No data available that match "antigens cd38"


Purification and characterization of ADP-ribosyl cyclase from Euglena gracilis. (1/936)

ADP-ribosyl cyclase, which catalyzes the conversion from NAD+ to cyclic adenosine diphosphoribose (cADPR), is proposed to participate in cell cycle regulation in Euglena gracilis. This enzyme, which was found as a membrane-bound protein, was purified almost the homogeneity after solubilization with deoxycholate, and found to be a monomeric protein with a molecular mass of 40 kDa. Its Km value for NAD+ was estimated to be 0.4 mM, and cADPR, a product of the enzyme, inhibited the enzyme competitively with respect to NAD+ whereas another product, nicotinamide, showed noncompetitive (mixed-type) inhibition. In contrast to mammalian CD38 and BST-1, Euglena ADP-ribosyl cyclase lacked cADPR hydrolase activity.  (+info)

Characterization of viral dynamics in human immunodeficiency virus type 1-infected patients treated with combination antiretroviral therapy: relationships to host factors, cellular restoration, and virologic end points. (2/936)

Biphasic plasma viral decays were modeled in 48 patients treated with ritonavir, zidovudine, and lamivudine. Estimated first- and second-phase decay rates were d1 as 0.47/day and d2 as 0.04/day. Interpatient differences in both decay rates were significant. The d1 was directly correlated with baseline CD4+, CD4+CD28+, and CD8+CD28+ T lymphocyte counts (P<.05) and inversely correlated with baseline virus load (P=.044) and the magnitude of CD4+ and CD8+ T lymphocyte recovery (P<.01). The d2 was directly correlated with baseline percentage of CD8+ T lymphocytes (P=.023), the CD8+CD38+ cell number (P=.024), and the level of IgG that binds to human immunodeficiency virus (HIV) type 1 gp120 (P=.02). Viral decay rates were not predictive of treatment failure or durability of viral suppression. These exploratory findings are consistent with a model in which immunologic factors contribute to elimination of HIV-infected cells and suggest a dynamic interplay between regulation of HIV expression and lymphocyte activation and recovery.  (+info)

Shorter survival in advanced human immunodeficiency virus type 1 infection is more closely associated with T lymphocyte activation than with plasma virus burden or virus chemokine coreceptor usage. (3/936)

To define predictors of survival time in late human immunodeficiency virus type 1 (HIV-1) disease, long- and short-duration survivors were studied after their CD4+ T cells fell to +info)

IL-5 induces IgG1 isotype switch recombination in mouse CD38-activated sIgD-positive B lymphocytes. (4/936)

Mouse B cells express CD38, whose ligation by anti-CD38 Ab induces their proliferation and protection from apoptosis. We previously showed that stimulation of mouse splenic B cells with IL-5 together with CS/2, an anti-mouse CD38 mAb, induces production of IgG1 and IgM. Here we examined the role of IL-5 and CS/2 in the expression of germline gamma1 transcripts and the generation of reciprocal products forming DNA circles as byproducts of mu-gamma1 switch recombination. By itself, CS/2 induced significant expression of germline gamma1 transcripts in splenic naive B cells, whereas IL-5 neither induced nor enhanced germline gamma1 expression. Increased cellular content of reciprocal product, which is characteristic of mu-gamma1 recombination, was not observed after culturing B cells with CS/2, but increased reciprocal product, along with high levels of lgG1 secretion, was found when B cells were cultured with CS/2 plus IL-5. Although IL-4 did not, by itself, induce mu-gamma1 recombination in B cells stimulated with CS/2, in conjunction with CS/2 plus IL-5, IL-4 dramatically enhanced sterile gamma1 transcription and IgG1 production. These results demonstrate that CD38 ligation induces only germline gamma1 transcription and that IL-5 promotes both mu-gamma1 switch recombination and lgG1 secretion in an IL-4-independent manner.  (+info)

Stable transduction of quiescent CD34(+)CD38(-) human hematopoietic cells by HIV-1-based lentiviral vectors. (5/936)

We compared the efficiency of transduction by an HIV-1-based lentiviral vector to that by a Moloney murine leukemia virus (MLV) retroviral vector, using stringent in vitro assays of primitive, quiescent human hematopoietic progenitor cells. Each construct contained the enhanced green fluorescent protein (GFP) as a reporter gene. The lentiviral vector, but not the MLV vector, expressed GFP in nondivided CD34(+) cells (45.5% GFP+) and in CD34(+)CD38(-) cells in G0 (12.4% GFP+), 48 hr after transduction. However, GFP could also be detected short-term in CD34(+) cells transduced with a lentiviral vector that contained a mutated integrase gene. The level of stable transduction from integrated vector was determined after extended long-term bone marrow culture. Both MLV vectors and lentiviral vectors efficiently transduced cytokine-stimulated CD34(+) cells. The MLV vector did not transduce more primitive, quiescent CD34(+)CD38(-) cells (n = 8). In contrast, stable transduction of CD34(+)CD38(-) cells by the lentiviral vector was seen for over 15 weeks of extended long-term culture (9.2 +/- 5.2%, n = 7). GFP expression in clones from single CD34(+)CD38(-) cells confirmed efficient, stable lentiviral transduction in 29% of early and late-proliferating cells. In the absence of growth factors during transduction, only the lentiviral vector was able to transduce CD34(+) and CD34(+)CD38(-) cells (13.5 +/- 2.5%, n = 11 and 12.2 +/- 9.7%, n = 4, respectively). The lentiviral vector is clearly superior to the MLV vector for transduction of quiescent, primitive human hematopoietic progenitor cells and may provide therapeutically useful levels of gene transfer into human hematopoietic stem cells.  (+info)

The metamorphosis of a molecule: from soluble enzyme to the leukocyte receptor CD38. (6/936)

Human CD38 is a 45-kDa type II membrane glycoprotein with an intricate pattern of expression in leukocytes, although evidence is accumulating of its quite widespread expression in cells of nonvascular origin. CD38 is a member of a nascent eukaryotic gene family encoding cytosolic and membrane-bound enzymes whose substrate is NAD, a coenzyme ubiquitously distributed in nature. Functionally, CD38 is an eclectic molecule with the ability not only to catalyze but also to signal, to mobilize calcium, and to adhere to itself, to hyaluronan, and to other ligands. Interaction with CD38 on various leukocyte subpopulations has profound though diverse consequences on their life-span, but these effects seem to be independent of the enzymatic activity of the molecule. CD38 challenges our expectations of a surface molecule and we must sift through its many guises to unmask its true nature.  (+info)

Evidence of a role for cyclic ADP-ribose in long-term synaptic depression in hippocampus. (7/936)

Ca2+ released from presynaptic and postsynaptic intracellular stores plays important roles in activity-dependent synaptic plasticity, including long-term depression (LTD) of synaptic strength. At Schaffer collateral-CA1 synapses in the hippocampus, presynaptic ryanodine receptor-gated stores appear to mobilize some of the Ca2+ necessary to induce LTD. Cyclic ADP-ribose (cADPR) has recently been proposed as an endogenous activator of ryanodine receptors in sea urchin eggs and several mammalian cell types. Here, we provide evidence that cADPR-mediated signaling pathways play a key role in inducing LTD. We show that biochemical production of cGMP increases cADPR concentration in hippocampal slices in vitro, and that blockade of cGMP-dependent protein kinase, cADPR receptors, or ryanodine-sensitive Ca2+ stores each prevent the induction of LTD at Schaffer collateral-CA1 synapses. A lack of effect of postsynaptic infusion of either cADPR antagonist indicates a probable presynaptic site of action.  (+info)

Expression of CD28 and CD38 by CD8+ T lymphocytes in HIV-1 infection correlates with markers of disease severity and changes towards normalization under treatment. The Swiss HIV Cohort Study. (8/936)

The relationship between blood CD8+ T lymphocyte subsets, as defined by CD28 and CD38 expression, and plasma viraemia and CD4+ T cells in HIV-1 infection was investigated. In a cross-sectional study of 46 patients with either no or stable anti-retroviral treatment, there was a strong negative correlation between the percentage of CD8+CD28- and the percentage of CD4+ T cells (r = -0.75, P < 0.0001), and a positive correlation between absolute numbers of CD8+CD28+ and CD4+ T cells (r = 0.56, P < 0.0001). In contrast, the expression of CD38 by CD8+ T lymphocytes correlated primarily with plasma viraemia (e.g. the percentage of CD38+ in CD8bright cells, r = 0.76, P < 0.0001). In the 6 months following triple therapy initiation in 32 subjects, there was a close correlation between changes (delta) in CD8+CD28+ or CD8+CD28- and in CD4+ T cells (e.g. delta % CD8+CD28+ versus delta % CD4+, r = 0.37, P = 0.0002; delta % CD8+CD28- versus delta % CD4+, r = -0.66, P < 0.0001). A marked decline of the number of CD8+ T cells expressing CD38 was also observed. These results suggest the existence of a T cell homeostasis mechanism operating in blood with CD4+ and CD8+CD28+ cells on the one hand, and with CD8+CD28- cells on the other. In addition, the percentage of CD38+ cells in CD8+ cells, generally considered an independent prognostic factor, could merely reflect plasma viral load.  (+info)

*BST1

"Entrez Gene: BST1 bone marrow stromal cell antigen 1". Human BST1 genome location and BST1 gene details page in the UCSC Genome ... 2003). "CD157, the Janus of CD38 but with a unique personality". Cell Biochem. Funct. 20 (4): 309-22. doi:10.1002/cbf.978. PMID ... 1996). "Elevated levels of the soluble form of bone marrow stromal cell antigen 1 in the sera of patients with severe ... The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell ...

*Daratumumab

CD38 is overexpressed in multiple myeloma cells. Daratumumab binds to CD38, causing cells to apoptose via antibody-dependent ... Fortunately, the only antigen system affected that is associated with common, clinically significant antibodies is Kell, making ... It binds to CD38, which multiple myeloma cells overexpress. Daratumumab was originally developed by Genmab, but it is now being ... If antibody screen is positive, give specific antigen negative blood. The incompatibility may persist for up to 6 months after ...

*List of MeSH codes (D08)

... antigens, cd38 MeSH D08.811.277.450.770 --- oligo-1,6-glucosidase MeSH D08.811.277.450.770.800 --- sucrase-isomaltase complex ... antigens, cd13 MeSH D08.811.277.656.350.555.200 --- carboxypeptidase b MeSH D08.811.277.656.350.555.250 --- carboxypeptidase h ... antigens, cd13 MeSH D08.811.277.656.675.555.200 --- carboxypeptidase b MeSH D08.811.277.656.675.555.250 --- carboxypeptidase h ... antigens, cd45 MeSH D08.811.277.352.650.625.700.200 --- cdc25 phosphatase MeSH D08.811.277.352.650.625.725 --- pyruvate ...

*List of MeSH codes (D23)

... antigens, cd34 MeSH D23.050.301.264.035.136 --- antigens, cd36 MeSH D23.050.301.264.035.138 --- antigens, cd38 MeSH D23.050. ... antigens, cd34 MeSH D23.101.100.110.136 --- antigens, cd36 MeSH D23.101.100.110.138 --- antigens, cd38 MeSH D23.101.100.110.140 ... hla-a antigens MeSH D23.050.301.500.450.370.372 --- hla-a1 antigen MeSH D23.050.301.500.450.370.374 --- hla-a2 antigen MeSH ... hla-b antigens MeSH D23.050.301.500.450.380.383 --- hla-b7 antigen MeSH D23.050.301.500.450.380.385 --- hla-b8 antigen MeSH ...

*CD38

... Antigens at the US National Library of Medicine Medical Subject Headings (MeSH) Human CD38 genome location and CD38 gene ... 1995). "Assignment of CD38, the gene encoding human leukocyte antigen CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase), ... In humans, the CD38 protein is encoded by the CD38 gene which is located on chromosome 4. CD38 is a multifunctional ectoenzyme ... "Entrez Gene: CD38 CD38 molecule". Jackson DG, Bell JI (April 1990). "Isolation of a cDNA encoding the human CD38 (T10) molecule ...

*CD38

"Assignment of CD38, the gene encoding human leukocyte antigen CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase), to ... "Entrez Gene: CD38 CD38 molecule".. *^ Jackson DG, Bell JI (April 1990). "Isolation of a cDNA encoding the human CD38 (T10) ... CD38 has been used as a prognostic marker in leukemia.[15] CD38 is also used as a target for daratumumab (Darzalex), a medicine ... In humans, the CD38 protein is encoded by the CD38 gene which is located on chromosome 4.[7][8] ...

*Multiple myeloma

However, this antigen disappears rapidly ex vivo. Recently, however, it was discovered that the surface antigen CD319 (SLAMF7) ... CD38, CD138, CD319 positive and CD19 and CD45 negative.[citation needed] Cytogenetics may also be performed in myeloma for ... a monoclonal antibody against CD38 indicated for the treatment of patients with multiple myeloma who have received at least ...

*Nicholas Chiorazzi

Distinct sets of stereotyped antigen receptors indicate the limited primary structural diversity in antigen-binding sites of ... Damle RN, Temburni S, Calissano C, Yancopoulos S, Banapour T, Sison C, Allen SL, Rai KR, Chiorazzi N. (2007) CD38 expression ... These findings have led to the view that (auto)antigen drive is a promoting factor in the development and evolution of CLL and ... Chiorazzi N, Ferrarini M. (2003) B Cell Chronic Lymphocytic Leukemia: Lessons learned from studies of the B cell antigen ...

*CD34

Antigens, CD34 at the US National Library of Medicine Medical Subject Headings (MeSH) Mouse CD Antigen Chart Human CD Antigen ... Cells observed as CD34+ and CD38- are of an undifferentiated, primitive form; i.e., they are multipotential hemopoietic stem ... Hematopoietic progenitor cell antigen CD34 also known as CD34 antigen is a protein that in humans is encoded by the CD34 gene. ... A hematopoietic progenitor cell surface antigen defined by a monoclonal antibody raised against KG-1a cells". Journal of ...

*CD31

Human CD Antigen Chart (eBioscience) Mouse CD Antigen Chart (eBioscience) Human PECAM1 genome location and PECAM1 gene details ... Deaglio S, Morra M, Mallone R, Ausiello CM, Prager E, Garbarino G, Dianzani U, Stockinger H, Malavasi F (1998). "Human CD38 ( ... Malignant endothelial cells also commonly retain the antigen, so that CD31 immunohistochemistry can also be used to demonstrate ... a putative intercellular adhesion molecule closely related to carcinoembryonic antigen". J. Exp. Med. 171 (6): 2147-52. doi: ...

*IMP321

The investigators for this work used influenza matrix protein antigen and the tumor antigens Melan-A/MART-1 and survivin when ... The 8 patients experienced a sustained CD8+ T-cell activation (as measured by percentage of CD8+ cells expressing CD69, CD38 ... Subjects who got IMP321 had higher levels of HBsAg antibody in their blood as well as higher levels of antigen-specific T cells ... An April 2006 paper in Cancer Research showed, in vitro, that IMP321 would induce an antigen-specific CD8+ T-cell response in ...

*CD34

Hematopoietic progenitor cell antigen CD34 also known as CD34 antigen is a protein that in humans is encoded by the CD34 gene.[ ... Cells observed as CD34+ and CD38- are of an undifferentiated, primitive form; i.e., they are multipotential hemopoietic stem ... A hematopoietic progenitor cell surface antigen defined by a monoclonal antibody raised against KG-1a cells". Journal of ... Antigens, CD34 at the US National Library of Medicine Medical Subject Headings (MeSH) ...

*Dipeptidyl peptidase-4

"Direct association of adenosine deaminase with a T cell activation antigen, CD26". Science. 261 (5120): 466-9. doi:10.1126/ ... plasma cell: CD38. *CD138. T/NK. T cell. *Pan-T antigens: CD3 ...

*CD4

... is a co-receptor of the T cell receptor (TCR) and assists the latter in communicating with antigen-presenting cells. The ... Leucocyte typing: human leucocyte differentiation antigens detected by monoclonal antibodies: specification, classification, ... T cells displaying CD4 molecules (and not CD8) on their surface, therefore, are specific for antigens presented by MHC II and ... CD1+Antigen at the US National Library of Medicine Medical Subject Headings (MeSH) ...

*CD64 (biology)

CD64+Antigens at the US National Library of Medicine Medical Subject Headings (MeSH) ... plasma cell: CD38. *CD138. T/NK. T cell. *Pan-T antigens: CD3 ...

*CD15

It is also called Lewis x and SSEA-1 (stage-specific embryonic antigen 1) and represents a marker for murine pluripotent stem ... CD15 Antigen at the US National Library of Medicine Medical Subject Headings (MeSH) ... CD15 (3-fucosyl-N-acetyl-lactosamine) is a cluster of differentiation antigen - an immunologically significant molecule. CD15 ... plasma cell: CD38. *CD138. T/NK. T cell. *Pan-T antigens: CD3 ...

*Antibody-dependent cellular cytotoxicity

Usually, a target cell line expressing a certain surface-exposed antigen is incubated with antibody specific for that antigen. ... "Daratumumab: a first-in-class CD38 monoclonal antibody for the treatment of multiple myeloma". J Hematol Oncol. 9 (1): 51. doi ... whose membrane-surface antigens have been bound by specific antibodies.[1] It is one of the mechanisms through which antibodies ... "Daratumumab, a novel therapeutic human CD38 monoclonal antibody, induces killing of multiple myeloma and other hematological ...

*Antibody-dependent cell-mediated cytotoxicity

Usually, a target cell line expressing a certain surface-exposed antigen is incubated with antibody specific for that antigen. ... Sanchez, L; Wang, Y; Siegel, DS (2016). "Daratumumab: a first-in-class CD38 monoclonal antibody for the treatment of multiple ... 2011). "Daratumumab, a novel therapeutic human CD38 monoclonal antibody, induces killing of multiple myeloma and other ... whose membrane-surface antigens have been bound by specific antibodies. It is one of the mechanisms through which antibodies, ...

*Regulatory B cells

Markers of peripheral blood Bregs were molecules CD24 and CD38. However, peripheral blood Bregs were mostly CD24 and CD27 ... "IgG4 production is confined to human IL-10-producing regulatory B cells that suppress antigen-specific immune responses". The ...

*Neprilysin

It is also a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute ... CD10+ diffuse large B cell lymphoma (CD10+ DLBLC)Marker for germinal center phenotype (CD10, HGAL, BCL6, CD38) are considered a ... and common acute lymphoblastic leukemia antigen (CALLA) is an enzyme that in humans is encoded by the MME gene. Neprilysin is a ...

*Cancer stem cell

Bonnet and Dick isolated a subpopulation of leukemia cells that expressed surface marker CD34, but not CD38. The authors ... stage-specific embryonic antigen-1), EGFR and CD44. The use of CD133 for identification of brain tumor stem-like cells may be ... The cell surface receptor interleukin-3 receptor-alpha (CD123) is overexpressed on CD34+CD38- leukemic stem cells (LSCs) in ... "Delineation of a cellular hierarchy in lung cancer reveals an oncofetal antigen expressed on tumor-initiating cells". Cancer ...

*ATP1B3 - Википедия

Tissue Antigens (англ.)русск. : journal. - 2007. - Vol. 68, no. 6. - P. 509-517. - DOI:10.1111/j.1399-0039.2006.00726.x. - PMID ...

*Hematopoietic stem cell

hematopoietic cell surface antigen defined by a monoclonal antibody raised against KG-1a cells". Journal of Immunology. 133 (1 ... Many markers belong to the cluster of differentiation series, like: CD34, CD38, CD90, CD133, CD105, CD45, and also c-kit, - the ... In fact, even in humans, there are hematopoietic stem cells that are CD34−/CD38−. Also some later studies suggested that ... Loken M. Shah V. Civin CI.. (1987). ""Characterization of myeloid antigens on human bone marrow using multicolour ...

*CCL18

... is produced mainly by antigen-presenting cells of the innate immune system. These cells include dendritic cells, ... "The dendritic cell-specific CC-chemokine DC-CK1 is expressed by germinal center dendritic cells and attracts CD38-negative ... and instead non-antigen specifically exert their immunosuppressive functions by secreting IL-10. It is thought that these ... and recruits naïve B-cells for antigen presentation. Perhaps aberrant CCL18 expression is involved in the generation of chronic ...

*Basigin

1997). "The Oka blood group antigen is a marker for the M6 leukocyte activation antigen, the human homolog of OX-47 antigen, ... 1992). "Human leukocyte activation antigen M6, a member of the Ig superfamily, is the species homologue of rat OX-47, mouse ... Kasinrerk W, Fiebiger E, Stefanová I, Baumruker T, Knapp W, Stockinger H (1992). "Human leukocyte activation antigen M6, a ... Ok blood group system at BGMUT Blood Group Antigen Gene Mutation Database at NCBI, NIH ...

*CD97 - Википедија, слободна енциклопедија

CD97 antigen je protein koji je kod ljudi kodiran CD97 genom.[1][2][3] ... CD38 • CD39 • CD40 • CD41 • CD42 (a, b, c, d) • CD43 • CD44 • CD45 • CD46 • CD47 • CD48 • CD49 (a, b, c, d, e, f) • CD50 ... 2001). „Tissue distribution of the human CD97 EGF-TM7 receptor". Tissue Antigens. 57 (4): 325-31. PMID 11380941. doi:10.1034/j. ... Expression cloning and chromosomal mapping of the leukocyte activation antigen CD97, a new seven-span transmembrane molecule of ...
Clone REA976 recognizes the human CD370 antigen, also known as C-type lectin domain family 9 member A (CLEC9A). CD370 is a type II transmembrane glycoprotein member of 241 amino acids with a predicted molecular mass of ~30 kDa. It is also known as DNGR-1 and is expressed on BDCA-3+ myeloid dendritic cells from peripheral blood and lymphoid tissues. CD370 acts as a receptor for necrotic cells and plays an important role in cross-presentation. Additional information: Clone REA976 displays negligible binding to Fc receptors. - Great Britain
M-L23.4 recognizes human CD23, a 45 kDa type II transmembrane glycoprotein that belongs to the immunoglobulin family. It is expressed on most mature B cells, monocytes, follicular dendritic cells, and at low levels on T cells, Langerhans cells, eosinophils, and platelets. CD23 is thought to play a role in the regulation of B cell activation and IgE response. It is up-regulated upon B cell activation. The proteolytic cleavage of membrane CD23 can result in the release of soluble forms of the antigen (sCD23) with a reported biological activity. - Deutschland
A Membrane-bound or cytosolic enzyme that catalyzes the synthesis of Cyclic ADP-Ribose (cADPR) from Nicotinamide Adenine Dinucleotide (NAD). This enzyme generally catalyzes the Hydrolysis of cADPR to ADP-Ribose, as well, and sometimes the synthesis of Cyclic ADP-Ribose 2 phosphate (2-P-cADPR) from NADP ...
CD38 is a 42-kilodalton glycoprotein expressed extensively on B and T lymphocytes. CD38 exhibits a structural homology to Aplysia adenosine diphosphate (ADP)-ribosyl cyclase. This enzyme catalyzes the synthesis of cyclic ADP-ribose (cADPR), a metabolite of nicotinamide adenine dinucleotide (NAD +) with calcium-mobilizing activity. A complementary DNA encoding the extracellular domain of murine CD38 was constructed and expressed, and the resultant recombinant soluble CD38 was purified to homogeneity. Soluble CD38 catalyzed the formation and hydrolysis of cADPR when added to NAD+. Purified cADPR augmented the proliferative response of activated murine B cells, potentially implicating the enzymatic activity of CD38 in lymphocyte function ...
Looking for online definition of ADP-ribosyl cyclase 2 in the Medical Dictionary? ADP-ribosyl cyclase 2 explanation free. What is ADP-ribosyl cyclase 2? Meaning of ADP-ribosyl cyclase 2 medical term. What does ADP-ribosyl cyclase 2 mean?
We use cookies to ensure that we give you the best experience on our website. If you click Continue well assume that you are happy to receive all cookies and you wont see this message again. Click Find out more for information on how to change your cookie settings ...
CD38 (NAD+ glycohydrolase) is a type II transmembrane glycoprotein able to induce activation, proliferation and differentiation of mature lymphocytes and mediate apoptosis of myeloid and lymphoid progenitor cells. Another role of CD38 is provided by enzymatic activity of its extracellular part. CD38 acts as NAD+ glycohydrolase converting NAD+ into ADP-ribose, as ADP-ribosyl cyclase producing cADPR and as cADPR hydrolase, thus affecting levels of calcium-mobilizing metabolites. ADPR produced by CD38 serves as an important second messenger of neutrophil and dendritic cell migration ...
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
Quantitative differences in phospho MFI values distinguish ERA.The data from Figure 3 are plotted to (A) compare the CD8 MFI range/CD4 MFI range for each of p-A
MarketResearchReports.biz has recently announced the addition of a market study " Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) - Pipeline Review, H2 2016 ", is a comparative analysis of the global market.. Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) - Pipeline Review, H2 2016. Summary. Global Markets Directs, Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) - Pipeline Review, H2 2016, provides in depth analysis on Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or CD40L Receptor or TNFRSF5 or CD40) targeted pipeline therapeutics.. The report provides comprehensive information on the Tumor Necrosis Factor Receptor Superfamily Member 5 (B Cell Surface Antigen CD40 or Bp50 or CDw40 or ...
Calcium signaling is essential for the differentiation of many cell types, including skeletal muscle cells, but its mechanisms remain elusive. Here we demonstrate a crucial role for nicotinic acid adenine dinucleotide phosphate (NAADP) signaling in skeletal muscle differentiation. Although the inositol trisphosphate pathway may have a partial role to play in this process, the ryanodine signaling cascade is not involved. In both skeletal muscle precursors and C2C12, cells interfering with NAADP signaling prevented differentiation, whereas promoting NAADP signaling potentiated differentiation. Moreover, siRNA knockdown of two-pore channels, the target of NAADP, attenuated differentiation. The data presented here strongly suggest that in myoblasts, NAADP acts at acidic organelles on the recently discovered two-pore channels to promote differentiation.
Thank you for your interest in spreading the word on Circulation Research.. NOTE: We only request your email address so that the person you are recommending the page to knows that you wanted them to see it, and that it is not junk mail. We do not capture any email address. ...
Cadp-ribose/ACM119340535 can be provided in Alfa Chemistry. We are dedicated to provide our customers the best products and services.
Although activation of M2 muscarinic receptors is classically known to inhibit adenylyl cyclase activity (Peralta et al., 1988) or to modify membrane potential by inhibiting Ca2+-activated K+ channel (Kotlikoff et al., 1992), it has been recently proposed that M2 muscarinic receptors may induce Ca2+ signals by activation of the cADPR pathway (White et al., 2003) or by stimulation of a voltage-dependent Ca2+ channel (Cav1.2b) via the phosphatidylinositol 3-kinase/PKC pathway (Callaghan et al., 2004). Activation of the cADPR pathway by ACh in duodenum myocytes is shown by: (1) inhibition of Ca2+ oscillations by application of the cADPR competitive antagonist (8Br-cADPR), (2) inhibition of ACh-induced Ca2+ oscillations by inhibitors of ADP-ribosyl cyclase (ZnCl2, anti-CD38 antibody) and (3) detection of ADP-ribosyl cyclase activity by fluorescence experiments as the enzyme cyclizes NGD+ (non fluorescent) to produce cGDPR, a fluorescent compound (Graeff et al., 1994). This method has been used ...
Cyclic ADP-ribose (cADPR) is a putative second messenger that has been demonstrated to mobilize Ca2+ in many cell types. Its postulated role as the endogenous regulator of ryanodine-sensitive Ca2+ release channels has been greatly supported by the advent and use of specific cADPR receptor antagonists such as 8-NH2-cADPR (Walseth, T. F., and Lee, H. C. (1993) Biochim. Biophys. Acta 1178, 235-242). However, investigations of the role of cADPR in physiological responses, such as fertilization, stimulus-secretion coupling, and excitation-contraction coupling, have been hindered by the susceptibility of cADPR receptor antagonists to hydrolysis and the need to introduce these molecules into cells by microinjection or patch clamp techniques. We have recently reported on the discovery of a poorly hydrolyzable analogue of cADPR, 7-deaza-cADPR (Bailey, V. C., Sethi, J. K., Fortt, S. M., Galione, A., and Potter, B. V. L. (1997) Chem. Biol. 4, 41-51) but this, like cADPR, is an agonist of ryanodine-sensitive Ca2+
Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5' untranslated region of this gene is ...
This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases ...
FUNCTION: [Summary is not available for the mouse gene. This summary is for the human ortholog.] This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases. [provided by RefSeq, Jul 2008 ...
Abstract. Evidence has been provided recently that shows that high concentrations of cytokines can fulfill functions previously attributed to stromal cells, su
From the Editor : I switched some time ago to the use of Twitter, instead of this blog, as a place to post items about selected recent news... ...
购买MFI2兔多克隆抗体(ab115334),MFI2抗体经IHC-P验证,可与人样本反应。产品出库一年都在质保范围内。中国现货速达。
Multiple mechanisms exist for increasing the concentration of intracellular calcium. This Perspective by Lee is one in a series on intracellular calcium release mechanisms and focuses on the calcium store operated by nicotinic acid adenine dinucleotide phosphate (NAADP). The characterization of the NAADP-operated calcium store as separate from the inositol trisphosphate (IP3)-operated and cyclic ADP-ribose (cADPR)-operated calcium stores is discussed. Lee also addresses the role of NAADP in regulating intracellular calcium fluctuations during fertilization and hormonal activation of pancreatic acinar cells.. ...
As the result of successful collaboration with Dr. K. Mikoshibas laboratory in RIKEN Brain Science Institute, Tokyo, Japan, we found that pancreatic protease activation by alcohol metabolite mainly depends on Ca2+ release via acid store IP3 receptors (Gerasimenko J. et al, PNAS, 2009). Currently there is no specific pharmacological treatment for pancreatitis. However, now our research has identified the critical proteins responsible for the excessive calcium release which is where the problem begins with the possibility to search for specific chemical compounds for the treatment of acute pancreatitis.. I am investigating the action of nicotinic acid adenine dinucleotide phosphate (NAADP), a novel Ca2+ releasing messenger and its role in the induction of pathological processes of exocrine pancreas. Our findings (Gerasimenko J, et al., JCS, 2006) show that the NAADP-sensitive Ca2+ pool is located in the endoplasmic reticulum and in acidic organelles, which are represented by secretory granules, ...
The ectoenzymes CD39 and CD73 regulate the purinergic signaling through the hydrolysis of adenosine triphosphate (ATP)/ADP to AMP and to adenosine (Ado), respectively. This shifts the pro-inflammatory milieu induced by extracellular ATP to the anti-inflammatory regulation by Ado. Mesenchymal stem cells (MSCs) have potent immunomodulatory capabilities, including monocyte modulation toward an anti-inflammatory phenotype aiding tissue repair. In vitro, we observed that human cardiac adipose tissue-derived MSCs (cATMSCs) and umbilical cord MSCs similarly polarize monocytes toward a regulatory M2 phenotype, which maintained the expression of CD39 and induced expression of CD73 in a cell contact dependent fashion, correlating with increased functional activity ...
CD2 interacts with lymphocyte function-associated antigen (LFA-3) to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.
MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGA 1 - 70 SATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLR 71 - 140 LSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFL 141 - 210 YPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFD 211 - 280 EPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGV 281 - 350 VVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL 351 - 420 LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLT 421 - 490 DVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYG 491 - 560 NAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKAL 561 - 630 KLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRL 631 - 700 LIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDR 701 - 770 MENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW 771 - 840 ...
Mango butter is a cosmetic ingredient with deep moisturizing, softening and soothing properties. Since this butter is great for skin, it is perfect to add to any of your bath and body products. It is so wonderful that we couldnt go without recognizing 30 Mango Butter Recipes that have been formulated at Natures Garden. These various soap and cosmetic recipes are amazing for your skin and are free for you to create at any time. Not only do all of these recipes contain this skin-loving butter, but they have other properties in addition. In this craft blog, we will talk about many of our recipes that use mango butter to create an amazing product. So, take a look at some of our recipes for fantastic bath and body products!. ...
The only curative therapy for sickle cell disease (SCD) is allogeneic hematopoietic stem cell (HSC) transplantation. Gene therapy approaches for autologous HSC transplantation are being developed. Although earlier engraftment is seen when cells from GCSF-mobilized blood are transplanted than when bone marrow is transplanted, administration of GCSF to patients with SCD can cause significant morbidity. We tested whether primitive hematopoietic progenitors are spontaneously mobilized in the blood of patients with SCD during acute crisis (AC-SCD patients). The frequency of myeloid-lymphoid-initiating cells (ML-ICs) and SCID-repopulating cells (SRCs) was significantly higher in blood from AC-SCD patients than in blood from patients with steady-state SCD or from normal donors. The presence of SRCs in peripheral blood was not associated with detection of long-term culture-initiating cells, consistent with the notion that SRCs are more primitive than long-term culture-initiating cells. As ML-ICs and ...
In sea urchin eggs, Ca2+ mobilization by nicotinic acid adenine dinucleotide phosphate (NAADP) potently self-inactivates but paradoxically induces long-term Ca2+ oscillations. We investigated whether NAADP-induced Ca2+ oscillations arise from the recruitment of other Ca2+ release pathways. NAADP, inositol trisphosphate (IP3) and cyclic ADP-ribose (cADPR) all mobilized Ca2+ from internal stores but only NAADP consistently induced Ca2+ oscillations. NAADP-induced Ca2+ oscillations were partially inhibited by heparin or 8-amino-cADPR alone, but eliminated by the presence of both, indicating a requirement for both IP3- and cADPR-dependent Ca2+ release. Thapsigargin completely blocked IP3 and cADPR responses as well as NAADP-induced Ca2+ oscillations, but only reduced the NAADP-mediated Ca2+ transient. Following NAADP-mediated release from this Ca2+ pool, the amount of Ca2+ in the Ca2+-induced Ca2+ release stores was increased. These results support a mechanism in which Ca2+ oscillations are initiated by Ca2
Nicotinic acid adenine dinucleotide phosphate (NAADP) receptor that may function as one of the major voltage-gated Ca(2+) channels (VDCC) across the lysosomal and endosomal membrane.
Human B lymphocytes expressing the CD5 surface antigen (CD5+ B cells) constitute a subset capable of producing polyspecific antibodies recognizing a variety of self antigens. The repertoire of antibodies produced by CD5+ and CD5- B cells is different. However, it is not yet established whether this distribution is reflected in different immunoglobulin variable region gene (IgV) use. Rearrangement of heavy chain IgV (IgVH) genes represents one of the first identifiable stages in the maturation of B cells, and occurs in a developmentally ordered fashion. The repertoire of IgVH gene expression is highly restricted during fetal life but diversifies progressively after birth. A high frequency of VH gene use from the relatively small VHIV gene family has previously been demonstrated in human fetal liver B cells. In the present study, 102 B cell lines established by Epstein-Barr Virus-transformation of separated CD5+ and CD5- cord blood B cells, were examined for the frequency of IgV expression using ...
This multiunctional enzyme catalyses both the synthesis and hydrolysis of cyclic ADP-ribose, a calcium messenger that can mobilize intracellular Ca2+ stores and activate Ca2+ influx to regulate a wide range of physiological processes. In addition, the enzyme also catalyses EC 2.4.99.20, 2-phospho-ADP-ribosyl cyclase/2-phospho-cyclic-ADP-ribose transferase. cf. EC 3.2.2.5, NAD+ glycohydrolase ...
Accepted name: NAD+ glycohydrolase. Reaction: NAD+ + H2O = ADP-D-ribose + nicotinamide. Glossary: ADP-D-ribose = adenosine 5′-(5-deoxy-D-ribofuranos-5-yl diphosphate). Other name(s): NAD glycohydrolase; nicotinamide adenine dinucleotide glycohydrolase; β-NAD+ glycohydrolase; DPNase (ambiguous); NAD hydrolase (ambiguous); diphosphopyridine nucleosidase (ambiguous); nicotinamide adenine dinucleotide nucleosidase (ambiguous); NAD nucleosidase (ambiguous); DPN hydrolase (ambiguous); NADase (ambiguous); nga (gene name). Systematic name: NAD+ glycohydrolase. Comments: This enzyme catalyses the hydrolysis of NAD+, without associated ADP-ribosyl cyclase activities (unlike the metazoan enzyme EC 3.2.2.6, bifunctional ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase). The enzyme from Group A streptococci has been implicated in the pathogenesis of diseases such as streptococcal toxic shock-like syndrome (STSS) and necrotizing fasciitis. The enzyme from the venom of the snake Agkistrodon acutus also ...
Recent developments of surrogate assays for human hematopoietic stem cells (HSC) have facilitated efforts at improving HSC gene transfer efficiency. Through the use of xenograft transplantation models, such as nonobese diabetic/severe combined immunodeficiency (NOD/SCID) mice, successful oncoretroviral gene transfer to transplantable hematopoietic cells has been achieved. However, because of the low frequency and/or homing efficiency of SCID repopulating cells (SRC) in bone marrow (BM), studies have primarily focused on cord blood (CB). The recently developed extended (| 60 days) long-term culture-initiating cell (ELTC-IC) assay detects an infrequent and highly quiescent candidate stem cell population in BM as well as CB of the CD34(+)CD38(-) phenotype. Although these characteristics suggest that ELTC-IC and SRC might be closely related, attempts to oncoretrovirally transduce ELTC-IC have been unsuccessful. Here, recently developed conditions (high concentrations of SCF + FL + Tpo in serum-free medium)
Hypothalamic oxytocin (OT) is released into the brain by cyclic ADP-ribose (cADPR) with or without depolarizing stimulation. Previously, we showed that the intracellular free calcium concentration ([Ca2+]i) that seems to trigger OT release can be elevated by -NAD+, cADPR, and ADP in mouse oxytocinergic neurons. As these -NAD+ metabolites activate warm-sensitive TRPM2 cation channels, when the incubation temperature is increased, the [Ca2+]i in hypothalamic neurons is elevated. However, it has not been determined whether OT release is facilitated by heat in vitro or hyperthermia in vivo in combination with cADPR. Furthermore, it has not been examined whether CD38 and TRPM2 exert their functions on OT release during stress or stress-induced hyperthermia in relation to the anxiolytic roles and social behaviors of OT under stress conditions. Here, we report that OT release from the isolated hypothalami of male mice in culture was enhanced by extracellular application of cADPR or increasing the
Intracellular Ca(2+) release is mostly mediated by inositol trisphosphate, but intracellular cyclic-ADP-ribose (cADPR) and nicotinic acid adenine dinucleotide phosphate (NAADP) are important messengers in many systems. Whereas cADPR generally activates type 2 ryanodine receptors (RyR2s), the NAADP-activated Ca(2+) release mechanism is less clear. Using knockouts and antibodies against RyRs and Two-Pore Channels (TPCs), we have compared their relative importance for NAADP-induced Ca(2+) release from two-photon permeabilized pancreatic acinar cells. In these cells, cholecystokinin-elicited Ca(2+) release is mediated by NAADP. TPC2-KO reduced NAADP-induced Ca(2+) release by 64%, but the combination of TPC2-KO and an antibody against TPC1, significantly reduced Ca(2+) release by 86% (64% vs. 86%, p|0.0002). In RyR3-KO, NAADP-evoked Ca(2+) release reduced by ∼50% but, when combined with antibodies against RyR1, responses were 90% inhibited. Antibodies against RyR2 had practically no effect on NAADP-evoked
TRPM2 is a Ca2+-permeable cation channel that is specifically activated by adenosine diphosphoribose (ADPR). Channel activation in the plasma membrane leads to Ca2+ influx and has been linked to apoptotic mechanisms. The primary agonist, ADPR, is produced both extra- and intracellularly and causes increases in intracellular calcium concentration ([Ca2+]i), but the mechanisms involved are not understood. Using short interfering RNA and a knockout mouse, we report that TRPM2, in addition to its role as a plasma membrane channel, also functions as a Ca2+-release channel activated by intracellular ADPR in a lysosomal compartment. We show that both functions of TRPM2 are critically linked to hydrogen peroxide-induced β cell death. Additionally, extracellular ADPR production by the ectoenzyme CD38 from its substrates NAD+ (nicotinamide adenine dinucleotide) or cADPR causes IP3-dependent Ca2+ release via P2Y and adenosine receptors. Thus, ADPR and TRPM2 represent multimodal signaling elements ...
How cancer cells adapt to metabolically adverse conditions in patients and strive to proliferate is a fundamental question in cancer biology. Here we show that AMP-activated protein kinase (AMPK), a metabolic checkpoint kinase, confers metabolic stress resistance to leukemia-initiating cells (LICs) and promotes leukemogenesis. Upon dietary restriction, MLL-AF9-induced murine acute myeloid leukemia (AML) activated AMPK and maintained leukemogenic potential. AMPK deletion significantly delayed leukemogenesis and depleted LICs by reducing the expression of glucose transporter 1 (Glut1), compromising glucose flux, and increasing oxidative stress and DNA damage. LICs were particularly dependent on AMPK to suppress oxidative stress in the hypoglycemic bone marrow environment. Strikingly, AMPK inhibition synergized with physiological metabolic stress caused by dietary restriction and profoundly suppressed leukemogenesis. Our results indicate that AMPK protects LICs from metabolic stress and that ...
Increasing evidence has indicated that NAD+ and NADH play critical roles not only in energy metabolism, but also in cell death and various cellular functions including regulation of calcium homeostasis and gene expression. It has also been indicated that NAD+ and NADH are mediators of multiple major biological processes including aging. NAD+ and NADH produce the biological effects by regulating numerous NAD+/NADH-dependent enzymes, including dehydrogenases, poly(ADP-ribose) polymerases, Sir2 family proteins (sirtuins), mono(ADP-ribosyl)transferases, and ADP-ribosyl cyclases. Of particular interest, NAD+-dependent generation of ADP-ribose, cyclic ADP-ribose and O-acetyl-ADP-ribose can mediate calcium homeostasis by affecting TRPM2 receptors and ryanodine receptors; and sirtuins and PARPs appear to play key roles in aging, cell death and a variety of cellular functions. It has also been indicated that NADH and NAD+ can be transported across plasma membranes of cells, and that extracellular NAD+ ...
BACKGROUND AND OBJECTIVE: Tumor necrosis factor-a plays an important role in hematopoiesis. Its effects are mediated through two membrane-bound receptors: TNF-R I (p55; CD 120a) and TNF-R II (p75; CD 120b). The aim of our study was to investigate the relative roles of these receptors. DESIGN AND METHODS: We analyzed in 16 acute myeloid leukemia cases whether TNF-alpha could induce in vitro maturation and apoptosis. We then investigated which of the two receptors was provoking monocytic maturation and which was responsible for apoptosis by using the agonistic MoAb HTR-9, directed at CD120a, and the CD120b antagonistic MoAb UTR-1. RESULTS: Monocytic maturation (morphologic and immunologic) was induced in all cases studied, although to different rates, by TNF-alpha and by HTR-9 incubation. The addition of UTR-1 to TNF-alpha did not abolish maturation, nor did it affect apoptosis, which was present in primary AML cultures after 4 and 10 days. INTERPRETATION AND CONCLUSIONS: We present here evidence ...
AllCells offers a wide selection of human primary cells and related products including Cord Blood CD3+ Pan T Cells from our AllCells.com store.
Ca 2+ signaling in spermatozoa plays a crucial role during processes such as capacitation and release of the acrosome, but the underlying molecular mechanisms still remain unclear. Nicotinic acid adenine dinucleotide phosphate (NAADP) is a potent Ca 2+ -releasing second messenger in a variety of cellular processes. The presence of a NAADP synthesizing enzyme in sea urchin sperm has been previously reported, suggesting a possible role of NAADP in sperm Ca 2+ signaling. In this work we used in vitro enzyme assays to show the presence of a novel NAADP synthesizing enzyme in human sperm, and to characterize its sensitivity to Ca 2+ and pH. Ca 2+ fluorescence imaging studies demonstrated that the permeable form of NAADP (NAADP-AM) induces intracellular [Ca 2+ ] increases in human sperm even in the absence of extracellular Ca 2+ . Using LysoTracker®, a fluorescent probe that selectively accumulates in acidic compartments, we identified two such stores in human sperm cells. Their acidic nature was further
Thrombopoietin (Tpo) is a primary regulator of megakaryocyte and platelet production. However, studies in c-mpl-deficient mice suggest that Tpo might also play an important role in early hemopoiesis. Here, the direct ability of Tpo to stimulate stroma-independent growth, multilineage differentiation, and progenitor cell expansion from single primitive CD34+ CD38- human bone marrow cells was investigated. Tpo alone stimulated limited clonal growth, but synergized with c-kit ligand (KL), flt3 ligand (FL), or IL-3 to potently enhance clonogenic growth. Whereas KL and FL in combination stimulated the clonal growth of only 3% of CD34+ CD38- cells, 40% of CD34+ CD38- cells were recruited by KL+FL+Tpo, demonstrating that Tpo promotes the growth of a high fraction of CD34+ CD38- progenitor cells. Additional cytokines (IL-3, IL-6, and erythropoietin (Epo)) did not significantly enhance clonal growth above that observed in response to KL+FL+Tpo. In contrast, Tpo enhanced clonogenic growth in response to KL+FL+IL
Hereditary hemochromatosis (HH) is a prevalent genetic disorder that results in the daily excess absorption of dietary iron. If untreated this disease leads to systemic organ failure and death. HH is caused by mutations to the gene coding for a protein called HFE, a type I transmembrane glycoprotein with a demonstrated role in regulating cellular iron homeostasis. HFE binds to the cell-surface receptor transferrin receptor (TfR), a dimeric type II transmembrane glycoprotein responsible for iron uptake into most mammalian cell types. TfR binds iron-loaded transferrin (Fe-Tf) from the blood and transports it to acidic recycling endosomes where iron is released from Fe-Tf in a TfR-facilitated process. Iron-free transferrin (apo-Tf) remains bound to TfR and is recycled to the cell surface, where apo-Tf rapidly dissociates from TfR upon exposure to the basic pH of blood. HFE and Fe-Tf can bind simultaneously to TfR to form a ternary complex, but HFE binding to TfR lowers the apparent affinity of the ...
De Wynter, E.A., Buck, D., Hart, C., Heywood, R., Coutinho, L.H., Clayton, A., Rafferty, J.A., Burt, D., Guenechea, G., Bueren, J.A., Gagen, D., Fairbairn, L.J., Lord, B.I. & Testa, N.G. (1998) CD34+AC133+ cells isolated from cord blood are highly enriched in long-term culture-initiating cells, NOD/SCID-repopulating cells and dendritic cell progenitors. Stem Cells, 16, 387-396. ...
AllCells offers a wide selection of human primary cells and related products including Bone Marrow CD34+ Stem/Progenitor Cells from our AllCells.com store.
PFS is defined as the time from randomization until progression/death. Per the IRC, if the participant had progression between scheduled visits, died before the first assessment, or died between adequate visits, the endpoint was considered progressed. If there was no progression at the end of the trial, treatment discontinuation for undocumented progression, treatment discontinuation for toxicity/other reason, new anti-cancer treatment, and death/progression after 2 or more missed visits in a row, the endpoint was censored. Clinical progression is not considered as progression endpoint ...
View R&D Systems research products for *8145-CD OR *6177-CD OR *3899-CD OR *2724-CD OR *3355-CD OR *2640-LM OR *1186-LM OR *1859-DC OR *1756-DC OR *1180-SE OR *954-SE OR *9168-SE OR *3384-B6 OR *3384-B6 OR *611-B6 OR *5668-A4 OR *6054-A4 OR *5397-A3 OR *8615-A3 OR *2319-L3 OR *3328-L3 OR *981-TR OR *546-TR OR *7579-CD
CD25− CD45RBlow as well as CD25+ CD45RBlow CD4+ cells from infected WT mice protect RAG KO mice against colitis. Infected RAG KO mice were given either no cel
CD4 receptor - MedHelps CD4 receptor Center for Information, Symptoms, Resources, Treatments and Tools for CD4 receptor. Find CD4 receptor information, treatments for CD4 receptor and CD4 receptor symptoms.
... - Cumpara online Muzica CD, vezi specificatii tehnice pentru Muzica CD, promotii, oferte si preturi la cele mai noi modele de Muzica CD - Muzica CD
Background: Poly (ADP-ribosyl) polymerase 1 (PARP1) is important in maintaining genomic stability, repairing DNA damage, and regulating transcriptional processe
Gentaur molecular products has all kinds of products like :search , Alpha Dia \ Anti_Human CD62P_PE conjugate \ CD62PP-100 for more molecular products just contact us
Gentaur molecular products has all kinds of products like :search , Alpha Dia \ Anti_Human CD41_PE conjugate 4 \ CD41P4-100 for more molecular products just contact us
How to Design CD Covers. Designing your own CD covers for mixtapes, burned CDs, or to replace your old worn out ones is a project with a lot of possibilities. You can print out computer-generated covers to size, or make you own CD covers...
购买重组CD32B兔单克隆抗体[EP888Y](ab45143),CD32B抗体经WB验证,可与人样本反应。12篇文献引用,产品出库一年都在质保范围内。中国现货速达。
2001 05 22.20858 16 06 45.68 -20 01 22.4 22.0R 01KG76 807 Cd1817 2001 05 22.28897 16 06 45.29 -20 01 21.3 01KG76 807 Cd1817 2001 06 10.02875 16 05 16.38 -19 57 27.3 22.9R 01KG76 304 Cd1817 2001 06 10.10380 16 05 16.05 -19 57 26.3 01KG76 304 Cd1817 2001 08 19.03454 16 02 18.80 -19 50 35.3 21.4R 01KG76 807 Cd7687 2001 08 20.03188 16 02 19.15 -19 50 37.8 01KG76 807 Cd7687 2001 08 21.03938 16 02 19.58 -19 50 40.7 01KG76 807 Cd7687 2002 04 07.29240 16 15 09.97 -20 25 16.3 21.6R 01KG76 807 Cf4617 2002 04 07.38861 16 15 09.68 -20 25 15.6 01KG76 807 Cf4617 2002 05 12.03950 16 12 54.85 -20 19 22.5 01KG76 950 Cf4617 2002 05 12.08513 16 12 54.63 -20 19 21.8 01KG76 950 Cf4617 2002 05 12.13062 16 12 54.41 -20 19 21.3 01KG76 950 Cf4617 2002 05 13.04812 16 12 50.15 -20 19 10.5 01KG76 950 Cf4617 2002 05 13.11749 16 12 49.83 -20 19 09.6 01KG76 950 Cf4617 2002 07 10.99718 16 08 34.27 -20 08 36.4 22.2R 01KG76 304 Cf9823 2002 07 11.20921 16 08 33.59 -20 08 35.0 01KG76 304 Cf9823 2002 07 13.10322 16 08 27.82 -20 08 ...
ഒരുപോലെയിരിക്കുന്ന ശരാശരി വലിപ്പമുള്ള ലിംഫോസൈറ്റുകളാണ് സൂക്ഷ്മദർശിനിയിലൂടെ ദൃശ്യമാവുക. നക്ഷത്രപൂരിതമായ ആകാശം എന്നാണ് ഈ സൂക്ഷ്മദർശിനി ദൃശ്യത്തെ വിശേഷിപ്പിക്കുന്നത്.[4] ഈ ലിംഫോസൈറ്റുകൾക്ക് ക്ഷാരാഭിമുഖ്യമുള്ള കോശദ്രവ്യം ഉണ്ടാകും. ചെറിയ മുറിയാത്ത കോശങ്ങൾ എന്നാണ് ബർക്കിറ്റ് ലിംഫോമയിലെ ലിംഫോസൈറ്റുകളെ വിശേഷിപ്പിക്കുന്നത്. ബി-കോശ വ്യതിരക്ത മാർക്കറുകളായ CD20, CD22, CD19 എന്നിവ ...
High-quality CD14 proteins from ACROBiosystems. Various species and tags of PCSK9 proteins. Minimal Batch-to-Batch Variation. Bulks in stock.
High-quality CD79B proteins from ACROBiosystems. Various species and tags of PCSK9 proteins. Minimal Batch-to-Batch Variation. Bulks in stock.
ゲット・イット・ベイビー (ノーナ・リーヴス・リミックス) ,ボーナス・トラック, / ティト・ ...
Page 3 - Hello everyone So I took the AANP in March 2011 after taking the Fitz course, and failed (personally I didnt think I was ready), but I thought I would try. Then I purchased the Barkley Assoc CD
هدف: پلاکت‏ها قطعات سلولی بدون هسته و مشتق از مگاکاریوسیت‏ها هستند که علاوه بر ایفای نقش در هموستاز و ایمنی ذاتی به واسطه داشتن شاخص‏های مهم نظیر CD40L (یک شاخص مولکولی مهم در تحریک سلول‏های ایمنی) می‏توانند در ایمنی اکتسابی نیز نقش داشته باشند؛ از جمله تأثیر آن‏ها بر لنفوسیت‏های B و فعال‏سازی آن‏ها مشخص شده است. اکنون در پاسخ به این سؤال که آیا میکروذرات مشتق از غشای پلاکت نیز می‏تواند این تأثیر‏گذاری را داشته باشد، تأثیر آن‏ها بر فعال‏سازی لنفوسیت‏های B بررسی شد. مواد و روش‏ها: در ابتدا پلاکت کنسانتره از پایگاه انتقال خون منطقه‌ای و آموزشی استان

Browsing  by Subject Antigens, CD38Browsing by Subject "Antigens, CD38"

Hematopoietic stem cells have the capacity to self-renew and give rise to the entirety of the mature blood and immune system throughout the lifespan of an organism. Here, we describe methods to isolate and culture murine ...
more infohttps://dukespace.lib.duke.edu/dspace/browse?type=subject&value=Antigens%2C%20CD38

Formation and hydrolysis of cyclic ADP-ribose catalyzed by lymphocyte antigen CD38Formation and hydrolysis of cyclic ADP-ribose catalyzed by lymphocyte antigen CD38

... Academic Article ... CD38 is a 42-kilodalton glycoprotein expressed extensively on B and T lymphocytes. CD38 exhibits a structural homology to ... and the resultant recombinant soluble CD38 was purified to homogeneity. Soluble CD38 catalyzed the formation and hydrolysis of ... A complementary DNA encoding the extracellular domain of murine CD38 was constructed and expressed, ...
more infohttp://scholars.uab.edu/display/pub767464

Mouse monoclonal to CD38.TB2 reacts with CD38 antigen - Angiogenesis Inhibitors ResearchMouse monoclonal to CD38.TB2 reacts with CD38 antigen - Angiogenesis Inhibitors Research

CD38 antigen is expressed 90% of CD34+ cells, Mouse monoclonal to CD38.TB2 reacts with CD38 antigen, NK cells, plasma cells, ... Tag: Mouse monoclonal to CD38.TB2 reacts with CD38 antigen. The mechanical environment of a cell has a profound effect on. The ... CD38 antigen is expressed 90% of CD34+ cells, but not on pluripotent stem cells. Coexpression of CD38 + and CD34+ indicates ... cancers [3,4]. Many inspections Mouse monoclonal to CD38.TB2 reacts with CD38 antigen, a 45 kDa integral membrane glycoprotein ...
more infohttp://angiogenesis-blog.com/tag/mouse-monoclonal-to-cd38-tb2-reacts-with-cd38-antigen/

Peptides and Proteins: Novus BiologicalsPeptides and Proteins: Novus Biologicals

Novus offers a wide variety of proteins and peptides including full-length recombinant proteins that have been tested for biological activity.
more infohttps://www.novusbio.com/product-type/peptides-and-proteins?gene_symbol=CD38

PE/Dazzle™ 594 anti-human CD38 Antibody, CD38, HIT2PE/Dazzle™ 594 anti-human CD38 Antibody, CD38, HIT2

CD38 is a 45 kD type II transmembrane glycoprotein also known as T10. It is an ADP-ribosyl hydrolase expressed at variable ... Antigen References 1. Ferrero E, et al. 1999. J. Leukoc. Biol. 65:151.. 2. Lund F, et al. 1995. Immunol. Today 16:469. ... Antigen Details Structure ADP-ribosyl cyclase, ectoenzyme, type II glycoprotein, 45 kD Distribution T cells, B cells, NK, ... CD38 is a 45 kD type II transmembrane glycoprotein also known as T10. It is an ADP-ribosyl hydrolase expressed at variable ...
more infohttps://www.biolegend.com/en-gb/products/pedazzle594-anti-human-cd38-antibody-14582

Early proliferation of CCR5+ CD38+++ antigen-specific CD4+ Th1 effector cells during primary HIV-1 infection | Blood JournalEarly proliferation of CCR5+ CD38+++ antigen-specific CD4+ Th1 effector cells during primary HIV-1 infection | Blood Journal

CD38-APC, CD38-PE, and CD38-FITC, human leukocyte antigen (HLA)-DR-FITC, CD57-FITC, CD62L-FITC, CD95-PE, CD154 (CD40L)-PE, and ... Early proliferation of CCR5+ CD38+++ antigen-specific CD4+ Th1 effector cells during primary HIV-1 infection. John J. Zaunders ... Early proliferation of CCR5+ CD38+++ antigen-specific CD4+ Th1 effector cells during primary HIV-1 infection. Blood, 106(5), ... Firstly, we have now directly shown that the antigen-specific CD38+++ CD4+ T cells also contained decreased levels of Bcl-2. We ...
more infohttp://www.bloodjournal.org/content/106/5/1660?ijkey=4e7965673ac322c1b877805d1c3e7b98625d6be1&keytype2=tf_ipsecsha&sso-checked=true

Mouse anti-CD38, Clone: AT1, Novus Biologicals 0.1mg; Unlabeled:Life Sciences
 | Fisher ScientificMouse anti-CD38, Clone: AT1, Novus Biologicals 0.1mg; Unlabeled:Life Sciences | Fisher Scientific

Mouse anti-CD38, Clone: AT1, Novus Biologicals 0.1mg; Unlabeled Life Sciences:Antibodies:Primary Antibodies:Flow Cytometry ( ... CD38 antigen, CD38 antigen (p45), CD38 molecule, Cyclic ADP-ribose hydrolase 1, EC 3.2.2.5, NAD(+) nucleosidase, T10. ... CD38 is expressed on CD34+ cells. The CD34+CD38- population of hematopoietic stems cells defines the most pluripotent cells (e. ... CD38 Monoclonal antibody specifically detects CD38 in Human samples. It is validated for Flow Cytometry, Immunofluorescence. ...
more infohttps://www.fishersci.com/shop/products/mouse-anti-cd38-clone-at1-novus-biologicals-3/NBP24456401

Publications | AIDS Clinical Trials GroupPublications | AIDS Clinical Trials Group

Antigens, CD38. Zheng L, Taiwo B, Gandhi RT, et al. "Factors associated with CD8+ T-cell activation in HIV-1-infected patients ...
more infohttps://actgnetwork.org/pubmed_publications?f%5Btg%5D=F&s=keyword&o=asc

monocyte/macrophages and dentritic cells. CD38 antigen is expressed 90% of CD34+ cells | Discovery of Serotonin N...monocyte/macrophages and dentritic cells. CD38 antigen is expressed 90% of CD34+ cells | Discovery of Serotonin N...

CD38 antigen is expressed 90% of CD34+ cells, Mouse monoclonal to CD38.TB2 reacts with CD38 antigen, NK cells, plasma cells, ... CD38 antigen is expressed 90% of CD34+ cells, but not on pluripotent stem cells. Coexpression of CD38 + and CD34+ indicates ... angiogenesis and signal transduction associated with UCB Mouse monoclonal to CD38.TB2 reacts with CD38 antigen, a 45 kDa ... CD38 antigen is expressed 90% of CD34+ cells. Data Availability StatementThe datasets generated or analyzed during this study ...
more infohttp://extremebiology.net/tag/monocyte-macrophages-and-dentritic-cells-cd38-antigen-is-expressed-90-of-cd34-cells/

BC-3 ATCC ® CRL-2277™ Homo sapiens Pleura, pleural effusionBC-3 ATCC ® CRL-2277™ Homo sapiens Pleura, pleural effusion

Antigen Expression CD30 +; CD38 +; CD45 +; CD 54 +; CD71 +; HLA-DR +; EMA + (epithelial membrane antigen); CD2 -; CD3 -; CD4 ... The cells do not express B-cell lineage restricted antigens or kappa or lambda immunoglobulin light chains or T-cell lineage- ...
more infohttps://www.atcc.org/en/Products/Cells_and_Microorganisms/By_Tissue/Other_Tissues/Pleura/CRL-2277.aspx

IM-9  ATCC ® CCL-159™ Homo sapiens peripheral blood multipleIM-9 ATCC ® CCL-159™ Homo sapiens peripheral blood multiple

Antigen Expression CD11a +; CD19 +; CD20 +; CD38 -; CD49e +. Receptor Expression growth hormone receptor ...
more infohttps://www.atcc.org/en/Products/All/CCL-159.aspx

CD38 from ACROBiosystems : Get Quote, RFQ, Price or BuyCD38 from ACROBiosystems : Get Quote, RFQ, Price or Buy

CD38 is expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and ... CD antigen CD38 is also known as ADP-ribosyl cyclase 1, which belongs to the ADP-ribosyl cyclase family. ... CD38 Molecule Synonym Name. CD38, T10, cADPr hydrolase 1. CD38 Molecule Background. CD antigen CD38 is also known as ADP- ... CD38 Molecule Information. Name4Lymphocyte differentiation antigen CD38. Target Synonym42 -phospho-ADP-ribosyl cyclase?T10?CD38 ...
more infohttps://www.news-medical.net/CD38-from-ACROBiosystems

Recombinant Human CD38 protein (ab114253) | AbcamRecombinant Human CD38 protein (ab114253) | Abcam

Buy our Recombinant Human CD38 protein. Ab114253 is a full length protein produced in Wheat germ and has been validated in WB, ... Acute lymphoblastic leukemia cells antigen CD38. *ADP ribosyl cyclase. *ADP ribosyl cyclase 1 ...
more infohttp://www.abcam.com/recombinant-human-cd38-protein-ab114253.html

CD27 | Cancer Genetics WebCD27 | Cancer Genetics Web

Persistence of EBV antigen-specific CD8 T cell clonotypes during homeostatic immune reconstitution in cancer patients.. PLoS ... myeloma BM samples have shown that combined assessment of CD138 and CD38, together with CD45, CD19, CD56, CD27, CD81, and CD117 ... The genetic modification of CD8+ T cells using anti-tumor T-cell receptors (TCR) or chimeric antigen receptors is a promising ... The weal and woe of costimulation in the adoptive therapy of cancer with chimeric antigen receptor (CAR)-redirected T cells.. ...
more infohttp://www.cancerindex.org/geneweb/CD27.htm

Anti-CD38 antibody (FITC) [90] | AbcamAnti-CD38 antibody (FITC) [90] | Abcam

Anti-CD38 antibody conjugated to FITC [90] validated for IP, IHC, Flow Cyt, CellAct and tested in Mouse. Immunogen ... Acute lymphoblastic leukemia cells antigen CD38 antibody. *ADP ribosyl cyclase 1 antibody ... Anti-CD38 antibody [90] (FITC) images. * Flow Cytometry - CD38 antibody [90] (FITC) (ab24978) ... References for Anti-CD38 antibody [90] (FITC) (ab24978). ab24978 has not yet been referenced specifically in any publications. ...
more infohttp://www.abcam.com/cd38-antibody-90-fitc-ab24978.html

Practical Considerations for the Use of Daratumumab, a Novel CD38 Monoclonal Antibody, in Myeloma | SpringerLinkPractical Considerations for the Use of Daratumumab, a Novel CD38 Monoclonal Antibody, in Myeloma | SpringerLink

Multiple Myeloma Bortezomib Lenalidomide Overall Response Rate Chimeric Antigen Receptor These keywords were added by machine ... Targeting CD38 with daratumumab monotherapy in multiple myeloma. N Engl J Med. 2015;373(13):1207-19.CrossRefPubMedGoogle ... Daratumumab is a CD38 mAb that has demonstrated substantial activity and good tolerability in four phase I, phase I/II and ... Deaglio S, Mehta K, Malavasi F. Human CD38: a (r)evolutionary story of enzymes and receptors. Leuk Res. 2001;25(1):1-12. ...
more infohttps://link.springer.com/article/10.1007%2Fs40265-016-0573-4

LLS Search Results | Leukemia and Lymphoma SocietyLLS Search Results | Leukemia and Lymphoma Society

CD38. An antigen on CLL cells and other cells. The expression of CD38 may be a marker to assist in predicting CLL progression. ... CD38. An antigen on CLL cells and other cells. The expression of CD38 may be a marker to assist in predicting CLL progression. ...
more infohttps://www.lls.org/llssearch?page=9&search-terms=cll&search_language=en

LLS Search Results | Leukemia and Lymphoma SocietyLLS Search Results | Leukemia and Lymphoma Society

CD38. An antigen on CLL cells and other cells. The expression of CD38 may be a marker to assist in predicting CLL progression. ... CD38. An antigen on CLL cells and other cells. The expression of CD38 may be a marker to assist in predicting CLL progression. ...
more infohttps://www.lls.org/llssearch?page=4&search-terms=cll&search_language=en

Multi-color CD34⁺ progenitor-focused flow cytometric assay in evaluation of myelodysplastic syndromes in patients with post...Multi-color CD34⁺ progenitor-focused flow cytometric assay in evaluation of myelodysplastic syndromes in patients with post...

CD38, CD117, and CD123; aberrant expression of lymphoid or mature myelomonocytic antigens on CD34(+) myeloblasts; and several ...
more infohttps://www.ncbi.nlm.nih.gov/pubmed/22626984?dopt=Abstract

KEGG BRITE: CD Molecules - Homo sapiens (human)KEGG BRITE: CD Molecules - Homo sapiens (human)

CD36 antigen K06475 CD37; CD37 antigen K01242 CD38; ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20] K01510 ENTPD1_3_8; apyrase [EC ... CD79A antigen K06507 CD79B; CD79B antigen K05412 CD80; CD80 antigen K06508 CD81; CD81 antigen K06509 KAI1; CD82 antigen K06510 ... CD300 antigen K06719 CD300; CD300 antigen K06719 CD300; CD300 antigen K06719 CD300; CD300 antigen K06721 CLEC10A; C-type lectin ... CD96 antigen K08446 ADGRE5; CD97 antigen K06519 SLC3A2; solute carrier family 3, member 2 K06520 CD99; CD99 antigen K06521 ...
more infohttps://www.genome.jp/kegg-bin/get_htext?hsa04090+4486

GO Gene ListGO Gene List

Cd38. CD38 antigen. NM_007646. Gene Info. Cenpv. Centromere protein V. NM_028448. Gene Info. ...
more infohttps://cgap.nci.nih.gov/Genes/GoGeneQuery?PAGE=1&ORG=Mm&GOID=0016829

JCI -
Resolution of immune activation defines nonpathogenic SIV infectionJCI - Resolution of immune activation defines nonpathogenic SIV infection

CD38, antigen identified by monoclonal antibody Ki-67 [MKI67]); and elevated serum levels of proinflammatory cytokines ... CD38, chemokines, cell cycling genes) and CD8+ T cell exhaustion (e.g., lymphocyte-activation gene 3 [LAG3], T cell ... primary producers of type I IFN with the inherent ability to present viral antigens to T cells. HIV induction of IFNs by pDCs, ...
more infohttps://www.jci.org/articles/view/41509

Gene InfoGene Info

CD38 antigen. Protein Similarities Based on Shared Motif Content. Find gene products sharing protein motifs with: NP_031672 ...
more infohttps://cgap.nci.nih.gov/Genes/GeneInfo?ORG=Mm&CID=249873&LLNO=12494

Bone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [PerCP] (NBP2-37711PCP): Novus BiologicalsBone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [PerCP] (NBP2-37711PCP): Novus Biologicals

Mouse Monoclonal Anti-Bone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [PerCP]. Validated: WB, Flow, IHC-Fr. Tested ... Additional Bone marrow stromal cell antigen 1/CD157 Products. Bone marrow stromal cell antigen 1/CD157 NBP2-37711PCP * Bone ... Blogs on Bone marrow stromal cell antigen 1/CD157. There are no specific blogs for Bone marrow stromal cell antigen 1/CD157, ... Home » Bone marrow stromal cell antigen 1/CD157 » Bone marrow stromal cell antigen 1/CD157 Antibodies » Bone marrow stromal ...
more infohttps://www.novusbio.com/products/bone-marrow-stromal-cell-antigen-1-cd157-antibody-sy11b5_nbp2-37711pcp

Single-Cell RNA Sequencing Reveals Expanded Clones of Islet Antigen-Reactive CD4+ T Cells in Peripheral Blood of Subjects with...Single-Cell RNA Sequencing Reveals Expanded Clones of Islet Antigen-Reactive CD4+ T Cells in Peripheral Blood of Subjects with...

... and CD38-Pacific Blue (HB7; eBioscience). Cells were gated as shown in Supplemental Fig. 2: lymphocytes, singlets, CD4+Via- ... Antigen-reactive T cell enrichment for direct, high-resolution analysis of the human naive and memory Th cell repertoire. J. ... Microbial antigen mimics activate diabetogenic CD8 T cells in NOD mice. J. Exp. Med. 213: 2129-2146. ... Linking the T cell receptor to the single cell transcriptome in antigen-specific human T cells. Immunol. Cell Biol. 94: 604-611 ...
more infohttp://www.jimmunol.org/content/199/1/323
  • 13 , 14 , 18 Further evidence for the presence of antigen-specific CD4 T cells is the production of high-affinity, isotype-switched antibodies to HIV-1, which presumably requires the provision of help for B-cell responses by CXCR5 + CD4 + follicular helper T cells. (bloodjournal.org)
  • Protein-tyrosine phosphorylation by IgG1 subclass CD38 monoclonal antibodies is mediated through stimulation of the FcgammaII receptors in human myeloid cell lines. (springer.com)
  • Antibodies to CD38 are useful in subtyping of lymphomas and leukemias, detection of plasma cells (i.e. identification of myelomas), and as a marker for activated B and T cells. (thermofisher.com)
  • Protein tyrosine phosphorylation by IgG1-subclass CD38 monoclonal antibodies is mediated through stimulation of the Fc γ II receptors in human myeloid cell lines. (nii.ac.jp)
  • Thus, a screening assay for irregular antibodies against red blood cell antigens or a direct immunoglobulin test can produce false-positive results. (wikipedia.org)
  • Provided are antibodies, and antigen-binding fragments thereof, which specifically bind to an extracellular poor loop of an alpha 1a subunit of L-type voltage. (patents.com)
  • The study gives a unique perspective into this therapeutic strategy because the three other anti-CD38 cytolytic antibodies in clinical development (daratumumab, isatuximab, and MOR202) cannot be tested in similar models because they do not crossreact with CD38 expressed by new world primates. (aspetjournals.org)
  • Antibodies against SLAMF7, CD38, B-cell maturation antigen and PD-1 have been developed and clinical trials are curre. (bioportfolio.com)
  • The cross-talk results in collaboration between B and T cells and production of antibodies directed against the antigen. (pnas.org)
  • Soluble CD38 catalyzed the formation and hydrolysis of cADPR when added to NAD+. (uab.edu)
  • Purified cADPR augmented the proliferative response of activated murine B cells, potentially implicating the enzymatic activity of CD38 in lymphocyte function. (uab.edu)
  • CD38 is a multifunctional ectoenzyme that catalyzes the synthesis and hydrolysis of cyclic ADP-ribose (cADPR) from NAD+ to ADP-ribose. (news-medical.net)
  • Although CD4 + T cells that proliferate in vitro in response to HIV-1 antigens are mostly absent in untreated chronically infected subjects, an average of approximately 0.1% of peripheral blood CD4 + T cells capable of producing IFN-γ can be detected in most HIV-infected individuals by enzyme-linked immunospot (ELISPOT) assay or by intracellular cytokine assay. (bloodjournal.org)
  • The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. (creative-biolabs.com)
  • The antigen-binding repertoire of the surface immunoglobulin is already unique for each clone, as a result of selective usage in each cell of different variable (V), diversity (D), and joining (J) region sequences, accompanied by the generation of random-linking N sequences (via the action of terminal transferase). (bloodjournal.org)
  • Conclusions: In one third of MM patients CD117 antigen could be considered as a „tumour associated marker" and it may be of value for the identification of the malignant clone in minimal residual disease. (termedia.pl)
  • Such factors include those common to all mAbs, namely infusion-related reactions, but also factors that are observed with mAbs used in myeloma, such as interference with response assessment, or factors that are related to CD38 mAbs such as daratumumab, for instance blood typing interference. (springer.com)
  • In this study, we describe the cytotoxic mechanisms of action of daratumumab, a novel, high-affinity, therapeutic human mAb against a unique CD38 epitope. (jimmunol.org)
  • Daratumumab induced potent Ab-dependent cellular cytotoxicity in CD38-expressing lymphoma- and MM-derived cell lines as well as in patient MM cells, both with autologous and allogeneic effector cells. (jimmunol.org)
  • Daratumumab stood out from other CD38 mAbs in its strong ability to induce complement-dependent cytotoxicity in patient MM cells. (jimmunol.org)
  • Collectively, our results show the versatility of daratumumab to effectively kill CD38-expressing tumor cells, including patient MM cells, via diverse cytotoxic mechanisms. (jimmunol.org)
  • These findings support clinical development of daratumumab for the treatment of CD38-positive MM tumors. (jimmunol.org)
  • The use of Daratumumab can interfere with pre- Blood transfusion tests, as CD38 is weakly expressed on the surface of erythrocytes . (wikipedia.org)
  • CD31 is the ligand of CD38. (biolegend.com)
  • CD31 has been reported to bind CD38 and be involved in wound healing, angiogenesis, and cellular migration in an inflammatory situation. (biolegend.com)
  • One of the known ligands that activates CD38-mediated signaling is CD31 (Deaglio, 2001). (merckmillipore.com)
  • to their strong reactivity for CD38, CD138 (syndecan-1) and their typical light scatter distribution. (termedia.pl)
  • Interferon (IFN)-γ producing antigen-specific CD4 + T cells have been demonstrated in primary HIV-1 infection, despite high levels of viremia. (bloodjournal.org)
  • The CBMG pipeline includes preclinical compounds targeting CD20-, CD22- and B-cell maturation antigen (BCMA)-specific CAR-T compounds, and T-cell receptor (TCR) and tumor infiltrating lymphocyte (TIL) technologies. (pipelinereview.com)
  • 1996). Human CD38 ligand. (springer.com)
  • Identification and characterization of an active soluble form of human CD38 in normal and pathological fluids. (springer.com)
  • The vector of anti-CD38 chimeric antigen receptor (CAR) is constructed for the engineering of T cells to target Human CD38. (creative-biolabs.com)
  • CD38, a disease marker for human leukemias and myelomas, plays a role in the pathogenesis and outcome of human immunodeficiency virus infection and chronic lymphocytic leukemia, and controls insulin release and also the development of diabetes. (miltenyibiotec.com)
  • Chronically inflamed human bronchus: immunohistochemical staining for CD38 antigen using NCL-CD38-290. (leicabiosystems.com)
  • We exposed primary human peripheral blood monocytes to V3 lipopeptides using a liposome delivery system followed by a superantigen-mediated antigen presentation system. (biomedcentral.com)
  • Potentiation of chemotactic peptide-induced superoxide generation by CD38 ligation in human myeloid cell lines. (nii.ac.jp)
  • Synthesis and hydrolysis of cyclic ADP-ribose by human leukocyte antigen CD38 and inhibition of the hydrolysis by ATP. (nii.ac.jp)
  • We have previously demonstrated that the presence of specific gp120/V3 peptides during antigen presentation can modify the activation of normal T-cells leading to altered immune function. (biomedcentral.com)
  • B cells then enter the germinal centers of secondary lymphoid follicles and undergo a process of random hypermutation in theirV immunoglobulin region genes, under the influence of activation-induced cytidine deaminase (AID), resulting in yet more diversity in the antigen-binding repertoire of their surface immunoglobulin. (bloodjournal.org)
  • The GC is the region of secondary lymphoid tissue where antigen-activated B cells undergo proliferation, class switch recombination (CSR), somatic hypermutation (SHM), antigen selection, and affinity maturation ( 28 , 29 , 31 ). (asm.org)
  • B cells within the germinal center then perish through spontaneous apoptosis unless their surface immunoglobulin binds with high affinity to antigen (present within immune complexes) on follicular dendritic cells. (bloodjournal.org)
  • TAK-079 binds to monkey CD38 with an affinity at EC 50 4.5 nM, and the potential activity of TAK-079 was investigated in a monkey collagen-induced arthritis model of autoimmune disease. (aspetjournals.org)
  • A prerequisite for such receptor cross-talk is that the B cell receptor binds antigen. (pnas.org)
  • In this immunotherapy, autologous T cells are engineered to express an artificial receptor which targets a tumor-associated antigen and initiates the T-cell killing procedure. (springer.com)
  • Theoretically, CAR-T cells can specifically localize and eliminate tumor cells by interacting with the tumor-associated antigens (TAAs) expressing on tumor cell surface. (springermedizin.de)
  • Chmielewski M, Hombach AA, Abken H. Of CARs and TRUCKs: chimeric antigen receptor (CAR) T cells engineered with an inducible cytokine to modulate the tumor stroma. (springermedizin.de)
  • Administration of anti-CTLA-4 Ab exacerbated autoimmune responses in a murine model of multiple sclerosis or insulin-dependent diabetes mellitus (IDDM [5-, enhanced tumor immunity ( 8 ), or prevented the induction of immunologic tolerance to concurrently administered non-self-antigens ( 9 ). (rupress.org)
  • CD38 is expressed on a variety of hematopoietic and non-hematopoietic cells and is involved in diverse processes such as generation of calcium-mobilizing metabolites, cell activation, and chemotaxis. (miltenyibiotec.com)
  • The B cell receptors (BCRs) for antigen express variable (V) regions that are enormously diverse, thus serving as markers on individual B cells. (pnas.org)
  • Antigen-specific memory CD4 + T cells are not often found in untreated chronic HIV-1 infection, using the standard in vitro proliferation assay. (bloodjournal.org)
  • Crosslinking of CD38 on the surface of mature, resting B cells induces B-cell proliferation, which is enhanced by co-signals such as IL-4 and LPS. (thermofisher.com)
  • The most statistically significant enriched categories and networks identified by IPA were associated with cell cycle, gene expression, immune response, infection mechanisms, cellular growth, proliferation and antigen presentation. (biomedcentral.com)
  • When the CD25 + CD4 + T cells are stimulated via the T cell receptor in vitro, they potently suppress antigen-specific and polyclonal activation and proliferation of other T cells, including CTLA-4-deficient T cells, and blockade of CTLA-4 abrogates the suppression. (rupress.org)
  • The cells do not express B-cell lineage restricted antigens or kappa or lambda immunoglobulin light chains or T-cell lineage-restricted antigens. (atcc.org)
  • The CD38 protein is a marker of cell activation. (news-medical.net)
  • Characterization of a CD38-like 78-kilodalton soluble protein released from B cell lines derived from patients with X-linked agammaglobulinemia. (springer.com)
  • CD38 participates in cell adhesion, signal transduction and calcium signaling. (thermofisher.com)
  • It transmits an activation signal to the T cell after antigen is bound. (creative-biolabs.com)
  • Among these approaches, chimeric antigen receptor (CAR) T-cell therapy is the most promising star, based on the results of previous success in B-cell neoplasms. (springer.com)
  • In this review article, we summarize six promising candidate antigens in MM that can be targeted by CARs and discuss some noteworthy studies of the safety profile of current CAR T-cell therapy. (springer.com)
  • The chimeric antigen receptor T (CAR-T) cell therapy is a newly developed adoptive antitumor treatment. (springermedizin.de)
  • The CTLp assay is dependent on cell growth in vitro in response to antigen stimulation, which is subject to many experimental variables. (asm.org)
  • Tyrosine phosphorylation of the c-cbl protooncogene product mediated by cell surface antigen CD38 in HL-60 cells. (nii.ac.jp)
  • This report shows that cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) plays a key role in T cell-mediated dominant immunologic self-tolerance. (rupress.org)
  • CTL-associated antigen 4 (CTLA-4 [CD is a CD28 homologue expressed on activated T cells and, upon interaction with CD80 or CD86 on APCs, exerts a downregulatory or attenuating effect on T cell-mediated immune responses ( 1 )( 2 ). (rupress.org)
  • We hypothesized that antigen-specific T cell responses are modulated by an inhibitory T cell phenotype and modified dendritic cell (DC) phenotype in a gestation-dependent manner. (frontiersin.org)
  • We analyzed changes in surface markers of peripheral blood T cells, ex vivo antigen-specific T cell responses, indoleamine 2,3-dioxygenase (IDO) activity (kynurenine/tryptophan ratio, KTR), plasma neopterin concentration, and the in vitro expression of progesterone-induced blocking factor (PIBF) in response to peripheral blood mononuclear cell culture with progesterone. (frontiersin.org)
  • Conversely, antigen-specific T cell responses normalized in late pregnancy and were associated with increased markers of T cell activation (CD38, neopterin). (frontiersin.org)
  • Definition of cell immunophenotype in acute leukemias is commonly employed to identify malignant line, maturation stage and finally pattern of antigen expression in individual patients what permits better monitoring of treatment and residual disease. (termedia.pl)
  • In this highly competitive environment, failure to successfully compete for antigen and T-cell help leads to apoptosis, whereas success results in the production of plasma cells or memory cells ( 29 ). (asm.org)
  • 5 This deficit of antigen-specific CD4 + T cells may represent a major impediment to immune control of HIV-1 infection. (bloodjournal.org)
  • Previous studies of primary immune responses to viral infection in mice have shown that antigen-specific T-helper 1 (Th1) CD4 responses can be readily detected in the early stages of the infection, but rapidly decline as antigen is cleared. (bloodjournal.org)
  • The loss of CD38 function is associated with impaired immune responses, metabolic disturbances, and behavioral modifications. (news-medical.net)
  • Various regulatory mechanisms repress maternal immune function and the response against fetal antigens, in particular at the maternal-fetal interface. (frontiersin.org)
  • Diseases associated with CD38 dysfunction include chronic lymphocytic leukemia and Richter's Syndrome. (thermofisher.com)
  • A complementary DNA encoding the extracellular domain of murine CD38 was constructed and expressed, and the resultant recombinant soluble CD38 was purified to homogeneity. (uab.edu)
  • BACKGROUND: Rh phenotype is an extremely rare condition characterized by no expression of Rh antigens at the surface of red blood cells. (bireme.br)
  • We have shown previously that antigen presentation can be deregulated by the presence of V3 epitopes on the surface of macrophages. (biomedcentral.com)
  • Pharmacologic modulation of plasma cells is challenging because these cells are not actively cycling, cease expressing most surface antigens (e.g. (aspetjournals.org)