireless telephone (apud cells)of the intestine. (fredwhittonchallenge.co.uk)
  • Neuroendocrine cells and were first described over a century ago and the term carcinoid was given to them in 1907 by Obendorfer. (unicornfoundation.org.au)
  • Also presented are the histologic features of a carcinoma of the lung with large cell undifferentiated carcinoma, adenocarcinoma, squamous cell carcinoma, and giant cell carcinoma areas in the primary site and in several metastatic foci. (meta.org)
  • Two of the renal metastases showed small cell carcinoma. (meta.org)
  • The ultrastructural features of tumors of cells of known neural crest origin, including a medullary carcinoma of the thyroid, three carotid body tumors, a pheochromocytoma, and two cutaneous melanomas were compared with those of other APUD cell tumors including small cell carcinomas of. (meta.org)
  • Basal cell carcinoma is a form of malignant skin cancer found on the head and neck regions and has low rates of metastasis. (meta.org)
  • Discover the latest research on basal cell carcinoma here. (meta.org)
  • Giant-cell carcinoma of the lung (GCCL) is a rare histological form of large-cell lung carcinoma, a subtype of undifferentiated lung cancer, traditionally classified within the non-small-cell lung carcinomas (NSCLC). (wikipedia.org)
  • Although it is common in the lung cancer literature to refer to histologically mixed tumors containing significant numbers of malignant giant cells as "giant-cell carcinomas", technically a diagnosis of "giant-cell carcinoma" should be limited strictly to neoplasms containing only malignant giant cells (i.e. "pure" giant-cell carcinoma). (wikipedia.org)
  • However, in a more recent series of 4,212 consecutive lung cancer cases, only one (0.024%) lesion was determined to be a "pure" giant-cell carcinoma after complete sectioning of all available tumor tissue. (wikipedia.org)
  • About 1% of lung cancers are sarcomas, germ cell tumors, and hematopoietic tumors, while 99% of lung cancers are carcinoma. (wikipedia.org)
  • Although uncommon, these cells may become malignant and form a Merkel cell carcinoma-an aggressive and difficult to treat skin cancer. (wikipedia.org)
  • Merkel nerve ending Merkel cell carcinoma List of keratins expressed in the human integumentary system List of human cell types derived from the germ layers Mescher, Anthony L (2016). (wikipedia.org)
  • Elevated NSE concentrations are observed in patients with neuroblastoma, pancreatic islet cell carcinoma, medullary thyroid carcinoma, pheochromocytoma, and other neuroendocrine tumors as well as in certain benign conditions. (questdiagnostics.com)
  • A multimodality approach using concurrent chemoradiotherapy (CRT) followed by esophagectomy has been the standard treatment in patients with locally advanced esophageal squamous cell carcinoma (ESCC). (bioportfolio.com)
  • Tumor Remission and tumor-infiltrating lymphocytes during chemoradiotherapy: predictive and prognostic markers in locally advanced esophageal squamous cell carcinoma. (bioportfolio.com)
  • Clinical tools are unavailable for accurately predicting the pathological responses to chemoradiotherapy (CRT) of patients with esophageal squamous cell carcinoma (ESCC) before surgery. (bioportfolio.com)
  • Histogram analysis of DCE-MRI for chemoradiotherapy response evaluation in locally advanced esophageal squamous cell carcinoma. (bioportfolio.com)
  • Lactate dehydrogenase and baseline markers associated with clinical outcomes of advanced esophageal squamous cell carcinoma patients treated with camrelizumab (SHR-1210), a novel anti-PD-1 antibody. (bioportfolio.com)
  • Squamous cell carcinoma is the most common histology in Eastern Europe and Asia, and adenocarcinoma is most common in N. (bioportfolio.com)
  • The prognosis of locally advanced esophageal squamous cell carcinoma is poor,the role of chemotherapy as neoadjuvant therapy in locally advanced esophageal cancer has been established, whi. (bioportfolio.com)
  • Broder LE, Carter SK: Pancreatic islet cell carcinoma. (springer.com)
  • What other terms have been used to refer to Merkel cell carcinoma (MCC)? (medscape.com)
  • Merkel cell carcinoma of the head and neck. (medscape.com)
  • Merkel Cell Carcinoma of the Head and Neck: Recommendations for Diagnostics and Treatment. (medscape.com)
  • Clonal integration of a polyomavirus in human Merkel cell carcinoma. (medscape.com)
  • Becker JC, Houben R, Ugurel S, Trefzer U, Pfohler C, Schrama D. MC polyomavirus is frequently present in Merkel cell carcinoma of European patients. (medscape.com)
  • Sastre-Garau X, Peter M, Avril MF, Laude H, Couturier J, Rozenberg F. Merkel cell carcinoma of the skin: pathological and molecular evidence for a causative role of MCV in oncogenesis. (medscape.com)
  • Houben R, Shuda M, Weinkam R, Schrama D, Feng H, Chang Y. Merkel cell polyomavirus-infected Merkel cell carcinoma cells require expression of viral T antigens. (medscape.com)
  • Houben R, Adam C, Baeurle A, Hesbacher S, Grimm J, Angermeyer S. An intact retinoblastoma protein-binding site in Merkel cell polyomavirus large T antigen is required for promoting growth of Merkel cell carcinoma cells. (medscape.com)
  • Type I and II IFNs inhibit Merkel cell carcinoma via modulation of the Merkel cell polyomavirus T antigens. (medscape.com)
  • Amber K, McLeod MP, Nouri K. The Merkel cell polyomavirus and its involvement in Merkel cell carcinoma. (medscape.com)
  • Oat cell carcinoma is rarely diagnosed in the head and neck and can be primary or secondary. (elsevier.com)
  • We report a 64-year-old woman with a known pancreatic oat cell carcinoma who came to the ENT Department with dysphagia. (elsevier.com)
  • On examination, a lesion was seen at the base of the tongue and was histologically an oat cell carcinoma. (elsevier.com)
  • To our knowledge, oat cell carcinoma of the tongue has not been previously reported. (elsevier.com)
  • In our centre, we diagnose a case of Large-Cell Neuroendocrine Carcinoma (LCNEC) of the, endometrium in an 82 y old female. (alliedacademies.org)
  • En este artículo se presentan dos casos clínicos de carcinoma mucoepidermoide bronquial de bajo grado, enfocado en su diagnóstico y manejo quirúrgico. (bvsalud.org)
  • Con menor frecuencia, se asienta en el árbol traqueobronquial el carcinoma mucoepidermoide. (bvsalud.org)
  • Actinic keratosis is currently believed to be an early stage in the evolution of squamous cell carcinoma. (storysteel.gq)
  • It is the most common bronchial carcinoma associated with asbestos and is more common in non-smokers, compared with other cell types. (patient.info)
  • The strongest evidence for the participation of GPC3 in carcinogenesis stems from studies on hepatocellular carcinoma and lung squamous cell carcinoma. (spandidos-publications.com)
  • To the best of our knowledge, the role of the GPC3 protein and its potential therapeutic application have never been studied in small cell lung carcinoma (SCLC), despite the known involvement of associated pathways and the high mortality caused by this disease. (spandidos-publications.com)
  • Review article--involvement of gastric APUD cells in chronic renal failure. (thefreedictionary.com)
  • Aoyagi T, Summerskill WHJ: Gastric secretion with ulcerogenic islet cell tumor: Importance of basal acid output. (springer.com)
  • Enterochromaffin-like cells or ECL cells are a type of neuroendocrine cell found in the gastric glands of the gastric mucosa beneath the epithelium , in particular in the vicinity of parietal cells , that aid in the production of gastric acid via the release of histamine . (wikipedia.org)
  • Gastrin is transferred from a specific type of G cell in the gastric epithelium to the ECL cells by blood . (wikipedia.org)
  • Mucous-secreting simple columnar cells, known as mucous surface cells, line the gastric lumen and the periodic deep depressions, known as gastric pits. (medicalhistology.us)
  • Secretin helps in regulating the pH within the duodenum by inhibiting gastric acid secretion by the parietal cells of the stomach, and by stimulating bicarbonate production by the centroacinar cells and intercalated ducts of the pancreas. (meddic.jp)
  • It was pointed out that Solcia and his colleagues (l967) described endocrine-like cells in the gastric "antrum" which were argyrophilic, but non-argentaffin in quality. (plig.org)
  • In a small series (8 gastric ulcer cases and 8 cases of duodenal ulcer with uraemia), no G cells were found in the oxyntic zone of the stomach. (plig.org)
  • In a second and larger series of cases, Stave and Brandtzaeg (l978) determined the antral density, mucosal distribution and total mass of G cells in gastric resection specimens. (plig.org)
  • In classical anatomy , the human stomach is divided into four sections, beginning at the gastric cardia , [6] each of which has different cells and functions. (howlingpixel.com)
  • often restricted to the cells of the alveolar epithelium (squamous alveolar cells and great alveolar cells) and alveolar phagocytes. (thefreedictionary.com)
  • Arias-Stella cells columnar cells in the endometrial epithelium which have a hyperchromatic enlarged nucleus and which appear to be associated with chorionic tissue in an intrauterine or extrauterine site. (thefreedictionary.com)
  • basal granular cells APUD cells located at the base of the epithelium at many places in the gastrointestinal tract. (thefreedictionary.com)
  • Histological, histochemical, electronmicroscopical and immunohistochemical investigations of last decades have demonstrated the presence of specialized cells in the digestive tract (its endodermal part) epithelium of many invertebrate species of different taxa (for references see reviews: Punin, 1986, 1993). (zin.ru)
  • In neorhabdocoelan Astrothorynchus bifundus only rare intraepithelial processes running along the basal border of epithelium (gastrodermis) were detected, while in another worm species from this order - Provortex karlingi - single small cells of closed type (situated in the basal part of gastrodermis and having no contact with intestinal lumen) were revealed too (Fig. 1, A). All these structures were observed in the beginning of intestine close to pharynx. (zin.ru)
  • In this Review, we discuss the signals, cell types and mechanisms that control homeostasis and regeneration in the intestinal epithelium. (nature.com)
  • Fig. 4: Cell specification in the intestinal epithelium. (nature.com)
  • We investigated the cell behaviors that drive morphogenesis of the Drosophila follicular epithelium during expansion and elongation of early‐stage egg chambers. (embopress.org)
  • We found that cell division is not required for elongation of the early follicular epithelium, but drives the tissue toward optimal geometric packing. (embopress.org)
  • Planar division orientation is independent of cell shape cues and spindle‐orienting machinery Mud/Pins in the proliferating Drosophila follicular epithelium. (embopress.org)
  • Canoe depletion, which prevents cells from responding to tension, disrupts planar spindle orientation in the follicular epithelium. (embopress.org)
  • The virus is present in the hollowed cells of the epithelium. (green-blog.org)
  • Single, barrel-shaped mucin-producing cell within a columnar or pseudostratified epithelium. (pathguy.com)
  • Colonic epithelium has huge numbers of goblet cells. (pathguy.com)
  • A cell in a respiratory epithelium, with microvilli on its surface, nad afferent nerve endings attached to their basal portions. (pathguy.com)
  • APUD cells in respiratory epithelium. (pathguy.com)
  • The epithelium is a typical pseudostratified ciliated columnar epithelium, with abundant goblet cells. (pathguy.com)
  • Arises from mucous cells in the bronchial epithelium. (patient.info)
  • In prenatal hamster lungs, 3H-thymidine and bromodeoxyuridine (BrdU) labeling have shown that cell division in the epithelium diminishes as a linear function of distance from differentiated NEBs. (grantome.com)
  • Follicular dendritic cells (DENDRITIC CELLS, FOLLICULAR) are also considered to be antigen-presenting cells by some authors. (slicksurface.com)
  • Serotonin producing and hence argentaffin cells have not been found. (nih.gov)
  • ABBR: APUD cell Any of the constituent cells of a diffuse neuroendocrine system, having metabolic pathways that make and utilize serotonin (5-HT). (tabers.com)
  • These tumours develop from secretory cells found throughout the body and which are particularly concentrated in the gastrointestinal system, lung, pancreas, ovary and testes.These cells are referred to as the diffuse endocrine system to separate them from the discrete endocrine organs such as pituitary, thyroid, parathyroid and adrenal glands. (unicornfoundation.org.au)
  • The diffuse endocrine system is made up of neuroendocrine cells found in the respiratory and digestive tracts. (unicornfoundation.org.au)
  • Somatostatin , also known as growth hormone-inhibiting hormone ( GHIH ) or by several other names , is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. (wikidoc.org)
  • The endocrine system is a network of glands consisting of endocrine cells that produce hormones in the body. (encyclopedia.com)
  • Metastasizing APUD cell tumours of the human gastrointestinal buy prozac 10mg tract. (binalbum.icu)
  • Neuroendocrine (NE) tumours include a heterogeneous group of neoplasms arising from NE cells, which are either present in endocrine organs or dispersed through the body, including the gastrointestinal tract, lung, kidney, ovary, testis, et al. (biomedcentral.com)
  • Filmus and Capurro ( 12 ) proposed that GPC3 could stimulate cell proliferation in tumours with a dominant influence of the Wnt signalling and inhibit proliferation in tumours with predominant Hh signalling. (spandidos-publications.com)
  • basal cell an early keratinocyte, present in the stratum basale of the epidermis. (thefreedictionary.com)
  • However, in M. lineare FMRFamide- and PP-like immunoreactivities were seemingly associated not with a separate cell type but with basal parts of gastrodermal glandular cells, and only antibodies to vasotocin reacted with different structures. (zin.ru)
  • Single processes penetrate from this plexus into gastrodermis either ending between the basal parts of gastrodermal cells or running in the direction to intestinal lumen. (zin.ru)
  • Individual cells contain secretory granules in the basal part of the cytoplasm, whereas the Golgi complex is supranuclear. (plig.org)
  • electronmicroscopy shows that they possess microvilli extending into the lumen and that secretory granules are present in the basal parts of the cells. (plig.org)
  • Absorption of vitamin B 12 from the small intestine is dependent on conjugation to a glycoprotein called intrinsic factor, which is produced by parietal cells of the stomach. (newworldencyclopedia.org)
  • Regulatory cells in the intestine of turbellarian worms and possible evolution of intestinal regulatory systems in Metazoa. (zin.ru)
  • Secretin is synthesized in cytoplasmic secretory granules of S-cells, which are found mainly in the mucosa of the duodenum, and in smaller numbers in the jejunum of the small intestine. (meddic.jp)
  • Astrocytes (from 'star' cells) are irregularly shaped with many long processes, including those with 'end feet' which form the glial (limiting) membrane and directly and indirectly contribute to the BLOOD-BRAIN BARRIER. (slicksurface.com)
  • GFAP is one of the intermediate filament proteins and is an effective marker for astrocytes and ependymal cells and their derived tumors. (green-blog.org)
  • A precursor cell that can also give rise to identical precursor cells: daughters of a stem cell can develop into a terminally-differentiated cell type or they can remain a stem cell. (thefreedictionary.com)
  • One type of cell, the pluripotent hematopoietic stem cell, lives in the marrow and gives rise to all blood cells, including some phagocytes, such as Kupffer cells, histiocytes, osteoclasts, etc. (powershow.com)
  • Daughters of a stem cell can develop into a terminally differentiated cell type, or they can remain a stem cell. (tabers.com)
  • Constant tissue replenishment is fuelled by continuously dividing stem cells that reside at the bottom of crypts. (nature.com)
  • Intestinal stem cells and early progenitor cells compete for limited niche space and, therefore, the ability to retain or regain stemness. (nature.com)
  • Tissue replenishment is fuelled by adult stem cells that divide continuously and reside sequestered away from the intestinal lumen at the bottom of crypts. (nature.com)
  • Stem cells are protected by their niche (Paneth cells and the surrounding mesenchyme) through crypt shape, antimicrobial products, a specialized metabolic environment and neutral competition for limited space. (nature.com)
  • Stemness is a state that is lost when cells leave the stem cell zone, but can also be regained when differentiated cells re-enter the niche. (nature.com)
  • This book presents an overview of a new group of progenitor stem cells. (springer.com)
  • The distribution of these cells can result in a large quantity of ectopic stem cells. (springer.com)
  • The observation of these ectopic stem cells leads us to postulate the existence of a basic wave of stem cell progenitors. (springer.com)
  • This first wave of progenitor stem cell migration initially reaches the peri-aortal AMG-region ( A ortal- M esonephric- G onadal region). (springer.com)
  • From here, some of these progenitor cells enter the aorta, are distributed through the vascular system and become the embryonal stem cells (reserve cells) in many peripheral tissues. (springer.com)
  • During this migration process the stem cells develop into their final state. (springer.com)
  • In the adrenal cortex the ingrowing nerves guide the stem cells to the adrenal medulla. (springer.com)
  • In the pancreas the ingrowing nerve fibers guide the stem cells to the islets. (springer.com)
  • These newly detected stem cells represent a specific developmental step which is found only in humans. (springer.com)
  • Although the term islet cell tumor is often used to identify neoplasms of the endocrine pancreas, this is a misnomer because many pancreatic neuroendocrine tumors do not develop directly from islet cells. (medscape.com)
  • Primary renal neuroendocrine tumors are among the most unusual of all renal neoplasms, since neuroendocrine cells are not found within normal renal parenchyma. (biomedcentral.com)
  • B cells B lymphocytes . (thefreedictionary.com)
  • T and B cells become effector lymphocytes and memory cells. (powershow.com)
  • Various cell subpopulations, often B-lymphocytes, can be defined, based on the different classes of immunoglobulins that they synthesize. (slicksurface.com)
  • They are short-lived cells resembling bursa-derived lymphocytes of birds in their production of immunoglobulin upon appropriate stimulation. (slicksurface.com)
  • T lymphocytes have a receptor that recognizes proteins that are found inside the cell. (doctortipster.com)
  • diagnostic test of the orbital canada pharmacy online coupon code cavity oft concedes nonspecicevidence of blubbery inltration by lymphocytes, chalcedony cells,and eosinophils. (fredwhittonchallenge.co.uk)
  • Enteroendocrine cells are specialized endocrine cells of the gastrointestinal tract . (wikidoc.org)
  • the technique of immunocytochemistry shows the precise localization of the cells in the walls of the gastrointestinal tract. (plig.org)
  • The tumour contains dense core granules similar to the argentaffin cell granules of the gastrointestinal tract and actively secretes hormones and hormone like products. (gpnotebook.com)
  • [2] . Enteroendocrine cells are also found in the duodenum . (wikidoc.org)
  • It is produced in the S cells of the duodenum, which are located in the crypts of Lieberkühn. (meddic.jp)
  • less important sources are G cells in the duodenum, D cells in the islands of Langerhans in the pancreas, and isolated G cells in the proximal acid producing region of the fornix and body of the stomach. (plig.org)
  • By means of immunohistochemical methods these authors attempted a systematic mapping of the numerical distribution of G cells in the human stomach and duodenum in specimens resected for peptic ulcer. (plig.org)
  • The first part of the duodenum contained considerably fewer G cells than the "antrum", and the numbers in the duodenum were virtually equal in the two groups. (plig.org)
  • Somatostatin is secreted by delta cells at several locations in the digestive system, namely the pyloric antrum , the duodenum and the pancreatic islets . (wikidoc.org)
  • These hormones, including gastrin, secretin, cholecystokinin, and grehlin, are mediated through either intracrine or autocrine mechanisms, indicating that the cells releasing these hormones are conserved structures throughout evolution. (thefullwiki.org)
  • APUD cells [ a mine p recursor u ptake and d ecarboxylation] a group of cells that manufacture polypeptides and biogenic amines serving as hormones or neurotransmitters. (thefreedictionary.com)
  • These cells are stimulated by the hormones gastrin (not depicted in the adjacent diagram) and pituitary adenylyl cyclase-activating peptide . (wikipedia.org)
  • Enterochromaffin-like cells also produce pancreastatin and probably other peptide hormones and growth factors . (wikipedia.org)
  • Neuroendocrine tumors (NETs) possess unique features including expression of peptide hormone receptors as well as the capacity to concentrate and take up precursor forms of amines and peptides making hormones that are stored in secretory granules within the tumor cells (APUD). (thno.org)
  • 2 ] A unique feature of NET is the APUD characteristics which means that they concentrate and take up amino acids and precursors and produce hormones that are stored in secretory granules within the tumor cells. (thno.org)
  • APUD cells manufacture polypeptides and amines which act as hormones or neurotransmitters. (patient.info)
  • The term neuroendocrine implies that these cells have received some nervous connections (neuro-) and the cells have the ability to secrete hormones (endocrine). (unicornfoundation.org.au)
  • All the enteroendocrine cells are argyrophilic and differ mainly in the size and shape of their secretory granules. (nih.gov)
  • Tumors whose cells possess secretory granules and originate from the neuroectoderm, i.e., the cells of the ectoblast or epiblast that program the neuroendocrine system. (umassmed.edu)
  • Bowie stain, a stain used to demonstrate the slightly basophilic cytoplasm and the specific granules of juxtaglomerular cells. (tripod.com)
  • The enteroendocrine cells (APUD) present an increased number of granules and organelles in the cytoplasm. (rjme.ro)
  • These tumors are characterized by the presence of cells that possess secretory granules and have the ability to secrete neurohormones. (encyclopedia.com)
  • for mammalian cells, typical internal concentrations include 140 mM K+, 5-15 mM Na+, 5-15 mM Cl-, and a pH of 7.2, which can be significantly different from their concentrations outside the cell. (thefreedictionary.com)
  • illustration Individual mammalian cells are usually microscopic, typically ranging from 5 µm to 50 µm in diameter. (thefreedictionary.com)
  • In mammalian skin, they are clear cells found in the stratum basale (at the bottom of sweat duct ridges) of the epidermis approximately 10 μm in diameter. (wikipedia.org)
  • For mammalian cells, typical internal concentrations include 140 mM K+, 5 to 15 mM Na+, 5 to 15 mM Cl-, and a pH of 7.2, which can be significantly different from their concentrations outside the cell. (tabers.com)
  • Small-granule cells/neuroepithelial bodies (NEBs) are peptide-producing paracrine receptor-effectors dispersed throughout airways of mammalian lungs from fetal life into old age. (grantome.com)
  • MSI-1 (GIWKFLKKAKKFWK-NH2), a cationic antimicrobial peptide, may be an attractive antifungal agent because of its structural characteristics, perfect stability against pH and high-temperature/salt, low toxicity towards mammalian cells and low potential for emergence of drug tolerance. (bvsalud.org)
  • Scanty argyrophil cells are present in a substantial proportion of normal endometria, particularly during the secretory stage of the cycle. (bmj.com)
  • A malignant cancer that begins in cells that line certain internal organs and that have glandular (secretory) properties. (carcinoid.org)
  • In all three types, the glands contain mucous neck cells and enteroendocrine (APUD) cells at the isthmus and bases respectively. (redorbit.com)
  • The esophageal glands proper are primarily mucous secreting but also have some serous cells. (brainscape.com)
  • The mucous surface cells differ from goblet cells both in their appearance and in the type of mucous they secrete. (medicalhistology.us)
  • 1. any of the protoplasmic masses making up organized tissue, consisting of a nucleus surrounded by cytoplasm enclosed in a cell or plasma membrane. (thefreedictionary.com)
  • Blastoma refers to a neoplasm that consists of immature, undifferentiated cells derived from the blastema of an organ or tissue. (ebscohost.com)
  • The Ectoderm gives rise to cells that form tissue of organs that are exposed to the external environment. (hpathy.com)
  • pmid: 28845791] the value of intravenous tration of tissues load in peripheral tissue, including tion (apud) cell system of the wound will not produce more toxicity than more rapid infusion, hoch5 administration of systemic corticosteroids or by ally applied once daily, but in no clear consensus as long as the antireflux mechanism for neobladder.23 with a sterile folliculitis that pres- ing in hyperuricemia and hypokalemia with a. (wsradio.com)
  • We examined the orientation of cell divisions with respect to the planar tissue axis and found a bias toward the primary direction of tissue expansion. (embopress.org)
  • Hertwig's rule, which holds that cell elongation determines division orientation, is therefore broken in this tissue. (embopress.org)
  • Inhibition of cell division does not affect growth and elongation of the egg chamber, but interferes with optimal geometric packing of the tissue. (embopress.org)
  • Planar division orientation is biased in the direction of tissue expansion, not interphase cell shape. (embopress.org)
  • The present invention relates to methods of enriching for desired cell population from cell sources, such as body fluids, dispersed tissue specimens and cultured cells. (freepatentsonline.com)
  • NET cancers develop when these specialized cells undergo changes causing them to divide uncontrollably and grow into an abnormal tissue mass (tumour). (unicornfoundation.org.au)
  • This edition includes over 100 new illustrations, more Clinical Correlation boxes on the histology of common medical conditions, and new information on the molecular biology of endothelial cell function. (google.com)
  • 6.02 - Merkel Cells", The Senses: A Comprehensive Reference, New York: Academic Press, pp. 33-38, doi:10.1016/b978-012370880-9.00341-8, ISBN 978-0-12-370880-9, retrieved 2020-10-22 Anatomy, Physiology, Histology, and Immunohistochemistry of Human Skin. (wikipedia.org)
  • Alpha cell of the pancreas. (thefreedictionary.com)
  • A cell present in the acinus of an acinous gland, e.g., of the pancreas. (thefreedictionary.com)
  • dePeyster FA: Planning the appropriate operations for islet cell tumors of the pancreas. (springer.com)
  • Neuroendocrine cells are also located in the discrete endocrine glands of adrenals, pancreas, thyroid and pituitary. (unicornfoundation.org.au)
  • Intravenous albumin con- to be at increased risk of com- (tall-cell, columnar cell, and 716 part vi testis figure 27-1 embryologic origin of any between the psoas muscle in the figure are the patients of airflow obstruction, arterial blood gas analysis if respiratory failure vival: Median survival greater than 110 mg orally daily). (aestheticscienceinstitute.edu)
  • 1. An enteroendocrine cell that produces glucagon and is found in the pancreatic islets. (thefreedictionary.com)
  • acinar cell , acinic cell , acinous cell any of the cells lining an acinus, especially the zymogen-secreting cells of the pancreatic acini. (thefreedictionary.com)
  • [ 1 ] In 1927, Wilder et al described the first hormone-producing pancreatic tumor syndrome in a patient with hypoglycemia and a metastatic islet cell tumor, extracts of which caused hypoglycemia. (medscape.com)
  • 1984). In the last species bovine pancreatic polypeptide (PP)- and vasotocin-immunoreactive cells were revealed too (Reuter & Palmberg, 1987). (zin.ru)
  • Because they can occur wherever neuroendocrine cells are found, neuroendocrine tumors come in a wide variety of types and have been classified according to their site of origin, usually either as digestive system , pancreatic or lung neuroendocrine tumors. (encyclopedia.com)
  • Functionally active neuroendocrine tumors display specific symptoms, such as the excessive release of specific neurohormones from the tumor cell, as described above for pancreatic neuroendocrine tumors. (encyclopedia.com)
  • Giant-cell carcinomas have been reported to be diagnosed in a significantly younger population than all non-small-cell carcinomas considered as a group. (wikipedia.org)
  • For several decades, primary lung cancers were consistently dichotomously classified for treatment and research purposes into small-cell lung carcinomas (SCLCs) and non-small-cell lung carcinomas (NSCLCs), based on an oversimplified approach that is now clearly outmoded. (wikipedia.org)
  • A group of carcinomas which share a characteristic morphology, often being composed of clusters and trabecular sheets of round "blue cells", granular chromatin, and an attenuated rim of poorly demarcated cytoplasm. (bioportfolio.com)
  • Kassem A, Schopflin A, Diaz C, Weyers W, Stickeler E, Werner M. Frequent detection of Merkel cell polyomavirus in human Merkel cell carcinomas and identification of a unique deletion in the VP1 gene. (medscape.com)
  • Detection of Merkel cell polyomavirus in Merkel cell carcinomas and small cell carcinomas by PCR and immunohistochemistry. (medscape.com)
  • Iwasaki T, Matsushita M, Kuwamoto S, Kato M, Murakami I, Higaki-Mori H. Usefulness of significant morphologic characteristics in distinguishing between Merkel cell polyomavirus-positive and Merkel cell polyomavirus-negative Merkel cell carcinomas. (medscape.com)
  • Large-cell carcinomas metastasise early. (patient.info)
  • It is highly expressed in medullary thyroid cancer (MTC) and small cell lung cancer (SCLC) and may be a useful marker for these cancers. (atlasgeneticsoncology.org)
  • The management guidelines summary for small-cell lung cancers (SCLCs) and non-small-cell lung cancers (NSCLCs) in this article are taken from the guidelines published by the National Institute for Health and Care Excellence (NICE) in April 2011 [ 1 ] . (patient.info)
  • Cytotoxicity was analysed by treating liver cancer (HepG2, SNU‑398 and SNU‑449) and lung cancer (NCI‑H510A, NCI‑H446, A549 and SK‑MES1) cell lines with hGC33‑PE38 and estimating viable cells number. (spandidos-publications.com)
  • The results showed that the immunoreactive positive cells in the body of the Z 1-Z 5,M and L of E. Sinensis were not found;9 kinds of antisera immunoreaction of nerve fiber protein,insulin,vasoactive intestinal polypeptide,calcitonin,5-hydroxytriptamine,calcitonin gene related peptide,growth hormone,calmodulin and molting hormone were found in the different parts of digestive system of E. Sinensis adult except hindgut. (cnki.com.cn)
  • The endodermal origin of digestive and respiratory tract APUD cells. (meta.org)
  • While having some differences in morphology, these cells possess one common feature - they do not directly participate in digestive processes obviously playing a regulatory, integrating role. (zin.ru)
  • A definition of the medical term "chromaffinoma" is presented, which refers to a chromaffin cell tumor. (ebscohost.com)
  • Hürthle cell tumor. (ebscohost.com)
  • A definition of the medical term "Hürthle cell tumor" is presented, which refers to a benign or malignant tumor of the thyroid gland. (ebscohost.com)
  • The term refers to a tumor containing muscle cells. (ebscohost.com)
  • Frequency and number of neuroendocrine tumor cells in Prostate cancer: no difference between radical Prostatectomy specimens from patients with and without neoadjuvant hormonal therapy," The Prostate , vol. 67, no. 6, pp. 645-652, 2007. (hindawi.com)
  • Common properties across most neuroendocrine tumors include ectopic hormone production (often via APUD CELLS), the presence of tumor-associated antigens, and isozyme composition. (umassmed.edu)
  • It exists not only in nerve cells and their axons, but also in various endocrine cells and their associated tumor cells. (green-blog.org)
  • The expression of somatostatin receptors on tumor cells have been widely explored during the last two decades starting with 111 In-DTPA-Octreotide as an imaging agent followed by 68 Ga-DOTATOC/TATE positron emission tomography scanning. (thno.org)
  • Another unique feature of NETs is the expression of different receptors on the tumor cells not only typical growth regulating factor receptors such as VEGF, IGF, EGF and so forth, but peptide hormone receptors such as somatostatin receptors as well as CCK receptors, GRP receptors and so forth. (thno.org)
  • Somatostatin is then carried to the anterior pituitary gland , where it inhibits the secretion of growth hormone from somatotrope cells. (wikidoc.org)
  • Type II cells secrete pulmonary surfactant. (thefreedictionary.com)
  • For example, the G cells (which secrete gastrin ) are located primarily in the stomach . (wikidoc.org)
  • Type II cells, which are smaller and more numerous than Type I cells, secrete pulmonary surfactant. (tabers.com)
  • ECL cells synthesize and secrete histamine . (wikipedia.org)
  • this causes the G cells to secrete gastrin, which in turn stimulates ECL cells to release histamine. (wikipedia.org)
  • A definition of the medical term "Hürthle cells" is presented, which refers to large granular cells found in pathological sections in some thyroid diseases. (ebscohost.com)
  • APUD cells (DNES cells) constitute a group of apparently unrelated endocrine cells, which were named by the scientist A.G.E. Pearse, who developed the APUD concept in the early 1960s. (wikipedia.org)
  • [ 12 ] Pearse first used the term APUD in 1968 to unify a group of functionally and structurally similar neuroendocrine cells that are present throughout the body. (medscape.com)
  • Bussolati and Pearse (l970), using immunofluorescent and silver techniques, showed that these two types of cell were the same. (plig.org)
  • Histamine and gastrin act synergistically as the most important stimulators of hydrochloric acid secretion from parietal cells and stimulators of secretion of pepsinogen from chief cells . (wikipedia.org)
  • In the stomach, somatostatin acts directly on the acid-producing parietal cells via a G-protein coupled receptor (which inhibits adenylate cyclase, thus effectively antagonising the stimulatory effect of histamine) to reduce acid secretion. (wikidoc.org)
  • Only a few and small goblet cells could be observed in this segment, moreover, APUD cells were not seen. (thefreedictionary.com)
  • It's the barrel-shape that makes it a goblet cell. (pathguy.com)
  • terminal bronchioles lack goblet cells). (pathguy.com)
  • Classic Fat, identified in Drosophila , is known to regulate cell proliferation and planar cell polarity. (biologists.org)
  • It is a marker of the cell proliferation cycle, especially the "S" phase. (green-blog.org)
  • Glypican‑3 (GPC3) is a cell membrane glycoprotein that regulates cell growth and proliferation. (spandidos-publications.com)
  • 18F]FLT is a reliable PET of cell proliferation. (engii.org)
  • The characteristic feature of this highly lethal malignancy is the distinctive light microscopic appearance of its extremely large cells, which are bizarre and highly pleomorphic, and which often contain more than one huge, misshapen, pleomorphic nucleus ("syncytia"), which result from cell fusion. (wikipedia.org)
  • Anichkov's cell a plump modified histiocyte in the inflammatory lesions of the heart (Aschoff bodies) characteristic of rheumatic fever. (thefreedictionary.com)
  • T-cells- originate in the bone marrow and travel to the thymus in the youngster to differentiate. (powershow.com)
  • B-cells originate in the bone marrow, MALT, spleen. (powershow.com)
  • Gastrin producing G cells originate from neuroectoderm together with other cells of the APUD series. (plig.org)
  • Adenohypophysis Neurons of Hypothalamus C-cells of Thyroid Chief Cells of Parathyroid Adrenal Medullary Cells Glomus cells in Carotid Body Melanocytes of Skin Cells of Pineal Gland Renin producing cells in Kidney Apudoma Enteroendocrine cell Neuroendocrine cell List of human cell types derived from the germ layers Welbourn RB (January 1977). (wikipedia.org)
  • amacrine cell any of five types of retinal neurons that seem to lack large axons, having only processes that resemble dendrites. (thefreedictionary.com)
  • neurons to generate persistent firing through cell-autonomous biophysical mechanisms. (jneurosci.org)
  • According to their gross and fine structure some of these "regulatory" cells can be regarded as endocrine while others closely correspond to neurons. (zin.ru)
  • They are also considered a type of enteroendocrine cell . (wikipedia.org)
  • As with each part of a living organism ( cells , tissues , glands , systems, etc.), the stomach interacts harmoniously with other parts of the body to keep the organism functioning. (newworldencyclopedia.org)
  • Neuroendocrine tumors are tumors that develop from the cells of the diffuse neuroendocrine system, such as the enterochromaffin (EC) cells. (encyclopedia.com)
  • They are composed of CYTOPLASM containing various ORGANELLES and a CELL MEMBRANE boundary. (slicksurface.com)
  • The parietal (oxyntic) cells show in their apical cytoplasm wide dilatations of the intracellular canalicles, vesicles, a reduced number of organelles and irregular nuclei. (rjme.ro)
  • Neuroendocrine tumors (NETs) are a diverse group of malignancies deriving from the diffuse neuroendocrine cell system with localisation almost everywhere in the human body. (thno.org)
  • basic stain, one that is basic in reaction and shows an affinity for the nuclei of cells. (tripod.com)
  • nuclear stain, one that has a special affinity for the nuclei of cells. (tripod.com)
  • oat cell tumour - characterised by uniform small - to - medium sized, closely packed cells arranged in strands, clusters, or singly, with dark-staining nuclei and a high nuclear:cytoplasmic ratio. (gpnotebook.com)